G4LXG8_SCHMA Loading...

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Involved in the interferon/all-trans-retinoic acid (IFN/RA) induced cell death. This apoptotic activity is inhibited by interaction with viral IRF1. Prevents the transactivation of STAT3 target genes. May play a role in CARD15-mediated innate mucosal responses and serve to regulate intestinal epithelial cell responses to microbes. Complex I functions in the transfer of electrons from NADH to the respiratory chain. Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis.

AlphaFold DB , UniProt , Accession G4LXG8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 148 aa.

						>G4LXG8_SCHMA|G4LXG8
MPGYKQEMPPPGGFAPIDVSRKMPKGYVHGLITLGALYTSTYVGLKVLKYMKGKQTKINREDQECRIALAPFIIAEQERLYLKQLRKNREYEQNLMGDVAGWKIGHWFDYPVYHNPRGLWCDPDINEFYAHVADCDKDLRRKVRYRYS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	55.6	Low	79.8	Confident	233 Å²	233	139.5 Å²	139.5	100%	1.148	75%	0.751	S	S	*	*				0	121.1	0	-65	173.5	170.1	0	0	106.9	G3	M1-G3 PolarHBondContact O-N 2.72Å
2	P	66	Low	80.6	Confident	137 Å²	137	135.3 Å²	135.3	89%	0.89	76%	0.764	S	S	*	*	P	Polyproline II helix	trans	-66	125.9	176.3	28.7	-30.6	0	0	0	108	Y4	P2-Y4 PolarHBondContact O-N 3.31Å
3	G	75.6	Confident	81.3	Confident	76 Å²	76	128.1 Å²	128.1	78%	0.784	74%	0.739	S	S	*	*	P	Polyproline II helix	trans	-65.4	127.8	-176.5	0	0	0	0	0	110.9	M1	M1-G3 PolarHBondContact O-N 2.72Å
4	Y	77	Confident	82.1	Confident	181 Å²	181	131.2 Å²	131.2	71%	0.71	74%	0.74	S	S	*	*	P	Polyproline II helix	trans	-69.6	135.8	171.1	83.3	-81.2	0	0	0	108.9	P2 Q6	P2-Y4 PolarHBondContact O-N 3.31Å; Y4-Q6 HydrophobicContact CD2-CB 3.62Å; Y4-Q6 HydrophobicContact CE2-CB 3.36Å; Y4-Q6 HydrophobicContact CE2-CG 4.4Å
5	K	80.6	Confident	82.7	Confident	192 Å²	192	127.9 Å²	127.9	84%	0.835	74%	0.736	S	S	*	*			trans	-108.1	98.5	169	-172.5	178.4	179.4	-174.2	0	106.7
6	Q	86.9	Confident	83.2	Confident	130 Å²	130	127.9 Å²	127.9	61%	0.607	74%	0.742	S	S	*	*			trans	-88	133.7	173.7	179.7	167	-5.8	0	0	109.3	Y4 M8	Y4-Q6 HydrophobicContact CD2-CB 3.62Å; Y4-Q6 HydrophobicContact CE2-CB 3.36Å; Y4-Q6 HydrophobicContact CE2-CG 4.4Å; Q6-M8 PolarHBondContact O-N 3.39Å
7	E	88	Confident	83.7	Confident	164 Å²	164	129.2 Å²	129.2	77%	0.766	74%	0.743	S	S	*	*			trans	-65.5	116	167.7	-65.1	-60.8	155.2	0	0	108
8	M	87	Confident	84.2	Confident	136 Å²	136	127.2 Å²	127.2	67%	0.67	73%	0.73	S	S	*	*			trans	-112.6	150.2	172.3	56	-179	67.6	0	0	108.1	Q6	Q6-M8 PolarHBondContact O-N 3.39Å
9	P	89.6	Confident	84.6	Confident	77 Å²	77	127.8 Å²	127.8	50%	0.5	74%	0.735	S	S	.	*			trans	-54.4	148.6	168	25.5	-33.8	0	0	0	108.9	F14	P9-F14 HydrophobicContact CB-CD2 4.27Å; P9-F14 HydrophobicContact CB-CE2 3.91Å
10	P	88.1	Confident	85	Confident	68 Å²	68	124.9 Å²	124.9	44%	0.442	72%	0.723	S	S	.	*			trans	-54.6	145.6	178.9	23.7	-33.2	0	0	0	109.7	G12 G13	P10-G12 PolarHBondContact O-N 2.8Å; P10-G13 PolarHBondContact O-N 2.92Å
11	P	83	Confident	85.4	Confident	141 Å²	141	128.6 Å²	128.6	92%	0.916	73%	0.725	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.8	110.5	174.1	23.7	-31.7	0	0	0	108.6
12	G	89.9	Confident	87	Confident	88 Å²	88	125 Å²	125	91%	0.907	70%	0.703	S	S	*	*	T	Hydrogen-bonded Turn	trans	122.2	-11.5	-169.5	0	0	0	0	0	115.4	P10	P10-G12 PolarHBondContact O-N 2.8Å
13	G	90.1	Very high	88.1	Confident	42 Å²	42	124.3 Å²	124.3	43%	0.433	69%	0.689	S	S	.	*			trans	76.3	173.5	180	0	0	0	0	0	113.9	P10	P10-G13 PolarHBondContact O-N 2.92Å
14	F	91.4	Very high	88.6	Confident	172 Å²	172	126.4 Å²	126.4	75%	0.754	69%	0.689	S	S	*	*	P	Polyproline II helix	trans	-79.7	153.3	171.2	-68	-74.3	0	0	0	110.7	P9	P9-F14 HydrophobicContact CB-CD2 4.27Å; P9-F14 HydrophobicContact CB-CE2 3.91Å
15	A	91	Very high	89	Confident	82 Å²	82	126.9 Å²	126.9	68%	0.678	70%	0.695	S	S	*	*	P	Polyproline II helix	trans	-58.2	141.5	171.4	0	0	0	0	0	110.3	I17	A15-I17 PolarHBondContact O-N 3.12Å
16	P	91.3	Very high	89.1	Confident	128 Å²	128	121 Å²	121	83%	0.831	69%	0.689	S	S	*	*	P	Polyproline II helix	trans	-62.2	128.9	179.5	25.2	-33.2	0	0	0	110.6
17	I	91.7	Very high	88.7	Confident	149 Å²	149	125.3 Å²	125.3	76%	0.764	70%	0.701	S	S	*	*	P	Polyproline II helix	trans	-85.1	117	175.9	-56.8	171	0	0	0	108.1	A15 V19	A15-I17 PolarHBondContact O-N 3.12Å; I17-V19 HydrophobicContact CG2-CG1 4.26Å; I17-V19 PolarHBondContact O-N 3.5Å
18	D	92.3	Very high	88.6	Confident	94 Å²	94	122.8 Å²	122.8	50%	0.503	70%	0.696	S	S	.	*			trans	-81.3	98.2	175.3	-172.7	-0.5	0	0	0	110.4	S20 K22	D18-S20 VanDerWaalsContact CG-OG 3.31Å; D18-S20 PolarHBondContact O-N 3.17Å; D18-S20 WeakPolarHBondContact OD1-CB 3.47Å; D18-S20 PolarHBondContact OD1-N 3.36Å; D18-S20 PolarHBondContact OD1-OG 3.46Å; D18-S20 PolarHBondContact OD2-OG 3.12Å; D18-K22 WeakPolarHBondContact OD2-CE 3.46Å; D18-K22 IonicContact OD2-NZ 2.68Å; D18-K22 PolarHBondContact OD2-NZ 3.19Å
19	V	93	Very high	88.6	Confident	138 Å²	138	122.2 Å²	122.2	84%	0.836	69%	0.692	S	S	*	*			trans	-82.6	5.1	175.9	-78.1	0	0	0	0	113.4	I17	I17-V19 HydrophobicContact CG2-CG1 4.26Å; I17-V19 PolarHBondContact O-N 3.5Å
20	S	92.9	Very high	88.6	Confident	69 Å²	69	120.4 Å²	120.4	48%	0.483	69%	0.687	S	S	.	*	S	Bend	trans	-70.2	141.9	178.5	71.1	0	0	0	0	112.3	D18 K22	D18-S20 VanDerWaalsContact CG-OG 3.31Å; D18-S20 PolarHBondContact O-N 3.17Å; D18-S20 WeakPolarHBondContact OD1-CB 3.47Å; D18-S20 PolarHBondContact OD1-N 3.36Å; D18-S20 PolarHBondContact OD1-OG 3.46Å; D18-S20 PolarHBondContact OD2-OG 3.12Å; S20-K22 PolarHBondContact O-N 3.16Å; S20-K22 VanDerWaalsContact O-N 3.11Å
21	R	93	Very high	88.8	Confident	204 Å²	204	123.3 Å²	123.3	77%	0.77	70%	0.699	S	S	*	*			trans	-73	104.1	175.6	-178.9	176.4	167.3	178.8	-6.9	110.1	M23	R21-M23 HydrophobicContact CG-CG 4.02Å; R21-M23 VanDerWaalsContact CZ-SD 3.59Å; R21-M23 VanDerWaalsContact NE-CE 3.29Å; R21-M23 PolarHBondContact NH2-SD 3.05Å; R21-M23 PolarHBondContact O-N 3.21Å
22	K	89.6	Confident	89.3	Confident	157 Å²	157	121.6 Å²	121.6	68%	0.683	68%	0.68	S	S	*	*			trans	-88.2	95.2	172.1	-62.7	-179.7	-175.4	173.5	0	110.3	D18 S20	D18-K22 WeakPolarHBondContact OD2-CE 3.46Å; D18-K22 IonicContact OD2-NZ 2.68Å; D18-K22 PolarHBondContact OD2-NZ 3.19Å; S20-K22 PolarHBondContact O-N 3.16Å; S20-K22 VanDerWaalsContact O-N 3.11Å
23	M	88	Confident	89.5	Confident	122 Å²	122	120.8 Å²	120.8	60%	0.601	66%	0.658	S	S	*	*	P	Polyproline II helix	trans	-78.4	131	171.7	-62	-164.8	-129.1	0	0	110	R21 K25	R21-M23 HydrophobicContact CG-CG 4.02Å; R21-M23 VanDerWaalsContact CZ-SD 3.59Å; R21-M23 VanDerWaalsContact NE-CE 3.29Å; R21-M23 PolarHBondContact NH2-SD 3.05Å; R21-M23 PolarHBondContact O-N 3.21Å; M23-K25 PolarHBondContact O-N 3.3Å
24	P	87.1	Confident	89.8	Confident	120 Å²	120	124.1 Å²	124.1	78%	0.779	67%	0.665	S	S	*	*	P	Polyproline II helix	trans	-62.9	133.3	172.1	27.1	-32.7	0	0	0	109	G26	P24-G26 PolarHBondContact O-N 3.36Å
25	K	83.6	Confident	90.1	Very high	191 Å²	191	117.5 Å²	117.5	83%	0.83	65%	0.646	S	S	*	*	P	Polyproline II helix	trans	-67.7	127.6	174.1	-67.7	-177.8	-179.4	178.3	0	108.4	M23 Y27	M23-K25 PolarHBondContact O-N 3.3Å; K25-Y27 PolarHBondContact O-N 2.96Å
26	G	83.4	Confident	90.4	Very high	69 Å²	69	116.1 Å²	116.1	71%	0.711	63%	0.634	S	S	*	*	P	Polyproline II helix	trans	-63.2	132.9	173.1	0	0	0	0	0	110.6	P24 V28	P24-G26 PolarHBondContact O-N 3.36Å; G26-V28 VanDerWaalsContact C-N 3.31Å; G26-V28 PolarHBondContact O-N 3.34Å
27	Y	79.2	Confident	90.6	Very high	220 Å²	220	115 Å²	115	86%	0.863	62%	0.621	S	S	*	*	S	Bend	trans	-75.7	-18.8	-178.2	-59.6	-77.5	0	0	0	113.5	K25	K25-Y27 PolarHBondContact O-N 2.96Å
28	V	85.5	Confident	90.9	Very high	111 Å²	111	116.1 Å²	116.1	67%	0.673	62%	0.617	S	S	*	*			trans	-95.6	104.7	-176.6	-70.3	0	0	0	0	110.7	G26 T33	G26-V28 VanDerWaalsContact C-N 3.31Å; G26-V28 PolarHBondContact O-N 3.34Å; V28-T33 HydrophobicContact CB-CG2 4.23Å
29	H	86.3	Confident	91.2	Very high	125 Å²	125	115.5 Å²	115.5	58%	0.579	62%	0.616	S	S	*	*			trans	-81.5	152.1	173.1	-163.8	62.7	0	0	0	111	L31 I32 T33	H29-L31 PolarHBondContact O-N 2.86Å; H29-I32 HydrophobicContact CB-CD1 4.12Å; H29-I32 HydrophobicContact CB-CG1 4.28Å; H29-I32 WeakPolarHBondContact O-CA 3.35Å; H29-I32 WeakPolarHBondContact O-CB 3.3Å; H29-I32 PolarHBondContact O-N 3.31Å; H29-T33 PolarHBondContact O-N 2.86Å; H29-T33 VanDerWaalsContact O-N 3.09Å
30	G	90.2	Very high	91.4	Very high	39 Å²	39	112.3 Å²	112.3	40%	0.402	60%	0.6	S	S	.	*	H	α-helix	trans	-58.5	-32.3	-177	0	0	0	0	0	114.2	T33 L34	G30-T33 WeakPolarHBondContact CA-OG1 3.45Å; G30-T33 PolarHBondContact O-N 3.08Å; G30-T33 PolarHBondContact O-OG1 3.2Å; G30-L34 WeakPolarHBondContact O-CG 3.44Å; G30-L34 PolarHBondContact O-N 3.4Å
31	L	92.6	Very high	91.7	Very high	129 Å²	129	112.4 Å²	112.4	68%	0.675	60%	0.598	S	S	*	*	H	α-helix	trans	-69	-33.8	174	-64.9	174.9	0	0	0	112.5	H29 G35	H29-L31 PolarHBondContact O-N 2.86Å; L31-G35 PolarHBondContact O-N 3.24Å
