G4LYL4_SCHMA Loading...

Transcriptional regulator

AlphaFold DB , UniProt , Accession G4LYL4, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 51 aa.

						>G4LYL4_SCHMA|G4LYL4
MQPVDEGLDYASQGMMDEDITCTISSERAPDLHADFRRDFGYDPFDDDDLD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	35	Very low	55.8	Low	250 Å²	250	141.6 Å²	141.6	100%	1.232	77%	0.77	S	S	*	*				0	156	0	-76	-177.6	-179.2	0	0	108.5
2	Q	39.1	Very low	56.2	Low	180 Å²	180	138.9 Å²	138.9	84%	0.841	77%	0.769	S	S	*	*			trans	-63.6	158.3	-158.4	-75.8	167.7	-52.4	0	0	116.9
3	P	45.6	Very low	56.3	Low	125 Å²	125	142.1 Å²	142.1	81%	0.812	78%	0.775	S	S	*	*			trans	-79.4	129.9	170.7	32.9	-30.7	0	0	0	110.2
4	V	63.8	Low	56.6	Low	101 Å²	101	135.8 Å²	135.8	61%	0.612	76%	0.759	S	S	*	*			trans	-131.4	86.6	166.2	-171.6	0	0	0	0	105.9	E6	V4-E6 HydrophobicContact CG1-CB 3.82Å; V4-E6 HydrophobicContact CG1-CG 3.35Å; V4-E6 PolarHBondContact O-N 3.26Å
5	D	61.2	Low	57	Low	161 Å²	161	139 Å²	139	86%	0.861	77%	0.769	S	S	*	*			trans	-85.2	68.6	162	-169.7	-3	0	0	0	106.3	G7	D5-G7 PolarHBondContact O-N 2.85Å
6	E	59	Low	57.4	Low	163 Å²	163	139.3 Å²	139.3	76%	0.762	77%	0.765	S	S	*	*			trans	-78.8	76	168.8	-85.9	170.9	-177.3	0	0	107	V4 L8	V4-E6 HydrophobicContact CG1-CB 3.82Å; V4-E6 HydrophobicContact CG1-CG 3.35Å; V4-E6 PolarHBondContact O-N 3.26Å; E6-L8 PolarHBondContact O-N 3.07Å
7	G	61.4	Low	58	Low	59 Å²	59	141.4 Å²	141.4	61%	0.608	78%	0.775	S	S	*	*			trans	-54.3	112.8	155	0	0	0	0	0	106.7	D5 D9	D5-G7 PolarHBondContact O-N 2.85Å; G7-D9 PolarHBondContact O-N 2.81Å
8	L	62.4	Low	58.6	Low	128 Å²	128	141.4 Å²	141.4	67%	0.67	77%	0.769	S	S	*	*			trans	-54.4	99.6	178.9	-74.3	148.8	0	0	0	109.4	E6 Y10	E6-L8 PolarHBondContact O-N 3.07Å; L8-Y10 VanDerWaalsContact C-N 3.26Å; L8-Y10 HydrophobicContact CB-CD2 3.71Å; L8-Y10 HydrophobicContact CB-CE2 3.32Å; L8-Y10 HydrophobicContact CD1-CE2 3.89Å; L8-Y10 HydrophobicContact CD2-CE2 4.32Å; L8-Y10 HydrophobicContact CG-CE2 4.03Å; L8-Y10 WeakPolarHBondContact O-CD2 3.28Å; L8-Y10 PolarHBondContact O-N 3.05Å
9	D	62.8	Low	59.3	Low	128 Å²	128	142.3 Å²	142.3	68%	0.684	77%	0.773	S	S	*	*			trans	-73.8	85.9	169.5	-175	-47.4	0	0	0	107.3	G7 A11	G7-D9 PolarHBondContact O-N 2.81Å; D9-A11 PolarHBondContact O-N 2.83Å; D9-A11 