32	I	93.6	Very high	91.9	Very high	104 Å²	104	108.9 Å²	108.9	53%	0.533	59%	0.586	S	S	.	*	H	α-helix	trans	-69	-41.7	176.5	-60.9	173.3	0	0	0	109.5	H29 G35 A36	H29-I32 HydrophobicContact CB-CD1 4.12Å; H29-I32 HydrophobicContact CB-CG1 4.28Å; H29-I32 WeakPolarHBondContact O-CA 3.35Å; H29-I32 WeakPolarHBondContact O-CB 3.3Å; H29-I32 PolarHBondContact O-N 3.31Å; I32-G35 PolarHBondContact O-N 3.11Å; I32-A36 WeakPolarHBondContact O-CB 3.3Å; I32-A36 PolarHBondContact O-N 2.69Å
33	T	94.6	Very high	92.4	Very high	72 Å²	72	105.5 Å²	105.5	44%	0.442	58%	0.578	S	S	.	*	H	α-helix	trans	-66.1	-43	178.1	59.3	0	0	0	0	111.7	V28 H29 G30 A36 L37	V28-T33 HydrophobicContact CB-CG2 4.23Å; H29-T33 PolarHBondContact O-N 2.86Å; H29-T33 VanDerWaalsContact O-N 3.09Å; G30-T33 WeakPolarHBondContact CA-OG1 3.45Å; G30-T33 PolarHBondContact O-N 3.08Å; G30-T33 PolarHBondContact O-OG1 3.2Å; T33-A36 PolarHBondContact O-N 3.07Å; T33-L37 WeakPolarHBondContact O-CB 3.44Å; T33-L37 PolarHBondContact O-N 3.42Å
34	L	96.6	Very high	92.8	Very high	111 Å²	111	101.1 Å²	101.1	58%	0.581	56%	0.564	S	S	*	*	H	α-helix	trans	-63.3	-42.2	173.6	-70.1	175.2	0	0	0	112.1	G30 L37 Y38	G30-L34 WeakPolarHBondContact O-CG 3.44Å; G30-L34 PolarHBondContact O-N 3.4Å; L34-L37 PolarHBondContact O-N 3.33Å; L34-Y38 WeakPolarHBondContact O-CB 3.45Å; L34-Y38 PolarHBondContact O-N 3.46Å
35	G	96.6	Very high	93.4	Very high	33 Å²	33	100.7 Å²	100.7	34%	0.34	55%	0.554	S	S	.	*	H	α-helix	trans	-61.9	-42.3	174.7	0	0	0	0	0	112.7	L31 I32 Y38 T39	L31-G35 PolarHBondContact O-N 3.24Å; I32-G35 PolarHBondContact O-N 3.11Å; G35-Y38 PolarHBondContact O-N 3Å; G35-T39 WeakPolarHBondContact O-CB 3.32Å; G35-T39 VanDerWaalsContact O-CG2 3.26Å; G35-T39 WeakPolarHBondContact O-CG2 3.07Å; G35-T39 PolarHBondContact O-N 2.93Å; G35-T39 PolarHBondContact O-OG1 3.19Å
36	A	96.4	Very high	94.1	Very high	53 Å²	53	97.3 Å²	97.3	44%	0.438	54%	0.54	S	S	.	.	H	α-helix	trans	-65.7	-39.9	175.6	0	0	0	0	0	112	I32 T33 T39 S40	I32-A36 WeakPolarHBondContact O-CB 3.3Å; I32-A36 PolarHBondContact O-N 2.69Å; T33-A36 PolarHBondContact O-N 3.07Å; A36-T39 WeakPolarHBondContact CA-OG1 3.44Å; A36-T39 PolarHBondContact O-OG1 3.28Å; A36-T39 VanDerWaalsContact O-OG1 3.1Å; A36-S40 VanDerWaalsContact O-CB 3.27Å; A36-S40 WeakPolarHBondContact O-CB 3.45Å; A36-S40 PolarHBondContact O-N 3.21Å; A36-S40 PolarHBondContact O-OG 2.8Å
37	L	97.2	Very high	94.8	Very high	106 Å²	106	97.5 Å²	97.5	56%	0.555	53%	0.527	S	S	*	.	H	α-helix	trans	-64.7	-45.7	175.7	-179.7	63.1	0	0	0	111.2	T33 L34 S40 T41	T33-L37 WeakPolarHBondContact O-CB 3.44Å; T33-L37 PolarHBondContact O-N 3.42Å; L34-L37 PolarHBondContact O-N 3.33Å; L37-S40 WeakPolarHBondContact CA-OG 3.48Å; L37-S40 PolarHBondContact O-OG 3.32Å; L37-T41 WeakPolarHBondContact O-CB 3.27Å; L37-T41 PolarHBondContact O-N 3.04Å; L37-T41 PolarHBondContact O-OG1 3.06Å
38	Y	98.1	Very high	95.7	Very high	172 Å²	172	91.6 Å²	91.6	68%	0.675	51%	0.51	S	S	*	.	H	α-helix	trans	-64	-46.1	179.5	-177.3	-99.3	0	0	0	111.8	L34 G35 T41 Y42	L34-Y38 WeakPolarHBondContact O-CB 3.45Å; L34-Y38 PolarHBondContact O-N 3.46Å; G35-Y38 PolarHBondContact O-N 3Å; Y38-T41 PolarHBondContact O-N 3.19Å; Y38-Y42 WeakPolarHBondContact O-CB 3.41Å; Y38-Y42 PolarHBondContact O-N 3.13Å
39	T	97.9	Very high	96.3	Very high	81 Å²	81	94 Å²	94	50%	0.497	51%	0.511	S	S	.	.	H	α-helix	trans	-65.8	-44.4	179.2	51.1	0	0	0	0	112.2	G35 A36 T41 Y42 V43	G35-T39 WeakPolarHBondContact O-CB 3.32Å; G35-T39 VanDerWaalsContact O-CG2 3.26Å; G35-T39 WeakPolarHBondContact O-CG2 3.07Å; G35-T39 PolarHBondContact O-N 2.93Å; G35-T39 PolarHBondContact O-OG1 3.19Å; A36-T39 WeakPolarHBondContact CA-OG1 3.44Å; A36-T39 PolarHBondContact O-OG1 3.28Å; A36-T39 VanDerWaalsContact O-OG1 3.1Å; T39-T41 PolarHBondContact O-N 3.46Å; T39-Y42 PolarHBondContact O-N 3.41Å; T39-V43 WeakPolarHBondContact O-CB 3.38Å; T39-V43 VanDerWaalsContact O-CG2 3.3Å; T39-V43 WeakPolarHBondContact O-CG2 3.23Å; T39-V43 PolarHBondContact O-N 2.87Å
40	S	97.6	Very high	96.9	Very high	71 Å²	71	96.2 Å²	96.2	50%	0.497	52%	0.516	S	S	.	.	H	α-helix	trans	-62.8	-41.8	176.2	58.2	0	0	0	0	112.3	A36 L37 V43 G44	A36-S40 VanDerWaalsContact O-CB 3.27Å; A36-S40 WeakPolarHBondContact O-CB 3.45Å; A36-S40 PolarHBondContact O-N 3.21Å; A36-S40 PolarHBondContact O-OG 2.8Å; L37-S40 WeakPolarHBondContact CA-OG 3.48Å; L37-S40 PolarHBondContact O-OG 3.32Å; S40-V43 PolarHBondContact O-N 2.93Å; S40-G44 PolarHBondContact O-N 3.31Å
41	T	98.1	Very high	97.2	Very high	71 Å²	71	99.8 Å²	99.8	44%	0.436	52%	0.523	S	S	.	.	H	α-helix	trans	-63.7	-46.5	175.4	-55.4	0	0	0	0	111.3	L37 Y38 T39 V43 G44 L45	L37-T41 WeakPolarHBondContact O-CB 3.27Å; L37-T41 PolarHBondContact O-N 3.04Å; L37-T41 PolarHBondContact O-OG1 3.06Å; Y38-T41 PolarHBondContact O-N 3.19Å; T39-T41 PolarHBondContact O-N 3.46Å; T41-V43 PolarHBondContact O-N 3.46Å; T41-G44 PolarHBondContact O-N 2.95Å; T41-L45 HydrophobicContact CG2-CD1 4.26Å; T41-L45 HydrophobicContact CG2-CG 4.47Å; T41-L45 WeakPolarHBondContact O-CG 3.35Å; T41-L45 PolarHBondContact O-N 3.47Å
42	Y	98.4	Very high	97.5	Very high	130 Å²	130	100.9 Å²	100.9	51%	0.51	52%	0.523	S	S	.	.	H	α-helix	trans	-59.9	-46.9	178.1	177.4	-103.5	0	0	0	111.9	Y38 T39 L45 K46	Y38-Y42 WeakPolarHBondContact O-CB 3.41Å; Y38-Y42 PolarHBondContact O-N 3.13Å; T39-Y42 PolarHBondContact O-N 3.41Å; Y42-L45 PolarHBondContact O-N 3.31Å; Y42-K46 HydrophobicContact CE1-CG 4.26Å; Y42-K46 HydrophobicContact CE2-CD 4.5Å; Y42-K46 HydrophobicContact CE2-CG 4.39Å; Y42-K46 VanDerWaalsContact O-CG 3.29Å; Y42-K46 WeakPolarHBondContact O-CG 3.11Å; Y42-K46 PolarHBondContact O-N 2.73Å; Y42-K46 VanDerWaalsContact O-N 3.12Å
43	V	98.5	Very high	97.7	Very high	86 Å²	86	97.5 Å²	97.5	52%	0.521	51%	0.513	S	S	.	.	H	α-helix	trans	-61.6	-45.6	175.6	172.6	0	0	0	0	110.6	T39 S40 T41 L45 K46 V47	T39-V43 WeakPolarHBondContact O-CB 3.38Å; T39-V43 VanDerWaalsContact O-CG2 3.3Å; T39-V43 WeakPolarHBondContact O-CG2 3.23Å; T39-V43 PolarHBondContact O-N 2.87Å; S40-V43 PolarHBondContact O-N 2.93Å; T41-V43 PolarHBondContact O-N 3.46Å; V43-L45 PolarHBondContact O-N 3.36Å; V43-K46 PolarHBondContact O-N 3.21Å; V43-K46 VanDerWaalsContact O-N 3.16Å; V43-V47 HydrophobicContact CG1-CG2 4.4Å; V43-V47 WeakPolarHBondContact O-CG2 2.98Å; V43-V47 PolarHBondContact O-N 3.15Å
44	G	98.3	Very high	97.9	Very high	30 Å²	30	100.1 Å²	100.1	31%	0.309	52%	0.519	S	S	.	.	H	α-helix	trans	-56.7	-46.7	177.5	0	0	0	0	0	112.8	S40 T41 K46 V47 L48	S40-G44 PolarHBondContact O-N 3.31Å; T41-G44 PolarHBondContact O-N 2.95Å; G44-K46 VanDerWaalsContact C-N 3.33Å; G44-K46 PolarHBondContact O-N 3.27Å; G44-V47 PolarHBondContact O-N 2.97Å; G44-L48 WeakPolarHBondContact O-CB 2.8Å; G44-L48 WeakPolarHBondContact O-CG 3.24Å; G44-L48 PolarHBondContact O-N 3.25Å
45	L	98.4	Very high	97.9	Very high	110 Å²	110	99.8 Å²	99.8	58%	0.576	51%	0.514	S	S	*	.	H	α-helix	trans	-62.7	-38	177	-69.5	175.1	0	0	0	112.5	T41 Y42 V43 K49	T41-L45 HydrophobicContact CG2-CD1 4.26Å; T41-L45 HydrophobicContact CG2-CG 4.47Å; T41-L45 WeakPolarHBondContact O-CG 3.35Å; T41-L45 PolarHBondContact O-N 3.47Å; Y42-L45 PolarHBondContact O-N 3.31Å; V43-L45 PolarHBondContact O-N 3.36Å; L45-K49 WeakPolarHBondContact O-CB 3.41Å; L45-K49 PolarHBondContact O-N 3.03Å
46	K	98.3	Very high	98	Very high	120 Å²	120	101 Å²	101	52%	0.522	52%	0.515	S	S	.	.	H	α-helix	trans	-66.9	-42.4	176.9	-68	-75.3	-70.5	-163.8	0	111.6	Y42 V43 G44 K49 Y50	Y42-K46 HydrophobicContact CE1-CG 4.26Å; Y42-K46 HydrophobicContact CE2-CD 4.5Å; Y42-K46 HydrophobicContact CE2-CG 4.39Å; Y42-K46 VanDerWaalsContact O-CG 3.29Å; Y42-K46 WeakPolarHBondContact O-CG 3.11Å; Y42-K46 PolarHBondContact O-N 2.73Å; Y42-K46 VanDerWaalsContact O-N 3.12Å; V43-K46 PolarHBondContact O-N 3.21Å; V43-K46 VanDerWaalsContact O-N 3.16Å; G44-K46 VanDerWaalsContact C-N 3.33Å; G44-K46 PolarHBondContact O-N 3.27Å; K46-K49 PolarHBondContact O-N 2.91Å; K46-Y50 PolarHBondContact O-N 2.98Å
47	V	98.3	Very high	98.1	Very high	74 Å²	74	105.7 Å²	105.7	45%	0.448	53%	0.526	S	S	.	.	H	α-helix	trans	-64.3	-46.7	175.3	173.6	0	0	0	0	110.8	V43 G44 K49 Y50 M51	V43-V47 HydrophobicContact CG1-CG2 4.4Å; V43-V47 WeakPolarHBondContact O-CG2 2.98Å; V43-V47 PolarHBondContact O-N 3.15Å; G44-V47 PolarHBondContact O-N 2.97Å; V47-K49 VanDerWaalsContact C-N 3.32Å; V47-K49 PolarHBondContact O-N 3.43Å; V47-Y50 WeakPolarHBondContact O-CB 3.23Å; V47-Y50 PolarHBondContact O-N 3.45Å; V47-Y50 VanDerWaalsContact O-N 3.13Å; V47-M51 HydrophobicContact CG1-CG 4.28Å; V47-M51 HydrophobicContact CG1-SD 3.98Å; V47-M51 WeakPolarHBondContact O-CG 3.19Å; V47-M51 PolarHBondContact O-N 3.35Å
48	L	98.3	Very high	98.1	Very high	95 Å²	95	103.7 Å²	103.7	50%	0.497	52%	0.515	S	S	.	.	H	α-helix	trans	-58.5	-42.4	176.5	-74.6	172.9	0	0	0	112.1	G44 M51 K52	G44-L48 WeakPolarHBondContact O-CB 2.8Å; G44-L48 WeakPolarHBondContact O-CG 3.24Å; G44-L48 PolarHBondContact O-N 3.25Å; L48-M51 PolarHBondContact O-N 2.94Å; L48-K52 WeakPolarHBondContact O-CB 3.48Å; L48-K52 WeakPolarHBondContact O-CG 3.21Å; L48-K52 PolarHBondContact O-N 3.21Å
49	K	98.3	Very high	98.1	Very high	161 Å²	161	99 Å²	99	70%	0.7	50%	0.502	S	S	*	.	H	α-helix	trans	-62.1	-42.5	175.8	-175.3	176.3	-179.8	175.5	0	111.7	L45 K46 V47 G53	L45-K49 WeakPolarHBondContact O-CB 3.41Å; L45-K49 PolarHBondContact O-N 3.03Å; K46-K49 PolarHBondContact O-N 2.91Å; V47-K49 VanDerWaalsContact C-N 3.32Å; V47-K49 PolarHBondContact O-N 3.43Å; K49-G53 PolarHBondContact O-N 3.45Å
50	Y	98.1	Very high	98.1	Very high	172 Å²	172	102 Å²	102	68%	0.675	50%	0.504	S	S	*	.	H	α-helix	trans	-63.3	-47.7	176.1	175	-97.8	0	0	0	111.8	K46 V47 G53 K54	K46-Y50 PolarHBondContact O-N 2.98Å; V47-Y50 WeakPolarHBondContact O-CB 3.23Å; V47-Y50 PolarHBondContact O-N 3.45Å; V47-Y50 VanDerWaalsContact O-N 3.13Å; Y50-G53 PolarHBondContact O-N 3.07Å; Y50-K54 PolarHBondContact O-N 2.9Å
51	M	98	Very high	98.2	Very high	114 Å²	114	104.5 Å²	104.5	56%	0.562	51%	0.507	S	S	*	.	H	α-helix	trans	-61.9	-45	177.9	-69.7	-178.6	71.7	0	0	112.2	V47 L48 G53 K54 Q55	V47-M51 HydrophobicContact CG1-CG 4.28Å; V47-M51 HydrophobicContact CG1-SD 3.98Å; V47-M51 WeakPolarHBondContact O-CG 3.19Å; V47-M51 PolarHBondContact O-N 3.35Å; L48-M51 PolarHBondContact O-N 2.94Å; M51-G53 VanDerWaalsContact C-N 3.33Å; M51-G53 PolarHBondContact O-N 3.05Å; M51-K54 WeakPolarHBondContact O-CB 3.46Å; M51-K54 PolarHBondContact O-N 3.4Å; M51-Q55 PolarHBondContact O-N 3.38Å
52	K	98.1	Very high	98.2	Very high	152 Å²	152	105.4 Å²	105.4	66%	0.661	51%	0.51	S	S	*	.	H	α-helix	trans	-58.8	-44.8	173.8	-77.4	-176.5	175.2	-173.6	0	111.4	L48 K54 Q55 T56	L48-K52 WeakPolarHBondContact O-CB 3.48Å; L48-K52 WeakPolarHBondContact O-CG 3.21Å; L48-K52 PolarHBondContact O-N 3.21Å; K52-K54 VanDerWaalsContact C-N 3.31Å; K52-K54 PolarHBondContact O-N 3.37Å; K52-Q55 PolarHBondContact O-N 3.43Å; K52-T56 PolarHBondContact O-N 3.08Å; K52-T56 PolarHBondContact O-OG1 3.08Å
53	G	98	Very high	98.1	Very high	33 Å²	33	104.7 Å²	104.7	34%	0.34	51%	0.511	S	S	.	.	H	α-helix	trans	-59.2	-39.8	175.6	0	0	0	0	0	113	K49 Y50 M51 K57	K49-G53 PolarHBondContact O-N 3.45Å; Y50-G53 PolarHBondContact O-N 3.07Å; M51-G53 VanDerWaalsContact C-N 3.33Å; M51-G53 PolarHBondContact O-N 3.05Å; G53-K57 WeakPolarHBondContact O-CG 3.33Å; G53-K57 PolarHBondContact O-N 3.1Å
54	K	97.7	Very high	98.1	Very high	128 Å²	128	106.7 Å²	106.7	56%	0.557	52%	0.515	S	S	*	.	H	α-helix	trans	-64.2	-47.2	173.7	-175.4	177.9	177.3	-179.1	0	111.6	Y50 M51 K52 T56 K57 I58	Y50-K54 PolarHBondContact O-N 2.9Å; M51-K54 WeakPolarHBondContact O-CB 3.46Å; M51-K54 PolarHBondContact O-N 3.4Å; K52-K54 VanDerWaalsContact C-N 3.31Å; K52-K54 PolarHBondContact O-N 3.37Å; K54-T56 PolarHBondContact O-N 3.15Å; K54-K57 WeakPolarHBondContact O-CB 3.47Å; K54-K57 PolarHBondContact O-N 3.37Å; K54-I58 HydrophobicContact CG-CD1 4.39Å; K54-I58 PolarHBondContact O-N 2.94Å
55	Q	98	Very high	98.1	Very high	103 Å²	103	108.6 Å²	108.6	48%	0.481	52%	0.522	S	S	.	.	H	α-helix	trans	-62.7	-41.8	178.6	-170.5	62.2	41.1	0	0	112.2	M51 K52 K57 I58 N59	M51-Q55 PolarHBondContact O-N 3.38Å; K52-Q55 PolarHBondContact O-N 3.43Å; Q55-K57 VanDerWaalsContact C-N 3.27Å; Q55-K57 PolarHBondContact O-N 2.89Å; Q55-I58 PolarHBondContact O-N 3.24Å; Q55-N59 PolarHBondContact NE2-OD1 3.04Å; Q55-N59 VanDerWaalsContact O-CG 3.3Å; Q55-N59 PolarHBondContact O-N 2.95Å; Q55-N59 PolarHBondContact O-OD1 2.89Å
56	T	98.2	Very high	98	Very high	60 Å²	60	112.4 Å²	112.4	37%	0.368	53%	0.529	S	S	.	.	H	α-helix	trans	-62.4	-35	176.9	-57.8	0	0	0	0	112	K52 K54 R60	K52-T56 PolarHBondContact O-N 3.08Å; K52-T56 PolarHBondContact O-OG1 3.08Å; K54-T56 PolarHBondContact O-N 3.15Å; T56-R60 WeakPolarHBondContact O-CB 3.35Å; T56-R60 VanDerWaalsContact O-CG 3.25Å; T56-R60 WeakPolarHBondContact O-CG 3.46Å; T56-R60 PolarHBondContact O-N 3.14Å
57	K	98.1	Very high	98	Very high	151 Å²	151	112.6 Å²	112.6	66%	0.657	54%	0.535	S	S	*	.	H	α-helix	trans	-64.9	-46.2	174.7	-72.6	176.4	-179.4	-170.5	0	111.8	G53 K54 Q55 R60 E61	G53-K57 WeakPolarHBondContact O-CG 3.33Å; G53-K57 PolarHBondContact O-N 3.1Å; K54-K57 WeakPolarHBondContact O-CB 3.47Å; K54-K57 PolarHBondContact O-N 3.37Å; Q55-K57 VanDerWaalsContact C-N 3.27Å; Q55-K57 PolarHBondContact O-N 2.89Å; K57-R60 PolarHBondContact O-N 3.05Å; K57-E61 PolarHBondContact O-N 2.9Å
58	I	98	Very high	98	Very high	64 Å²	64	112.2 Å²	112.2	33%	0.328	54%	0.539	S	S	.	.	H	α-helix	trans	-60.8	-47.9	177	-63.4	166.8	0	0	0	110.4	K54 Q55 R60 E61 D62	K54-I58 HydrophobicContact CG-CD1 4.39Å; K54-I58 PolarHBondContact O-N 2.94Å; Q55-I58 PolarHBondContact O-N 3.24Å; I58-R60 PolarHBondContact O-N 3.37Å; I58-E61 WeakPolarHBondContact O-CB 3.49Å; I58-E61 PolarHBondContact O-N 3.05Å; I58-E61 VanDerWaalsContact O-N 3.16Å; I58-D62 PolarHBondContact O-N 3.24Å
59	N	98.1	Very high	98	Very high	74 Å²	74	112.4 Å²	112.4	40%	0.396	54%	0.54	S	S	.	.	H	α-helix	trans	-62.1	-33	179	-68	3.6	0	0	0	112.6	Q55 Q63	Q55-N59 PolarHBondContact NE2-OD1 3.04Å; Q55-N59 VanDerWaalsContact O-CG 3.3Å; Q55-N59 PolarHBondContact O-N 2.95Å; Q55-N59 PolarHBondContact O-OD1 2.89Å; N59-Q63 WeakPolarHBondContact O-CB 3.09Å; N59-Q63 WeakPolarHBondContact O-CG 3.5Å; N59-Q63 PolarHBondContact O-N 3.39Å
60	R	98.2	Very high	98	Very high	144 Å²	144	106.4 Å²	106.4	54%	0.543	52%	0.52	S	S	.	.	H	α-helix	trans	-69.7	-43.9	175.1	-77.6	173.8	-176.2	160	1.1	111.4	T56 K57 I58 D62 Q63 E64	T56-R60 WeakPolarHBondContact O-CB 3.35Å; T56-R60 VanDerWaalsContact O-CG 3.25Å; T56-R60 WeakPolarHBondContact O-CG 3.46Å; T56-R60 PolarHBondContact O-N 3.14Å; K57-R60 PolarHBondContact O-N 3.05Å; I58-R60 PolarHBondContact O-N 3.37Å; R60-D62 VanDerWaalsContact C-N 3.33Å; R60-D62 PolarHBondContact O-N 3.43Å; R60-Q63 WeakPolarHBondContact O-CB 3.22Å; R60-Q63 PolarHBondContact O-N 3.28Å; R60-Q63 VanDerWaalsContact O-N 3.16Å; R60-E64 WeakPolarHBondContact O-CB 3.39Å; R60-E64 VanDerWaalsContact O-CG 3.31Å; R60-E64 WeakPolarHBondContact O-CG 3.44Å; R60-E64 PolarHBondContact O-N 3.29Å
61	E	98.3	Very high	97.9	Very high	122 Å²	122	102 Å²	102	57%	0.57	51%	0.513	S	S	*	.	H	α-helix	trans	-57.3	-46.5	173.9	-174.3	177.4	-178.5	0	0	110.8	K57 I58 Q63 E64 C65	K57-E61 PolarHBondContact O-N 2.9Å; I58-E61 WeakPolarHBondContact O-CB 3.49Å; I58-E61 PolarHBondContact O-N 3.05Å; I58-E61 VanDerWaalsContact O-N 3.16Å; E61-Q63 VanDerWaalsContact C-N 3.34Å; E61-Q63 PolarHBondContact O-N 3.33Å; E61-E64 PolarHBondContact O-N 3.02Å; E61-C65 WeakPolarHBondContact O-CB 3.35Å; E61-C65 PolarHBondContact O-N 3.41Å; E61-C65 PolarHBondContact O-SG 3.48Å
62	D	97.8	Very high	97.9	Very high	91 Å²	91	103.3 Å²	103.3	49%	0.487	52%	0.516	S	S	.	.	H	α-helix	trans	-60.4	-41	175.1	-72	-22.4	0	0	0	112.4	I58 R60 R66	I58-D62 PolarHBondContact O-N 3.24Å; R60-D62 VanDerWaalsContact C-N 3.33Å; R60-D62 PolarHBondContact O-N 3.43Å; D62-R66 VanDerWaalsContact O-CG 3.29Å; D62-R66 WeakPolarHBondContact O-CG 3.49Å; D62-R66 PolarHBondContact O-N 3.02Å
63	Q	98	Very high	97.9	Very high	114 Å²	114	99.9 Å²	99.9	53%	0.533	50%	0.504	S	S	.	.	H	α-helix	trans	-66.9	-42.5	176.9	-76.6	175.4	-36.8	0	0	112.1	N59 R60 E61 R66 I67	N59-Q63 WeakPolarHBondContact O-CB 3.09Å; N59-Q63 WeakPolarHBondContact O-CG 3.5Å; N59-Q63 PolarHBondContact O-N 3.39Å; R60-Q63 WeakPolarHBondContact O-CB 3.22Å; R60-Q63 PolarHBondContact O-N 3.28Å; R60-Q63 VanDerWaalsContact O-N 3.16Å; E61-Q63 VanDerWaalsContact C-N 3.34Å; E61-Q63 PolarHBondContact O-N 3.33Å; Q63-R66 PolarHBondContact O-N 3.31Å; Q63-I67 VanDerWaalsContact O-CG1 3.27Å; Q63-I67 WeakPolarHBondContact O-CG1 3.39Å; Q63-I67 PolarHBondContact O-N 3.46Å
64	E	98.4	Very high	97.8	Very high	129 Å²	129	102.3 Å²	102.3	60%	0.603	51%	0.508	S	S	*	.	H	α-helix	trans	-62.4	-44.6	176.5	-74.1	171	-166.7	0	0	110.8	R60 E61 R66 I67 A68	R60-E64 WeakPolarHBondContact O-CB 3.39Å; R60-E64 VanDerWaalsContact O-CG 3.31Å; R60-E64 WeakPolarHBondContact O-CG 3.44Å; R60-E64 PolarHBondContact O-N 3.29Å; E61-E64 PolarHBondContact O-N 3.02Å; E64-R66 VanDerWaalsContact C-N 3.33Å; E64-R66 PolarHBondContact O-N 3.3Å; E64-I67 PolarHBondContact O-N 3.04Å; E64-A68 WeakPolarHBondContact O-CB 3.16Å; E64-A68 PolarHBondContact O-N 2.73Å
65	C	97.6	Very high	97.8	Very high	69 Å²	69	97.8 Å²	97.8	47%	0.466	50%	0.495	S	S	.	.	H	α-helix	trans	-56.6	-45.2	172.2	-73.1	0	0	0	0	111.8	E61 A68 L69	E61-C65 WeakPolarHBondContact O-CB 3.35Å; E61-C65 PolarHBondContact O-N 3.41Å; E61-C65 PolarHBondContact O-SG 3.48Å; C65-A68 PolarHBondContact O-N 3.5Å; C65-L69 WeakPolarHBondContact O-CG 3.34Å; C65-L69 PolarHBondContact O-N 3.32Å; C65-L69 VanDerWaalsContact O-N 3.1Å
66	R	96.8	Very high	97.8	Very high	191 Å²	191	98.5 Å²	98.5	72%	0.721	50%	0.498	S	S	*	.	H	α-helix	trans	-65	-41.5	177.3	-74.1	176.4	68.6	-176.5	1.6	112.6	D62 Q63 E64 A68 L69 A70	D62-R66 VanDerWaalsContact O-CG 3.29Å; D62-R66 WeakPolarHBondContact O-CG 3.49Å; D62-R66 PolarHBondContact O-N 3.02Å; Q63-R66 PolarHBondContact O-N 3.31Å; E64-R66 VanDerWaalsContact C-N 3.33Å; E64-R66 PolarHBondContact O-N 3.3Å; R66-A68 VanDerWaalsContact C-N 3.35Å; R66-L69 PolarHBondContact O-N 3.01Å; R66-A70 WeakPolarHBondContact O-CB 3.26Å; R66-A70 PolarHBondContact O-N 3.49Å
67	I	98	Very high	97.6	Very high	124 Å²	124	101.3 Å²	101.3	64%	0.636	51%	0.507	S	S	*	.	H	α-helix	trans	-64.4	-42	177.4	-69.4	164.4	0	0	0	110.2	Q63 E64 L69 A70	Q63-I67 VanDerWaalsContact O-CG1 3.27Å; Q63-I67 WeakPolarHBondContact O-CG1 3.39Å; Q63-I67 PolarHBondContact O-N 3.46Å; E64-I67 PolarHBondContact O-N 3.04Å; I67-L69 VanDerWaalsContact C-N 3.32Å; I67-L69 PolarHBondContact O-N 3.05Å; I67-A70 WeakPolarHBondContact O-CB 3.4Å; I67-A70 PolarHBondContact O-N 2.94Å
68	A	98.3	Very high	97.5	Very high	66 Å²	66	99.6 Å²	99.6	55%	0.545	50%	0.501	S	S	.	.	H	α-helix	trans	-63	-37.1	177.7	0	0	0	0	0	112.7	E64 C65 R66	E64-A68 WeakPolarHBondContact O-CB 3.16Å; E64-A68 PolarHBondContact O-N 2.73Å; C65-A68 PolarHBondContact O-N 3.5Å; R66-A68 VanDerWaalsContact C-N 3.35Å
69	L	97.6	Very high	97.5	Very high	99 Å²	99	104.5 Å²	104.5	52%	0.518	52%	0.516	S	S	.	.	H	α-helix	trans	-85	-20.9	178.9	-67	175.6	0	0	0	114.1	C65 R66 I67 P71 F72 I73	C65-L69 WeakPolarHBondContact O-CG 3.34Å; C65-L69 PolarHBondContact O-N 3.32Å; C65-L69 VanDerWaalsContact O-N 3.1Å; R66-L69 PolarHBondContact O-N 3.01Å; I67-L69 VanDerWaalsContact C-N 3.32Å; I67-L69 PolarHBondContact O-N 3.05Å; L69-P71 VanDerWaalsContact C-CD 3.47Å; L69-F72 PolarHBondContact O-N 3.22Å; L69-F72 VanDerWaalsContact O-N 3.11Å; L69-I73 HydrophobicContact CB-CD1 4.05Å; L69-I73 PolarHBondContact O-N 2.84Å; L69-I73 VanDerWaalsContact O-N 3.16Å
70	A	97.7	Very high	97.2	Very high	34 Å²	34	106.6 Å²	106.6	28%	0.281	53%	0.526	S	S	.	.	H	α-helix	trans	-47.5	-48.5	-176.6	0	0	0	0	0	114.9	R66 I67 F72 I73 I74	R66-A70 WeakPolarHBondContact O-CB 3.26Å; R66-A70 PolarHBondContact O-N 3.49Å; I67-A70 WeakPolarHBondContact O-CB 3.4Å; I67-A70 PolarHBondContact O-N 2.94Å; A70-F72 VanDerWaalsContact C-N 3.3Å; A70-F72 PolarHBondContact O-N 3.05Å; A70-I73 PolarHBondContact O-N 3.34Å; A70-I74 HydrophobicContact CB-CD1 4.49Å; A70-I74 WeakPolarHBondContact O-CB 3.22Å; A70-I74 VanDerWaalsContact O-CG1 3.24Å; A70-I74 WeakPolarHBondContact O-CG1 3.38Å; A70-I74 PolarHBondContact O-N 3.35Å
71	P	97.9	Very high	97	Very high	81 Å²	81	102.6 Å²	102.6	53%	0.526	51%	0.512	S	S	.	.	H	α-helix	trans	-64	-33.7	-177.9	24.3	-34.8	0	0	0	113.2	L69 A75	L69-P71 VanDerWaalsContact C-CD 3.47Å; P71-A75 VanDerWaalsContact O-CB 3.24Å; P71-A75 WeakPolarHBondContact O-CB 3.3Å; P71-A75 PolarHBondContact O-N 2.98Å
72	F	97.8	Very high	96.8	Very high	140 Å²	140	101 Å²	101	61%	0.614	51%	0.507	S	S	*	.	H	α-helix	trans	-69.9	-46.6	176.8	-61.9	-72.5	0	0	0	111.3	L69 A70 I74 A75 E76	L69-F72 PolarHBondContact O-N 3.22Å; L69-F72 VanDerWaalsContact O-N 3.11Å; A70-F72 VanDerWaalsContact C-N 3.3Å; A70-F72 PolarHBondContact O-N 3.05Å; F72-I74 PolarHBondContact O-N 2.82Å; F72-A75 PolarHBondContact O-N 3.25Å; F72-E76 WeakPolarHBondContact O-CG 3.31Å; F72-E76 PolarHBondContact O-N 3.22Å
73	I	96.7	Very high	96.6	Very high	80 Å²	80	103.5 Å²	103.5	41%	0.41	51%	0.513	S	S	.	.	H	α-helix	trans	-62.6	-45.4	179.6	-64	169.9	0	0	0	110.5	L69 A70 E76 Q77	L69-I73 HydrophobicContact CB-CD1 4.05Å; L69-I73 PolarHBondContact O-N 2.84Å; L69-I73 VanDerWaalsContact O-N 3.16Å; A70-I73 PolarHBondContact O-N 3.34Å; I73-E76 PolarHBondContact O-N 3.36Å; I73-Q77 HydrophobicContact CG2-CG 4.41Å; I73-Q77 WeakPolarHBondContact O-CB 3.44Å; I73-Q77 VanDerWaalsContact O-CG 3.26Å; I73-Q77 WeakPolarHBondContact O-CG 3.35Å; I73-Q77 PolarHBondContact O-N 3.45Å
74	I	96.6	Very high	96.3	Very high	84 Å²	84	99.4 Å²	99.4	43%	0.431	49%	0.494	S	S	.	.	H	α-helix	trans	-61.8	-47	177.9	-68.8	167.8	0	0	0	110	A70 F72 E76 Q77 E78	A70-I74 HydrophobicContact CB-CD1 4.49Å; A70-I74 WeakPolarHBondContact O-CB 3.22Å; A70-I74 VanDerWaalsContact O-CG1 3.24Å; A70-I74 WeakPolarHBondContact O-CG1 3.38Å; A70-I74 PolarHBondContact O-N 3.35Å; F72-I74 PolarHBondContact O-N 2.82Å; I74-E76 VanDerWaalsContact C-N 3.33Å; I74-E76 PolarHBondContact O-N 3.34Å; I74-Q77 PolarHBondContact O-N 3.24Å; I74-E78 HydrophobicContact CG2-CG 4.22Å; I74-E78 WeakPolarHBondContact CG2-OE1 3.39Å; I74-E78 WeakPolarHBondContact O-CB 3.48Å; I74-E78 VanDerWaalsContact O-CG 3.31Å; I74-E78 WeakPolarHBondContact O-CG 3.24Å; I74-E78 PolarHBondContact O-N 3.04Å
75	A	97.8	Very high	96	Very high	33 Å²	33	94.3 Å²	94.3	27%	0.273	47%	0.471	S	S	.	.	H	α-helix	trans	-61.5	-38.6	178.3	0	0	0	0	0	112.9	P71 F72 R79	P71-A75 VanDerWaalsContact O-CB 3.24Å; P71-A75 WeakPolarHBondContact O-CB 3.3Å; P71-A75 PolarHBondContact O-N 2.98Å; F72-A75 PolarHBondContact O-N 3.25Å; A75-R79 WeakPolarHBondContact O-CB 3.24Å; A75-R79 WeakPolarHBondContact O-CD 3.18Å; A75-R79 WeakPolarHBondContact O-CG 3.43Å; A75-R79 PolarHBondContact O-N 3.5Å
76	E	97.7	Very high	95.8	Very high	118 Å²	118	98.8 Å²	98.8	55%	0.551	48%	0.478	S	S	*	.	H	α-helix	trans	-65.6	-44.9	174.3	-75.3	-179	-177.9	0	0	112	F72 I73 I74 R79 L80	F72-E76 WeakPolarHBondContact O-CG 3.31Å; F72-E76 PolarHBondContact O-N 3.22Å; I73-E76 PolarHBondContact O-N 3.36Å; I74-E76 VanDerWaalsContact C-N 3.33Å; I74-E76 PolarHBondContact O-N 3.34Å; E76-R79 PolarHBondContact O-N 2.9Å; E76-L80 WeakPolarHBondContact O-CG 3.45Å; E76-L80 PolarHBondContact O-N 3.43Å
77	Q	94.7	Very high	95.7	Very high	119 Å²	119	95.8 Å²	95.8	56%	0.556	47%	0.47	S	S	*	.	H	α-helix	trans	-61	-46.8	176.7	-74.3	176.9	-3.8	0	0	111.6	I73 I74 R79 L80 Y81	I73-Q77 HydrophobicContact CG2-CG 4.41Å; I73-Q77 WeakPolarHBondContact O-CB 3.44Å; I73-Q77 VanDerWaalsContact O-CG 3.26Å; I73-Q77 WeakPolarHBondContact O-CG 3.35Å; I73-Q77 PolarHBondContact O-N 3.45Å; I74-Q77 PolarHBondContact O-N 3.24Å; Q77-R79 VanDerWaalsContact C-N 3.34Å; Q77-R79 PolarHBondContact O-N 2.92Å; Q77-L80 PolarHBondContact O-N 2.94Å; Q77-Y81 WeakPolarHBondContact O-CB 3.27Å; Q77-Y81 PolarHBondContact O-N 3.33Å
78	E	96.2	Very high	95.4	Very high	115 Å²	115	90.6 Å²	90.6	54%	0.537	44%	0.443	S	S	.	.	H	α-helix	trans	-60.7	-42.1	176.9	-73.7	176.4	175.7	0	0	111.8	I74 Y81 L82	I74-E78 HydrophobicContact CG2-CG 4.22Å; I74-E78 WeakPolarHBondContact CG2-OE1 3.39Å; I74-E78 WeakPolarHBondContact O-CB 3.48Å; I74-E78 VanDerWaalsContact O-CG 3.31Å; I74-E78 WeakPolarHBondContact O-CG 3.24Å; I74-E78 PolarHBondContact O-N 3.04Å; E78-Y81 PolarHBondContact O-N 3.2Å; E78-L82 WeakPolarHBondContact O-CB 3.44Å; E78-L82 WeakPolarHBondContact O-CG 3.41Å; E78-L82 PolarHBondContact O-N 3.25Å
79	R	97	Very high	95.2	Very high	167 Å²	167	94.2 Å²	94.2	63%	0.63	44%	0.443	S	S	*	.	H	α-helix	trans	-61.4	-45.8	174.8	-75	167.7	-177.7	175.4	1.9	111.9	A75 E76 Q77 Y81 K83	A75-R79 WeakPolarHBondContact O-CB 3.24Å; A75-R79 WeakPolarHBondContact O-CD 3.18Å; A75-R79 WeakPolarHBondContact O-CG 3.43Å; A75-R79 PolarHBondContact O-N 3.5Å; E76-R79 PolarHBondContact O-N 2.9Å; Q77-R79 VanDerWaalsContact C-N 3.34Å; Q77-R79 PolarHBondContact O-N 2.92Å; R79-Y81 VanDerWaalsContact C-N 3.33Å; R79-K83 WeakPolarHBondContact O-CB 3.26Å; R79-K83 WeakPolarHBondContact O-CG 3.43Å; R79-K83 PolarHBondContact O-N 2.89Å
80	L	93	Very high	95	Very high	118 Å²	118	94.4 Å²	94.4	62%	0.618	44%	0.441	S	S	*	.	H	α-helix	trans	-64.6	-41.1	177.9	-71.3	173.3	0	0	0	111.4	E76 Q77 K83 Q84	E76-L80 WeakPolarHBondContact O-CG 3.45Å; E76-L80 PolarHBondContact O-N 3.43Å; Q77-L80 PolarHBondContact O-N 2.94Å; L80-K83 PolarHBondContact O-N 3.31Å; L80-Q84 PolarHBondContact O-N 3.33Å
81	Y	92.2	Very high	94.8	Very high	61 Å²	61	98.1 Å²	98.1	24%	0.239	45%	0.449	C	S	.	.	H	α-helix	trans	-61.1	-52.9	177.9	178.3	-106.7	0	0	0	111.7	Q77 E78 R79 K83 Q84 L85 W120 P123 F128	Q77-Y81 WeakPolarHBondContact O-CB 3.27Å; Q77-Y81 PolarHBondContact O-N 3.33Å; E78-Y81 PolarHBondContact O-N 3.2Å; R79-Y81 VanDerWaalsContact C-N 3.33Å; Y81-K83 VanDerWaalsContact C-N 3.32Å; Y81-K83 PolarHBondContact O-N 3.38Å; Y81-Q84 WeakPolarHBondContact O-CB 3.41Å; Y81-Q84 PolarHBondContact O-N 3.16Å; Y81-Q84 VanDerWaalsContact O-N 3.14Å; Y81-L85 HydrophobicContact CD1-CD1 4.18Å; Y81-L85 HydrophobicContact CE1-CD1 3.61Å; Y81-L85 HydrophobicContact CE1-CG 4.44Å; Y81-L85 HydrophobicContact CE2-CD1 4.48Å; Y81-L85 PolarHBondContact O-N 3.01Å; Y81-W120 AromaticContact CE1-CZ2 3.84Å; Y81-W120 HydrophobicContact CE1-CZ2 3.84Å; Y81-P123 WeakPolarHBondContact OH-CD 3.33Å; Y81-P123 VanDerWaalsContact OH-CG 3.23Å; Y81-P123 WeakPolarHBondContact OH-CG 3.32Å; Y81-F128 AromaticContact CD2-CD2 3.72Å; Y81-F128 HydrophobicContact CD2-CD2 3.72Å; Y81-F128 AromaticContact CD2-CE2 3.19Å; Y81-F128 HydrophobicContact CD2-CE2 3.19Å; Y81-F128 AromaticContact CD2-CZ 3.87Å; Y81-F128 HydrophobicContact CD2-CZ 3.87Å; Y81-F128 AromaticContact CE2-CD2 3.52Å; Y81-F128 HydrophobicContact CE2-CD2 3.52Å; Y81-F128 AromaticContact CE2-CE2 3.55Å; Y81-F128 HydrophobicContact CE2-CE2 3.55Å; Y81-F128 HydrophobicContact CE2-CG 4.42Å; Y81-F128 HydrophobicContact CE2-CZ 4.45Å; Y81-F128 HydrophobicContact CG-CE2 4.14Å
82	L	94	Very high	94.7	Very high	89 Å²	89	96.3 Å²	96.3	47%	0.466	43%	0.433	S	S	.	.	H	α-helix	trans	-64	-35.2	178.5	-68.9	176.2	0	0	0	112.8	E78 L85 R86 W120	E78-L82 WeakPolarHBondContact O-CB 3.44Å; E78-L82 WeakPolarHBondContact O-CG 3.41Å; E78-L82 PolarHBondContact O-N 3.25Å; L82-L85 PolarHBondContact O-N 2.89Å; L82-R86 WeakPolarHBondContact O-CB 3.22Å; L82-R86 PolarHBondContact O-N 3.38Å; L82-W120 HydrophobicContact CD2-CH2 3.98Å; L82-W120 HydrophobicContact CD2-CZ2 4.49Å
83	K	94.3	Very high	94.5	Very high	142 Å²	142	94.8 Å²	94.8	62%	0.617	43%	0.428	S	S	*	.	H	α-helix	trans	-61.5	-43.1	173.2	-79.7	175.9	179.3	-176.1	0	111.7	R79 L80 Y81 R86 K87	R79-K83 WeakPolarHBondContact O-CB 3.26Å; R79-K83 WeakPolarHBondContact O-CG 3.43Å; R79-K83 PolarHBondContact O-N 2.89Å; L80-K83 PolarHBondContact O-N 3.31Å; Y81-K83 VanDerWaalsContact C-N 3.32Å; Y81-K83 PolarHBondContact O-N 3.38Å; K83-R86 PolarHBondContact O-N 3.23Å; K83-K87 PolarHBondContact O-N 3.04Å
84	Q	91.9	Very high	94.4	Very high	29 Å²	29	97.1 Å²	97.1	14%	0.136	44%	0.442	C	S	.	.	H	α-helix	trans	-64.9	-43.2	176.9	-177.6	63.1	35.1	0	0	111.4	L80 Y81 R86 K87 N88 F128	L80-Q84 PolarHBondContact O-N 3.33Å; Y81-Q84 WeakPolarHBondContact O-CB 3.41Å; Y81-Q84 PolarHBondContact O-N 3.16Å; Y81-Q84 VanDerWaalsContact O-N 3.14Å; Q84-R86 VanDerWaalsContact C-N 3.32Å; Q84-R86 PolarHBondContact O-N 3.04Å; Q84-K87 WeakPolarHBondContact O-CB 3.29Å; Q84-K87 PolarHBondContact O-N 2.82Å; Q84-N88 PolarHBondContact NE2-OD1 3.41Å; Q84-N88 PolarHBondContact O-N 3.28Å; Q84-N88 PolarHBondContact O-OD1 3.11Å; Q84-F128 HydrophobicContact CB-CD2 4.48Å; Q84-F128 HydrophobicContact CB-CE2 3.61Å; Q84-F128 HydrophobicContact CB-CZ 3.77Å; Q84-F128 HydrophobicContact CG-CD2 4.12Å; Q84-F128 HydrophobicContact CG-CE1 4.21Å; Q84-F128 HydrophobicContact CG-CE2 3.61Å; Q84-F128 HydrophobicContact CG-CZ 3.68Å
85	L	92.8	Very high	94.2	Very high	22 Å²	22	98.1 Å²	98.1	12%	0.115	45%	0.447	C	S	.	.	H	α-helix	trans	-62.5	-39.4	176.6	-65.6	-175	0	0	0	112.4	Y81 L82 N88 R89 W120 P123 F128	Y81-L85 HydrophobicContact CD1-CD1 4.18Å; Y81-L85 HydrophobicContact CE1-CD1 3.61Å; Y81-L85 HydrophobicContact CE1-CG 4.44Å; Y81-L85 HydrophobicContact CE2-CD1 4.48Å; Y81-L85 PolarHBondContact O-N 3.01Å; L82-L85 PolarHBondContact O-N 2.89Å; L85-N88 PolarHBondContact O-N 3.23Å; L85-R89 WeakPolarHBondContact O-CB 3.25Å; L85-R89 PolarHBondContact O-N 2.9Å; L85-W120 HydrophobicContact CD1-CH2 3.73Å; L85-W120 HydrophobicContact CD1-CZ2 3.74Å; L85-P123 HydrophobicContact CD1-CG 3.99Å; L85-P123 HydrophobicContact CD2-CB 4.43Å; L85-P123 HydrophobicContact CD2-CG 3.58Å; L85-P123 HydrophobicContact CG-CG 4.43Å; L85-F128 HydrophobicContact CD2-CD2 3.83Å; L85-F128 HydrophobicContact CD2-CE2 4.46Å; L85-F128 HydrophobicContact CG-CD2 4.45Å
86	R	93.8	Very high	94.1	Very high	163 Å²	163	98.8 Å²	98.8	62%	0.615	45%	0.445	S	S	*	.	H	α-helix	trans	-61	-45.5	173.6	-178.5	168.9	-65.4	151.1	2.8	111.5	L82 K83 Q84 N88 R89 E90	L82-R86 WeakPolarHBondContact O-CB 3.22Å; L82-R86 PolarHBondContact O-N 3.38Å; K83-R86 PolarHBondContact O-N 3.23Å; Q84-R86 VanDerWaalsContact C-N 3.32Å; Q84-R86 PolarHBondContact O-N 3.04Å; R86-N88 VanDerWaalsContact C-N 3.34Å; R86-N88 PolarHBondContact O-N 3.16Å; R86-R89 PolarHBondContact O-N 3.42Å; R86-E90 HydrophobicContact CG-CG 4.49Å; R86-E90 WeakPolarHBondContact CG-OE1 3.46Å; R86-E90 WeakPolarHBondContact O-CG 3.31Å; R86-E90 PolarHBondContact O-N 3.26Å
87	K	92.7	Very high	93.8	Very high	127 Å²	127	96 Å²	96	55%	0.552	45%	0.448	S	S	*	.	H	α-helix	trans	-59.8	-43	176.3	-176.1	-179.2	177.4	-177.6	0	112.1	K83 Q84 R89 E90 Y91	K83-K87 PolarHBondContact O-N 3.04Å; Q84-K87 WeakPolarHBondContact O-CB 3.29Å; Q84-K87 PolarHBondContact O-N 2.82Å; K87-R89 VanDerWaalsContact C-N 3.33Å; K87-E90 PolarHBondContact O-N 3.1Å; K87-Y91 WeakPolarHBondContact O-CB 3.45Å; K87-Y91 PolarHBondContact O-N 3.31Å
88	N	93	Very high	93.8	Very high	15 Å²	15	98.1 Å²	98.1	8%	0.08	46%	0.463	C	S	.	.	H	α-helix	trans	-64	-40.8	177.5	-67.3	-2.2	0	0	0	111	Q84 L85 R86 Y91 E92 E127 F128	Q84-N88 PolarHBondContact NE2-OD1 3.41Å; Q84-N88 PolarHBondContact O-N 3.28Å; Q84-N88 PolarHBondContact O-OD1 3.11Å; L85-N88 PolarHBondContact O-N 3.23Å; R86-N88 VanDerWaalsContact C-N 3.34Å; R86-N88 PolarHBondContact O-N 3.16Å; N88-Y91 PolarHBondContact O-N 3.39Å; N88-E92 WeakPolarHBondContact O-CB 3.45Å; N88-E92 PolarHBondContact O-N 3.46Å; N88-E127 PolarHBondContact ND2-O 3.19Å; N88-F128 PolarHBondContact ND2-O 3.04Å
89	R	93.4	Very high	93.7	Very high	143 Å²	143	95.7 Å²	95.7	54%	0.54	46%	0.456	S	S	.	.	H	α-helix	trans	-65.6	-42.2	177	-170.1	177.6	-69.4	147.3	0.6	113	L85 R86 K87 Y91 E92 Q93 I104	L85-R89 WeakPolarHBondContact O-CB 3.25Å; L85-R89 PolarHBondContact O-N 2.9Å; R86-R89 PolarHBondContact O-N 3.42Å; K87-R89 VanDerWaalsContact C-N 3.33Å; R89-Y91 VanDerWaalsContact C-N 3.31Å; R89-E92 PolarHBondContact O-N 3.02Å; R89-Q93 WeakPolarHBondContact O-CB 3.5Å; R89-Q93 PolarHBondContact O-N 3.22Å; R89-I104 HydrophobicContact CG-CG2 3.43Å; R89-I104 VanDerWaalsContact CG-CG2 3.43Å
90	E	94.8	Very high	93.5	Very high	102 Å²	102	92.2 Å²	92.2	48%	0.477	46%	0.463	S	S	.	.	H	α-helix	trans	-62.8	-40	174.1	-73.1	169.3	-172.7	0	0	111.1	R86 K87 Q93 N94	R86-E90 HydrophobicContact CG-CG 4.49Å; R86-E90 WeakPolarHBondContact CG-OE1 3.46Å; R86-E90 WeakPolarHBondContact O-CG 3.31Å; R86-E90 PolarHBondContact O-N 3.26Å; K87-E90 PolarHBondContact O-N 3.1Å; E90-Q93 PolarHBondContact O-N 3.45Å; E90-N94 PolarHBondContact O-N 2.91Å; E90-N94 PolarHBondContact O-ND2 2.89Å; E90-N94 VanDerWaalsContact O-ND2 3.13Å
91	Y	93.4	Very high	93.4	Very high	113 Å²	113	89 Å²	89	44%	0.443	46%	0.459	S	S	.	.	H	α-helix	trans	-65.9	-44.6	175.7	-172.3	-88.4	0	0	0	112.2	K87 N88 R89 Q93 N94 L95 H131	K87-Y91 WeakPolarHBondContact O-CB 3.45Å; K87-Y91 PolarHBondContact O-N 3.31Å; N88-Y91 PolarHBondContact O-N 3.39Å; R89-Y91 VanDerWaalsContact C-N 3.31Å; Y91-Q93 VanDerWaalsContact C-N 3.34Å; Y91-Q93 PolarHBondContact O-N 3.19Å; Y91-N94 PolarHBondContact O-N 3.37Å; Y91-L95 HydrophobicContact CD1-CB 4.5Å; Y91-L95 HydrophobicContact CE1-CB 4.34Å; Y91-L95 HydrophobicContact CE1-CD2 3.93Å; Y91-L95 VanDerWaalsContact O-CB 3.3Å; Y91-L95 WeakPolarHBondContact O-CB 3.41Å; Y91-L95 PolarHBondContact O-N 3.2Å; Y91-H131 AromaticContact CD1-CD2 3.82Å; Y91-H131 AromaticContact CD1-CE1 3.07Å; Y91-H131 WeakPolarHBondContact CD1-CE1 3.3Å; Y91-H131 AromaticContact CD1-CG 3.8Å; Y91-H131 AromaticContact CD1-ND1 3.35Å; Y91-H131 VanDerWaalsContact CD1-ND1 3.35Å; Y91-H131 WeakPolarHBondContact CD1-ND1 3.41Å; Y91-H131 AromaticContact CD1-NE2 3.38Å; Y91-H131 WeakPolarHBondContact CD1-NE2 3.42Å; Y91-H131 AromaticContact CE1-CE1 3.23Å; Y91-H131 WeakPolarHBondContact CE1-CE1 3.5Å; Y91-H131 AromaticContact CE1-ND1 3.27Å; Y91-H131 VanDerWaalsContact CE1-ND1 3.27Å; Y91-H131 WeakPolarHBondContact CE1-ND1 3.35Å; Y91-H131 AromaticContact CZ-ND1 3.98Å
92	E	93.9	Very high	93.5	Very high	42 Å²	42	89.3 Å²	89.3	20%	0.196	46%	0.46	C	S	.	.	H	α-helix	trans	-57.2	-46.9	174.1	-174.6	-165.7	168.3	0	0	111.2	N88 R89 N94 L95 M96 W102 I104 G105	N88-E92 WeakPolarHBondContact O-CB 3.45Å; N88-E92 PolarHBondContact O-N 3.46Å; R89-E92 PolarHBondContact O-N 3.02Å; E92-N94 VanDerWaalsContact C-N 3.32Å; E92-N94 PolarHBondContact O-N 2.93Å; E92-L95 PolarHBondContact O-N 2.93Å; E92-M96 HydrophobicContact CG-CG 4.19Å; E92-M96 VanDerWaalsContact O-CB 3.3Å; E92-M96 WeakPolarHBondContact O-CB 3.43Å; E92-M96 WeakPolarHBondContact O-CG 3.42Å; E92-M96 PolarHBondContact O-N 2.97Å; E92-W102 PolarHBondContact OE1-NE1 3.42Å; E92-W102 VanDerWaalsContact OE1-NE1 3.08Å; E92-I104 WeakPolarHBondContact OE1-CA 3.43Å; E92-G105 PolarHBondContact OE1-N 3.41Å; E92-G105 PolarHBondContact OE2-N 3.31Å
93	Q	94.2	Very high	93.5	Very high	108 Å²	108	90 Å²	90	51%	0.505	46%	0.459	S	S	.	.	H	α-helix	trans	-58.1	-44.6	177.5	177.4	171.4	-1.2	0	0	112.1	R89 E90 Y91 G97 I104	R89-Q93 WeakPolarHBondContact O-CB 3.5Å; R89-Q93 PolarHBondContact O-N 3.22Å; E90-Q93 PolarHBondContact O-N 3.45Å; Y91-Q93 VanDerWaalsContact C-N 3.34Å; Y91-Q93 PolarHBondContact O-N 3.19Å; Q93-G97 PolarHBondContact O-N 3.16Å; Q93-I104 HydrophobicContact CB-CD1 3.64Å; Q93-I104 HydrophobicContact CB-CG1 4.21Å; Q93-I104 HydrophobicContact CG-CD1 3.69Å
94	N	94.1	Very high	93.4	Very high	130 Å²	130	86.3 Å²	86.3	70%	0.695	45%	0.445	S	S	*	.	H	α-helix	trans	-70.4	-39.6	179.7	-67.5	-27	0	0	0	112	E90 Y91 E92	E90-N94 PolarHBondContact O-N 2.91Å; E90-N94 PolarHBondContact O-ND2 2.89Å; E90-N94 VanDerWaalsContact O-ND2 3.13Å; Y91-N94 PolarHBondContact O-N 3.37Å; E92-N94 VanDerWaalsContact C-N 3.32Å; E92-N94 PolarHBondContact O-N 2.93Å
95	L	93.6	Very high	93.2	Very high	105 Å²	105	87 Å²	87	55%	0.55	46%	0.46	S	S	.	.	H	α-helix	trans	-73.5	-37.8	-177.9	-175.8	69.1	0	0	0	112.3	Y91 E92	Y91-L95 HydrophobicContact CD1-CB 4.5Å; Y91-L95 HydrophobicContact CE1-CB 4.34Å; Y91-L95 HydrophobicContact CE1-CD2 3.93Å; Y91-L95 VanDerWaalsContact O-CB 3.3Å; Y91-L95 WeakPolarHBondContact O-CB 3.41Å; Y91-L95 PolarHBondContact O-N 3.2Å; E92-L95 PolarHBondContact O-N 2.93Å
96	M	94.6	Very high	93.1	Very high	47 Å²	47	89.8 Å²	89.8	23%	0.232	47%	0.472	C	S	.	.	H	α-helix	trans	-101.2	4.7	-171.9	-54.7	-61.7	-88.3	0	0	113.4	E92 D98 V99 W102	E92-M96 HydrophobicContact CG-CG 4.19Å; E92-M96 VanDerWaalsContact O-CB 3.3Å; E92-M96 WeakPolarHBondContact O-CB 3.43Å; E92-M96 WeakPolarHBondContact O-CG 3.42Å; E92-M96 PolarHBondContact O-N 2.97Å; M96-D98 PolarHBondContact O-N 2.99Å; M96-V99 PolarHBondContact O-N 3.26Å; M96-V99 VanDerWaalsContact O-N 3.12Å; M96-W102 HydrophobicContact CB-CB 4.45Å; M96-W102 HydrophobicContact CB-CD2 4.14Å; M96-W102 HydrophobicContact CB-CG 3.72Å; M96-W102 HydrophobicContact CE-CD2 3.54Å; M96-W102 HydrophobicContact CE-CE3 3.54Å; M96-W102 HydrophobicContact CE-CG 4.33Å; M96-W102 HydrophobicContact CE-CH2 3.54Å; M96-W102 HydrophobicContact CE-CZ2 3.54Å; M96-W102 HydrophobicContact CE-CZ3 3.54Å; M96-W102 HydrophobicContact CG-CD2 4.29Å; M96-W102 HydrophobicContact CG-CG 4.38Å; M96-W102 HydrophobicContact CG-CZ2 4.29Å
97	G	92	Very high	92.9	Very high	60 Å²	60	89.6 Å²	89.6	62%	0.619	47%	0.472	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.8	-28	-177.2	0	0	0	0	0	114.5	Q93	Q93-G97 PolarHBondContact O-N 3.16Å
98	D	94.9	Very high	92.8	Very high	163 Å²	163	87.5 Å²	87.5	87%	0.872	46%	0.462	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.3	-8.4	-178.5	-62.2	-28.6	0	0	0	113.5	M96	M96-D98 PolarHBondContact O-N 2.99Å
99	V	94.1	Very high	92.7	Very high	63 Å²	63	91.9 Å²	91.9	38%	0.382	49%	0.486	S	S	.	.	S	Bend	trans	-89.4	114.8	-173.7	-176.7	0	0	0	0	110.4	M96 G101 W102 F108	M96-V99 PolarHBondContact O-N 3.26Å; M96-V99 VanDerWaalsContact O-N 3.12Å; V99-G101 PolarHBondContact O-N 3.48Å; V99-W102 HydrophobicContact CB-CB 4.06Å; V99-W102 HydrophobicContact CG1-CB 4.25Å; V99-W102 WeakPolarHBondContact O-CB 3.35Å; V99-W102 PolarHBondContact O-N 3.25Å; V99-F108 HydrophobicContact CG1-CE1 4.31Å
100	A	93.1	Very high	92.6	Very high	95 Å²	95	92.4 Å²	92.4	79%	0.785	49%	0.489	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59	127.5	178.5	0	0	0	0	0	111.7	W102	A100-W102 VanDerWaalsContact C-N 3.33Å; A100-W102 PolarHBondContact O-N 2.91Å
101	G	91.1	Very high	92.4	Very high	51 Å²	51	91.5 Å²	91.5	53%	0.526	49%	0.492	S	S	.	.	T	Hydrogen-bonded Turn	trans	81	3.1	178.9	0	0	0	0	0	115.3	V99 K103	V99-G101 PolarHBondContact O-N 3.48Å; G101-K103 PolarHBondContact O-N 3.42Å
102	W	94.6	Very high	92.2	Very high	66 Å²	66	89.9 Å²	89.9	25%	0.25	49%	0.493	C	S	.	.			trans	-72.7	126.6	175.6	-167.8	-94.5	0	0	0	111.7	E92 M96 V99 A100 F108	E92-W102 PolarHBondContact OE1-NE1 3.42Å; E92-W102 VanDerWaalsContact OE1-NE1 3.08Å; M96-W102 HydrophobicContact CB-CB 4.45Å; M96-W102 HydrophobicContact CB-CD2 4.14Å; M96-W102 HydrophobicContact CB-CG 3.72Å; M96-W102 HydrophobicContact CE-CD2 3.54Å; M96-W102 HydrophobicContact CE-CE3 3.54Å; M96-W102 HydrophobicContact CE-CG 4.33Å; M96-W102 HydrophobicContact CE-CH2 3.54Å; M96-W102 HydrophobicContact CE-CZ2 3.54Å; M96-W102 HydrophobicContact CE-CZ3 3.54Å; M96-W102 HydrophobicContact CG-CD2 4.29Å; M96-W102 HydrophobicContact CG-CG 4.38Å; M96-W102 HydrophobicContact CG-CZ2 4.29Å; V99-W102 HydrophobicContact CB-CB 4.06Å; V99-W102 HydrophobicContact CG1-CB 4.25Å; V99-W102 WeakPolarHBondContact O-CB 3.35Å; V99-W102 PolarHBondContact O-N 3.25Å; A100-W102 VanDerWaalsContact C-N 3.33Å; A100-W102 PolarHBondContact O-N 2.91Å; W102-F108 HydrophobicContact CE3-CD1 4.34Å; W102-F108 HydrophobicContact CE3-CD2 4.43Å; W102-F108 HydrophobicContact CE3-CE1 4.14Å; W102-F108 HydrophobicContact CE3-CE2 4.23Å; W102-F108 HydrophobicContact CE3-CG 4.48Å; W102-F108 HydrophobicContact CE3-CZ 4.08Å; W102-F108 HydrophobicContact CZ3-CD2 4.24Å; W102-F108 AromaticContact CZ3-CE2 3.97Å; W102-F108 HydrophobicContact CZ3-CE2 3.97Å; W102-F108 HydrophobicContact CZ3-CZ 4.2Å
103	K	92.5	Very high	91.9	Very high	104 Å²	104	92.5 Å²	92.5	45%	0.452	50%	0.502	S	S	.	.			trans	-113.1	126.1	171.8	-72.2	172.7	179.3	155.9	0	108.9	G101 G105 H106 D109	G101-K103 PolarHBondContact O-N 3.42Å; K103-G105 PolarHBondContact O-N 2.89Å; K103-H106 HydrophobicContact CB-CB 3.98Å; K103-H106 PolarHBondContact O-N 2.98Å; K103-D109 IonicContact NZ-OD1 2.94Å; K103-D109 PolarHBondContact NZ-OD1 2.94Å
104	I	92.3	Very high	91.6	Very high	65 Å²	65	95.7 Å²	95.7	33%	0.333	52%	0.517	S	S	.	.	T	Hydrogen-bonded Turn	trans	-56.2	130.8	-179.1	-61.3	160.2	0	0	0	110.3	R89 E92 Q93 H106	R89-I104 HydrophobicContact CG-CG2 3.43Å; R89-I104 VanDerWaalsContact CG-CG2 3.43Å; E92-I104 WeakPolarHBondContact OE1-CA 3.43Å; Q93-I104 HydrophobicContact CB-CD1 3.64Å; Q93-I104 HydrophobicContact CB-CG1 4.21Å; Q93-I104 HydrophobicContact CG-CD1 3.69Å; I104-H106 PolarHBondContact O-N 3.36Å; I104-H106 PolarHBondContact O-ND1 3.43Å
105	G	88.9	Confident	91.5	Very high	42 Å²	42	92.1 Å²	92.1	43%	0.433	50%	0.498	S	S	.	.	T	Hydrogen-bonded Turn	trans	70.5	10.8	-179.9	0	0	0	0	0	115.2	E92 K103	E92-G105 PolarHBondContact OE1-N 3.41Å; E92-G105 PolarHBondContact OE2-N 3.31Å; K103-G105 PolarHBondContact O-N 2.89Å
106	H	91.1	Very high	91.3	Very high	81 Å²	81	92.1 Å²	92.1	38%	0.375	50%	0.504	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.7	157.4	173.7	-67.3	66.6	0	0	0	109.2	K103 I104 F108	K103-H106 HydrophobicContact CB-CB 3.98Å; K103-H106 PolarHBondContact O-N 2.98Å; I104-H106 PolarHBondContact O-N 3.36Å; I104-H106 PolarHBondContact O-ND1 3.43Å; H106-F108 WeakPolarHBondContact CB-O 3.36Å; H106-F108 PolarHBondContact O-N 3.41Å
107	W	89.2	Confident	91.2	Very high	160 Å²	160	99.7 Å²	99.7	61%	0.606	53%	0.53	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-89.2	91	165.5	-175	63.1	0	0	0	108.6	D109 Y110	W107-D109 PolarHBondContact O-N 2.88Å; W107-D109 VanDerWaalsContact O-N 3.12Å; W107-Y110 AromaticContact CE3-CD2 3.78Å; W107-Y110 HydrophobicContact CE3-CD2 3.78Å; W107-Y110 HydrophobicContact CE3-CG 4.31Å; W107-Y110 AromaticContact CZ3-CD2 3.83Å; W107-Y110 HydrophobicContact CZ3-CD2 3.83Å; W107-Y110 HydrophobicContact CZ3-CE2 4.33Å; W107-Y110 PolarHBondContact N-O 3.46Å; W107-Y110 PolarHBondContact O-N 3.18Å
108	F	90.9	Very high	91.1	Very high	82 Å²	82	100 Å²	100	36%	0.36	53%	0.534	S	S	.	.	T	Hydrogen-bonded Turn	trans	51.6	-113.3	-168.7	-66	-88.3	0	0	0	111.2	V99 W102 H106	V99-F108 HydrophobicContact CG1-CE1 4.31Å; W102-F108 HydrophobicContact CE3-CD1 4.34Å; W102-F108 HydrophobicContact CE3-CD2 4.43Å; W102-F108 HydrophobicContact CE3-CE1 4.14Å; W102-F108 HydrophobicContact CE3-CE2 4.23Å; W102-F108 HydrophobicContact CE3-CG 4.48Å; W102-F108 HydrophobicContact CE3-CZ 4.08Å; W102-F108 HydrophobicContact CZ3-CD2 4.24Å; W102-F108 AromaticContact CZ3-CE2 3.97Å; W102-F108 HydrophobicContact CZ3-CE2 3.97Å; W102-F108 HydrophobicContact CZ3-CZ 4.2Å; H106-F108 WeakPolarHBondContact CB-O 3.36Å; H106-F108 PolarHBondContact O-N 3.41Å
109	D	90.6	Very high	91	Very high	107 Å²	107	97.1 Å²	97.1	57%	0.572	52%	0.517	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.9	-9.8	179.1	-71.5	-45.6	0	0	0	114.1	K103 W107	K103-D109 IonicContact NZ-OD1 2.94Å; K103-D109 PolarHBondContact NZ-OD1 2.94Å; W107-D109 PolarHBondContact O-N 2.88Å; W107-D109 VanDerWaalsContact O-N 3.12Å
110	Y	90.8	Very high	90.9	Very high	154 Å²	154	101.2 Å²	101.2	60%	0.604	53%	0.526	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-99.1	135	-176.5	-59	-79.9	0	0	0	111.4	W107	W107-Y110 AromaticContact CE3-CD2 3.78Å; W107-Y110 HydrophobicContact CE3-CD2 3.78Å; W107-Y110 HydrophobicContact CE3-CG 4.31Å; W107-Y110 AromaticContact CZ3-CD2 3.83Å; W107-Y110 HydrophobicContact CZ3-CD2 3.83Å; W107-Y110 HydrophobicContact CZ3-CE2 4.33Å; W107-Y110 PolarHBondContact N-O 3.46Å; W107-Y110 PolarHBondContact O-N 3.18Å
111	P	90.7	Very high	90.7	Very high	83 Å²	83	99 Å²	99	54%	0.539	50%	0.504	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.5	142	170.8	29.2	-33.8	0	0	0	110.3	Y113	P111-Y113 VanDerWaalsContact C-N 3.28Å; P111-Y113 PolarHBondContact O-N 2.88Å
112	V	88.5	Confident	90.7	Very high	79 Å²	79	101.9 Å²	101.9	48%	0.479	51%	0.508	S	S	.	.	S	Bend	trans	-62	-37.7	179.2	179.7	0	0	0	0	111.5
113	Y	88.2	Confident	90.4	Very high	97 Å²	97	100.1 Å²	100.1	38%	0.38	51%	0.505	S	S	.	.	S	Bend	trans	-116.6	141.6	-179.6	-57.7	-67.3	0	0	0	111.8	P111 N115 C121 E127	P111-Y113 VanDerWaalsContact C-N 3.28Å; P111-Y113 PolarHBondContact O-N 2.88Å; Y113-N115 PolarHBondContact O-N 3.22Å; Y113-N115 VanDerWaalsContact O-N 3.16Å; Y113-C121 HydrophobicContact CD2-CB 3.83Å; Y113-C121 HydrophobicContact CE2-CB 4.14Å; Y113-C121 HydrophobicContact CG-CB 4.44Å; Y113-E127 PolarHBondContact OH-OE1 3.27Å
114	H	89	Confident	90.2	Very high	176 Å²	176	98.5 Å²	98.5	82%	0.815	50%	0.501	S	S	*	.			trans	-77.1	98.1	168.2	-176.8	72.9	0	0	0	109.8
115	N	90.5	Very high	89.7	Confident	54 Å²	54	98.6 Å²	98.6	29%	0.289	50%	0.502	S	S	.	.			trans	-130.9	79.8	-176.1	-175.4	4.6	0	0	0	112	Y113 R117 G118 L119 C121	Y113-N115 PolarHBondContact O-N 3.22Å; Y113-N115 VanDerWaalsContact O-N 3.16Å; N115-R117 PolarHBondContact O-N 2.95Å; N115-R117 PolarHBondContact OD1-N 2.74Å; N115-G118 PolarHBondContact O-N 3.35Å; N115-G118 PolarHBondContact OD1-N 2.9Å; N115-G118 VanDerWaalsContact OD1-N 3.07Å; N115-L119 PolarHBondContact ND2-N 3.49Å; N115-L119 VanDerWaalsContact ND2-N 3.19Å; N115-L119 PolarHBondContact ND2-O 3.19Å; N115-L119 PolarHBondContact OD1-N 2.94Å; N115-L119 VanDerWaalsContact OD1-N 3.11Å; N115-C121 PolarHBondContact ND2-SG 3.39Å
116	P	91	Very high	89.6	Confident	106 Å²	106	101.9 Å²	101.9	69%	0.688	51%	0.509	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.4	-17.6	-178.7	27	-34.5	0	0	0	113.5
117	R	91.1	Very high	89.4	Confident	206 Å²	206	102 Å²	102	78%	0.777	51%	0.51	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95.7	-5.4	-176.8	-64.8	-177.7	71.1	-175.1	2.4	113.7	N115 L119	N115-R117 PolarHBondContact O-N 2.95Å; N115-R117 PolarHBondContact OD1-N 2.74Å; R117-L119 HydrophobicContact CB-CD1 4.09Å; R117-L119 HydrophobicContact CB-CG 3.91Å; R117-L119 PolarHBondContact O-N 2.94Å
118	G	90.2	Very high	89.4	Confident	67 Å²	67	95.5 Å²	95.5	69%	0.691	49%	0.486	S	S	*	.			trans	62	29.7	-176.7	0	0	0	0	0	113.7	N115	N115-G118 PolarHBondContact O-N 3.35Å; N115-G118 PolarHBondContact OD1-N 2.9Å; N115-G118 VanDerWaalsContact OD1-N 3.07Å
119	L	92.7	Very high	89.3	Confident	101 Å²	101	92.9 Å²	92.9	53%	0.529	47%	0.474	S	S	.	.			trans	-70.3	159.2	177.2	-67.7	169.7	0	0	0	110.8	N115 R117 C121	N115-L119 PolarHBondContact ND2-N 3.49Å; N115-L119 VanDerWaalsContact ND2-N 3.19Å; N115-L119 PolarHBondContact ND2-O 3.19Å; N115-L119 PolarHBondContact OD1-N 2.94Å; N115-L119 VanDerWaalsContact OD1-N 3.11Å; R117-L119 HydrophobicContact CB-CD1 4.09Å; R117-L119 HydrophobicContact CB-CG 3.91Å; R117-L119 PolarHBondContact O-N 2.94Å; L119-C121 PolarHBondContact O-N 3.44Å
120	W	91.4	Very high	89	Confident	149 Å²	149	89.9 Å²	89.9	56%	0.564	46%	0.464	S	S	*	.			trans	-62.9	130.7	168.7	177.2	-98.7	0	0	0	109.7	Y81 L82 L85 D122	Y81-W120 AromaticContact CE1-CZ2 3.84Å; Y81-W120 HydrophobicContact CE1-CZ2 3.84Å; L82-W120 HydrophobicContact CD2-CH2 3.98Å; L82-W120 HydrophobicContact CD2-CZ2 4.49Å; L85-W120 HydrophobicContact CD1-CH2 3.73Å; L85-W120 HydrophobicContact CD1-CZ2 3.74Å; W120-D122 PolarHBondContact NE1-OD1 3.16Å
121	C	89.8	Confident	88.6	Confident	48 Å²	48	86.2 Å²	86.2	32%	0.324	45%	0.452	S	S	.	.			trans	-107.5	117.2	172.5	-65	0	0	0	0	107.8	Y113 N115 L119 P123	Y113-C121 HydrophobicContact CD2-CB 3.83Å; Y113-C121 HydrophobicContact CE2-CB 4.14Å; Y113-C121 HydrophobicContact CG-CB 4.44Å; N115-C121 PolarHBondContact ND2-SG 3.39Å; L119-C121 PolarHBondContact O-N 3.44Å; C121-P123 VanDerWaalsContact O-CD 3.24Å; C121-P123 WeakPolarHBondContact O-CD 3.49Å
122	D	90	Very high	88.2	Confident	112 Å²	112	83.1 Å²	83.1	60%	0.599	43%	0.432	S	S	*	.	P	Polyproline II helix	trans	-69.5	120.5	174.6	-73.8	-51.2	0	0	0	109.7	W120	W120-D122 PolarHBondContact NE1-OD1 3.16Å
123	P	88.9	Confident	87.7	Confident	29 Å²	29	82.3 Å²	82.3	19%	0.188	43%	0.433	C	S	.	.	P	Polyproline II helix	trans	-57.9	148.9	173.6	17.7	-32.9	0	0	0	112.2	Y81 L85 C121 E127	Y81-P123 WeakPolarHBondContact OH-CD 3.33Å; Y81-P123 VanDerWaalsContact OH-CG 3.23Å; Y81-P123 WeakPolarHBondContact OH-CG 3.32Å; L85-P123 HydrophobicContact CD1-CG 3.99Å; L85-P123 HydrophobicContact CD2-CB 4.43Å; L85-P123 HydrophobicContact CD2-CG 3.58Å; L85-P123 HydrophobicContact CG-CG 4.43Å; C121-P123 VanDerWaalsContact O-CD 3.24Å; C121-P123 WeakPolarHBondContact O-CD 3.49Å; P123-E127 WeakPolarHBondContact CA-OE2 3.43Å; P123-E127 HydrophobicContact CB-CB 3.95Å; P123-E127 WeakPolarHBondContact CB-OE2 3.35Å
124	D	87.7	Confident	87.2	Confident	71 Å²	71	83.3 Å²	83.3	38%	0.38	45%	0.445	S	S	.	.	P	Polyproline II helix	trans	-61.7	157.4	173.5	-177.5	41.5	0	0	0	111.3	N126 E127 F128	D124-N126 PolarHBondContact O-N 3.12Å; D124-N126 WeakPolarHBondContact OD2-CB 3.46Å; D124-N126 PolarHBondContact OD2-N 3.5Å; D124-N126 PolarHBondContact OD2-ND2 2.87Å; D124-E127 HydrophobicContact CB-CG 4.31Å; D124-E127 WeakPolarHBondContact O-CB 3.32Å; D124-E127 PolarHBondContact O-N 3.06Å; D124-F128 PolarHBondContact O-N 2.96Å
125	I	83.6	Confident	86.4	Confident	67 Å²	67	79.2 Å²	79.2	34%	0.344	44%	0.436	S	S	.	.	H	α-helix	trans	-54.7	-38.9	177.8	-61.1	179.2	0	0	0	110.6	Y129 R144	I125-Y129 HydrophobicContact CG2-CD2 3.61Å; I125-Y129 HydrophobicContact CG2-CE2 3.87Å; I125-Y129 WeakPolarHBondContact O-CB 3.42Å; I125-Y129 WeakPolarHBondContact O-CD2 3.29Å; I125-Y129 PolarHBondContact O-N 3.45Å; I125-Y129 VanDerWaalsContact O-N 3.07Å; I125-R144 VanDerWaalsContact CD1-NH1 3.27Å
126	N	85.4	Confident	85.8	Confident	111 Å²	111	79 Å²	79	59%	0.594	44%	0.435	S	S	*	.	H	α-helix	trans	-68.8	-35.8	179.7	-61.9	-54.6	0	0	0	112.3	D124 A130	D124-N126 PolarHBondContact O-N 3.12Å; D124-N126 WeakPolarHBondContact OD2-CB 3.46Å; D124-N126 PolarHBondContact OD2-N 3.5Å; D124-N126 PolarHBondContact OD2-ND2 2.87Å; N126-A130 WeakPolarHBondContact O-CA 3.37Å; N126-A130 WeakPolarHBondContact O-CB 3.48Å; N126-A130 PolarHBondContact O-N 3.13Å
127	E	87.6	Confident	85.1	Confident	84 Å²	84	76.5 Å²	76.5	39%	0.393	41%	0.413	S	S	.	.	H	α-helix	trans	-69	-43.1	176.3	-65.4	174.7	-163	0	0	111.4	N88 Y113 P123 D124 Y129	N88-E127 PolarHBondContact ND2-O 3.19Å; Y113-E127 PolarHBondContact OH-OE1 3.27Å; P123-E127 WeakPolarHBondContact CA-OE2 3.43Å; P123-E127 HydrophobicContact CB-CB 3.95Å; P123-E127 WeakPolarHBondContact CB-OE2 3.35Å; D124-E127 HydrophobicContact CB-CG 4.31Å; D124-E127 WeakPolarHBondContact O-CB 3.32Å; D124-E127 PolarHBondContact O-N 3.06Å; E127-Y129 VanDerWaalsContact C-N 3.34Å; E127-Y129 PolarHBondContact O-N 2.83Å
128	F	89.7	Confident	84.4	Confident	22 Å²	22	70.3 Å²	70.3	10%	0.096	40%	0.395	C	S	.	.	H	α-helix	trans	-62.9	-42.2	177.7	-175.3	-99.5	0	0	0	111.8	Y81 Q84 L85 N88 D124	Y81-F128 AromaticContact CD2-CD2 3.72Å; Y81-F128 HydrophobicContact CD2-CD2 3.72Å; Y81-F128 AromaticContact CD2-CE2 3.19Å; Y81-F128 HydrophobicContact CD2-CE2 3.19Å; Y81-F128 AromaticContact CD2-CZ 3.87Å; Y81-F128 HydrophobicContact CD2-CZ 3.87Å; Y81-F128 AromaticContact CE2-CD2 3.52Å; Y81-F128 HydrophobicContact CE2-CD2 3.52Å; Y81-F128 AromaticContact CE2-CE2 3.55Å; Y81-F128 HydrophobicContact CE2-CE2 3.55Å; Y81-F128 HydrophobicContact CE2-CG 4.42Å; Y81-F128 HydrophobicContact CE2-CZ 4.45Å; Y81-F128 HydrophobicContact CG-CE2 4.14Å; Q84-F128 HydrophobicContact CB-CD2 4.48Å; Q84-F128 HydrophobicContact CB-CE2 3.61Å; Q84-F128 HydrophobicContact CB-CZ 3.77Å; Q84-F128 HydrophobicContact CG-CD2 4.12Å; Q84-F128 HydrophobicContact CG-CE1 4.21Å; Q84-F128 HydrophobicContact CG-CE2 3.61Å; Q84-F128 HydrophobicContact CG-CZ 3.68Å; L85-F128 HydrophobicContact CD2-CD2 3.83Å; L85-F128 HydrophobicContact CD2-CE2 4.46Å; L85-F128 HydrophobicContact CG-CD2 4.45Å; N88-F128 PolarHBondContact ND2-O 3.04Å; D124-F128 PolarHBondContact O-N 2.96Å
129	Y	87.8	Confident	83.7	Confident	28 Å²	28	72.4 Å²	72.4	11%	0.11	39%	0.39	C	S	.	.	T	Hydrogen-bonded Turn	trans	-94.8	6.9	-177.2	-68.2	-58.5	0	0	0	114.9	I125 E127 H131 V132 K137 R140	I125-Y129 HydrophobicContact CG2-CD2 3.61Å; I125-Y129 HydrophobicContact CG2-CE2 3.87Å; I125-Y129 WeakPolarHBondContact O-CB 3.42Å; I125-Y129 WeakPolarHBondContact O-CD2 3.29Å; I125-Y129 PolarHBondContact O-N 3.45Å; I125-Y129 VanDerWaalsContact O-N 3.07Å; E127-Y129 VanDerWaalsContact C-N 3.34Å; E127-Y129 PolarHBondContact O-N 2.83Å; Y129-H131 VanDerWaalsContact C-N 3.29Å; Y129-H131 PolarHBondContact O-N 3.37Å; Y129-H131 VanDerWaalsContact O-N 3.15Å; Y129-V132 HydrophobicContact CD1-CB 4.36Å; Y129-V132 HydrophobicContact CD1-CG2 4.1Å; Y129-V132 PolarHBondContact O-N 2.9Å; Y129-V132 VanDerWaalsContact O-N 3.15Å; Y129-K137 WeakPolarHBondContact O-CE 3.46Å; Y129-K137 PolarHBondContact O-NZ 2.78Å; Y129-R140 HydrophobicContact CE1-CB 4.11Å; Y129-R140 HydrophobicContact CE1-CG 4.37Å
130	A	85	Confident	82.8	Confident	44 Å²	44	71.7 Å²	71.7	36%	0.364	38%	0.38	S	S	.	.	T	Hydrogen-bonded Turn	trans	-50.3	-46.8	-172.2	0	0	0	0	0	113.3	N126 K137	N126-A130 WeakPolarHBondContact O-CA 3.37Å; N126-A130 WeakPolarHBondContact O-CB 3.48Å; N126-A130 PolarHBondContact O-N 3.13Å; A130-K137 PolarHBondContact O-NZ 2.96Å
131	H	81.6	Confident	82	Confident	77 Å²	77	70.6 Å²	70.6	36%	0.356	38%	0.376	S	S	.	.	T	Hydrogen-bonded Turn	trans	-102.1	13.9	-173.9	-51	-56.8	0	0	0	114.5	Y91 Y129	Y91-H131 AromaticContact CD1-CD2 3.82Å; Y91-H131 AromaticContact CD1-CE1 3.07Å; Y91-H131 WeakPolarHBondContact CD1-CE1 3.3Å; Y91-H131 AromaticContact CD1-CG 3.8Å; Y91-H131 AromaticContact CD1-ND1 3.35Å; Y91-H131 VanDerWaalsContact CD1-ND1 3.35Å; Y91-H131 WeakPolarHBondContact CD1-ND1 3.41Å; Y91-H131 AromaticContact CD1-NE2 3.38Å; Y91-H131 WeakPolarHBondContact CD1-NE2 3.42Å; Y91-H131 AromaticContact CE1-CE1 3.23Å; Y91-H131 WeakPolarHBondContact CE1-CE1 3.5Å; Y91-H131 AromaticContact CE1-ND1 3.27Å; Y91-H131 VanDerWaalsContact CE1-ND1 3.27Å; Y91-H131 WeakPolarHBondContact CE1-ND1 3.35Å; Y91-H131 AromaticContact CZ-ND1 3.98Å; Y129-H131 VanDerWaalsContact C-N 3.29Å; Y129-H131 PolarHBondContact O-N 3.37Å; Y129-H131 VanDerWaalsContact O-N 3.15Å
132	V	82.3	Confident	81.5	Confident	17 Å²	17	75 Å²	75	10%	0.103	39%	0.39	C	S	.	.	S	Bend	trans	-87.6	145.7	176.5	175.4	0	0	0	0	109.1	Y129 D136 K137	Y129-V132 HydrophobicContact CD1-CB 4.36Å; Y129-V132 HydrophobicContact CD1-CG2 4.1Å; Y129-V132 PolarHBondContact O-N 2.9Å; Y129-V132 VanDerWaalsContact O-N 3.15Å; V132-D136 HydrophobicContact CG1-CB 3.51Å; V132-D136 WeakPolarHBondContact CG1-OD2 3.4Å; V132-K137 HydrophobicContact CB-CG 4.08Å; V132-K137 HydrophobicContact CG1-CG 4.04Å; V132-K137 WeakPolarHBondContact O-CE 3.46Å
133	A	79.4	Confident	80.8	Confident	62 Å²	62	73.3 Å²	73.3	51%	0.512	38%	0.383	S	S	.	.			trans	-62.5	141.9	174.5	0	0	0	0	0	110.4	C135 D136 K137	A133-C135 PolarHBondContact O-N 2.9Å; A133-C135 VanDerWaalsContact O-N 3.1Å; A133-D136 PolarHBondContact O-N 2.89Å; A133-K137 PolarHBondContact O-N 3.44Å; A133-K137 VanDerWaalsContact O-N 3.08Å
134	D	75.9	Confident	79.9	Confident	118 Å²	118	77.3 Å²	77.3	63%	0.631	39%	0.394	S	S	*	.	H	α-helix	trans	-56.1	-34.7	-174.3	-67.5	-31.1	0	0	0	113.2	D136 K137 D138	D134-D136 VanDerWaalsContact C-N 3.31Å; D134-D136 PolarHBondContact O-N 3.33Å; D134-K137 PolarHBondContact O-N 2.97Å; D134-K137 IonicContact OD1-NZ 2.72Å; D134-D138 PolarHBondContact O-N 2.84Å; D134-D138 VanDerWaalsContact O-N 3.08Å
135	C	72.2	Confident	79.3	Confident	91 Å²	91	81.7 Å²	81.7	62%	0.615	41%	0.407	S	S	*	.	H	α-helix	trans	-59.6	-39.5	174.6	60.4	0	0	0	0	113	A133 L139	A133-C135 PolarHBondContact O-N 2.9Å; A133-C135 VanDerWaalsContact O-N 3.1Å; C135-L139 WeakPolarHBondContact O-CD1 3.26Å; C135-L139 WeakPolarHBondContact O-CG 3.4Å; C135-L139 PolarHBondContact O-N 2.8Å
136	D	78	Confident	78.7	Confident	50 Å²	50	86.9 Å²	86.9	27%	0.267	42%	0.422	S	S	.	.	H	α-helix	trans	-77.8	-31.8	178.8	-175.8	37.5	0	0	0	111.1	V132 A133 D134 D138 R140	V132-D136 HydrophobicContact CG1-CB 3.51Å; V132-D136 WeakPolarHBondContact CG1-OD2 3.4Å; A133-D136 PolarHBondContact O-N 2.89Å; D134-D136 VanDerWaalsContact C-N 3.31Å; D134-D136 PolarHBondContact O-N 3.33Å; D136-D138 PolarHBondContact O-N 3.36Å; D136-R140 VanDerWaalsContact CG-NE 3.31Å; D136-R140 WeakPolarHBondContact O-CB 3.42Å; D136-R140 VanDerWaalsContact O-CG 3.26Å; D136-R140 WeakPolarHBondContact O-CG 3.32Å; D136-R140 PolarHBondContact O-N 2.87Å; D136-R140 IonicContact OD1-CZ 3.19Å; D136-R140 IonicContact OD1-NE 3.05Å; D136-R140 PolarHBondContact OD1-NE 3.15Å; D136-R140 IonicContact OD1-NH2 3.7Å; D136-R140 IonicContact OD2-CZ 3.37Å; D136-R140 IonicContact OD2-NE 3.77Å; D136-R140 PolarHBondContact OD2-NE 2.91Å; D136-R140 IonicContact OD2-NH2 2.73Å; D136-R140 PolarHBondContact OD2-NH2 3.09Å
137	K	76.4	Confident	77.5	Confident	53 Å²	53	90.5 Å²	90.5	23%	0.23	43%	0.428	C	S	.	.	H	α-helix	trans	-59.4	-48.3	171.9	-57.6	-170.2	-162.1	-173.6	0	111.3	Y129 A130 V132 A133 D134 R140 R141	Y129-K137 WeakPolarHBondContact O-CE 3.46Å; Y129-K137 PolarHBondContact O-NZ 2.78Å; A130-K137 PolarHBondContact O-NZ 2.96Å; V132-K137 HydrophobicContact CB-CG 4.08Å; V132-K137 HydrophobicContact CG1-CG 4.04Å; V132-K137 WeakPolarHBondContact O-CE 3.46Å; A133-K137 PolarHBondContact O-N 3.44Å; A133-K137 VanDerWaalsContact O-N 3.08Å; D134-K137 PolarHBondContact O-N 2.97Å; D134-K137 IonicContact OD1-NZ 2.72Å; K137-R140 PolarHBondContact O-N 2.95Å; K137-R141 WeakPolarHBondContact O-CB 3.37Å; K137-R141 PolarHBondContact O-N 3.1Å
138	D	77.4	Confident	76	Confident	76 Å²	76	93.2 Å²	93.2	41%	0.406	46%	0.457	S	S	.	.	H	α-helix	trans	-68.1	-40.4	-178.2	-81.3	-19.7	0	0	0	112.9	D134 D136 R141 K142	D134-D138 PolarHBondContact O-N 2.84Å; D134-D138 VanDerWaalsContact O-N 3.08Å; D136-D138 PolarHBondContact O-N 3.36Å; D138-R141 PolarHBondContact O-N 3.49Å; D138-R141 IonicContact OD1-NH1 3.67Å; D138-R141 PolarHBondContact OD1-NH1 3.48Å; D138-K142 WeakPolarHBondContact O-CG 3.49Å; D138-K142 PolarHBondContact O-N 3.4Å
139	L	75.6	Confident	75.3	Confident	110 Å²	110	96.8 Å²	96.8	58%	0.576	48%	0.475	S	S	*	.	H	α-helix	trans	-57.8	-50.6	173.9	-86.6	158.1	0	0	0	110.9	C135 R141 K142 V143	C135-L139 WeakPolarHBondContact O-CD1 3.26Å; C135-L139 WeakPolarHBondContact O-CG 3.4Å; C135-L139 PolarHBondContact O-N 2.8Å; L139-R141 PolarHBondContact O-N 3.38Å; L139-K142 PolarHBondContact O-N 3.39Å; L139-V143 WeakPolarHBondContact O-CG2 3.27Å; L139-V143 PolarHBondContact O-N 3.11Å
140	R	73.9	Confident	74.6	Confident	87 Å²	87	100.4 Å²	100.4	33%	0.328	49%	0.494	S	S	.	.	H	α-helix	trans	-68	-36.2	-178.5	-67.4	178.1	-171.5	-155.7	13.7	112.7	Y129 D136 K137 V143 R144	Y129-R140 HydrophobicContact CE1-CB 4.11Å; Y129-R140 HydrophobicContact CE1-CG 4.37Å; D136-R140 VanDerWaalsContact CG-NE 3.31Å; D136-R140 WeakPolarHBondContact O-CB 3.42Å; D136-R140 VanDerWaalsContact O-CG 3.26Å; D136-R140 WeakPolarHBondContact O-CG 3.32Å; D136-R140 PolarHBondContact O-N 2.87Å; D136-R140 IonicContact OD1-CZ 3.19Å; D136-R140 IonicContact OD1-NE 3.05Å; D136-R140 PolarHBondContact OD1-NE 3.15Å; D136-R140 IonicContact OD1-NH2 3.7Å; D136-R140 IonicContact OD2-CZ 3.37Å; D136-R140 IonicContact OD2-NE 3.77Å; D136-R140 PolarHBondContact OD2-NE 2.91Å; D136-R140 IonicContact OD2-NH2 2.73Å; D136-R140 PolarHBondContact OD2-NH2 3.09Å; K137-R140 PolarHBondContact O-N 2.95Å; R140-V143 PolarHBondContact O-N 2.58Å; R140-R144 PolarHBondContact O-N 3.38Å
141	R	73.8	Confident	74	Confident	126 Å²	126	103.6 Å²	103.6	48%	0.475	50%	0.502	S	S	.	.	H	α-helix	trans	-59	-49.1	172.5	-173.5	-175.3	-76.8	154.5	-11.2	110.9	K137 D138 L139 V143 R144 Y145	K137-R141 WeakPolarHBondContact O-CB 3.37Å; K137-R141 PolarHBondContact O-N 3.1Å; D138-R141 PolarHBondContact O-N 3.49Å; D138-R141 IonicContact OD1-NH1 3.67Å; D138-R141 PolarHBondContact OD1-NH1 3.48Å; L139-R141 PolarHBondContact O-N 3.38Å; R141-V143 VanDerWaalsContact C-N 3.32Å; R141-V143 PolarHBondContact O-N 2.99Å; R141-R144 PolarHBondContact O-N 3.48Å; R141-Y145 HydrophobicContact CG-CD2 3.9Å; R141-Y145 HydrophobicContact CG-CE2 3.57Å; R141-Y145 WeakPolarHBondContact O-CD2 3.16Å; R141-Y145 PolarHBondContact O-N 3.21Å
142	K	79.6	Confident	73.6	Confident	141 Å²	141	105.1 Å²	105.1	61%	0.613	51%	0.51	S	S	*	.	H	α-helix	trans	-61.2	-38.8	177.1	-73.2	173.6	-176.4	175	0	112.6	D138 L139 R146	D138-K142 WeakPolarHBondContact O-CG 3.49Å; D138-K142 PolarHBondContact O-N 3.4Å; L139-K142 PolarHBondContact O-N 3.39Å; K142-R146 PolarHBondContact O-N 2.87Å
143	V	76	Confident	73.1	Confident	76 Å²	76	110.6 Å²	110.6	46%	0.461	54%	0.536	S	S	.	.	H	α-helix	trans	-64.4	-45.3	177.1	171.6	0	0	0	0	111	L139 R140 R141 Y145 R146 Y147	L139-V143 WeakPolarHBondContact O-CG2 3.27Å; L139-V143 PolarHBondContact O-N 3.11Å; R140-V143 PolarHBondContact O-N 2.58Å; R141-V143 VanDerWaalsContact C-N 3.32Å; R141-V143 PolarHBondContact O-N 2.99Å; V143-Y145 PolarHBondContact O-N 2.92Å; V143-R146 WeakPolarHBondContact O-CB 3.47Å; V143-R146 PolarHBondContact O-N 3.41Å; V143-Y147 HydrophobicContact CG1-CD2 4.3Å; V143-Y147 HydrophobicContact CG1-CE2 4.25Å; V143-Y147 VanDerWaalsContact O-CD2 3.3Å; V143-Y147 WeakPolarHBondContact O-CD2 2.85Å
144	R	69.3	Low	72.6	Confident	113 Å²	113	113.9 Å²	113.9	43%	0.426	54%	0.537	S	S	.	.	H	α-helix	trans	-59.5	-48.1	179.6	-174.5	179.5	-69.8	-174	-2.3	112.4	I125 R140 R141 R146 Y147 S148	I125-R144 VanDerWaalsContact CD1-NH1 3.27Å; R140-R144 PolarHBondContact O-N 3.38Å; R141-R144 PolarHBondContact O-N 3.48Å; R144-R146 PolarHBondContact O-N 2.68Å; R144-Y147 PolarHBondContact O-N 3.19Å; R144-S148 PolarHBondContact O-N 3.32Å; R144-S148 PolarHBondContact O-OG 3.32Å
145	Y	74.8	Confident	72.4	Confident	163 Å²	163	113.6 Å²	113.6	64%	0.639	53%	0.53	S	S	*	.	H	α-helix	trans	-70.2	-16.7	179.8	-71	-65.6	0	0	0	114.2	R141 V143 Y147	R141-Y145 HydrophobicContact CG-CD2 3.9Å; R141-Y145 HydrophobicContact CG-CE2 3.57Å; R141-Y145 WeakPolarHBondContact O-CD2 3.16Å; R141-Y145 PolarHBondContact O-N 3.21Å; V143-Y145 PolarHBondContact O-N 2.92Å; Y145-Y147 VanDerWaalsContact C-N 3.32Å
146	R	72.1	Confident	72.4	Confident	175 Å²	175	115.3 Å²	115.3	66%	0.66	52%	0.524	S	S	*	.	H	α-helix	trans	-74.1	-25.2	176.5	-172.6	178.4	-63.3	179.9	0	112.8	K142 V143 R144	K142-R146 PolarHBondContact O-N 2.87Å; V143-R146 WeakPolarHBondContact O-CB 3.47Å; V143-R146 PolarHBondContact O-N 3.41Å; R144-R146 PolarHBondContact O-N 2.68Å
147	Y	59.5	Low	72	Confident	187 Å²	187	120.8 Å²	120.8	73%	0.733	55%	0.545	S	S	*	.			trans	-120.8	7	-172.3	-61.1	-70.6	0	0	0	113.9	V143 R144 Y145	V143-Y147 HydrophobicContact CG1-CD2 4.3Å; V143-Y147 HydrophobicContact CG1-CE2 4.25Å; V143-Y147 VanDerWaalsContact O-CD2 3.3Å; V143-Y147 WeakPolarHBondContact O-CD2 2.85Å; R144-Y147 PolarHBondContact O-N 3.19Å; Y145-Y147 VanDerWaalsContact C-N 3.32Å
148	S	55.2	Low	71.6	Confident	142 Å²	142	126.9 Å²	126.9	99%	0.993	57%	0.574	S	S	*	*			trans	-92.6	0	169.1	-53.6	0	0	0	0	109.3	R144	R144-S148 PolarHBondContact O-N 3.32Å; R144-S148 PolarHBondContact O-OG 3.32Å

Retrieved 148 of 148 residues in 39.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).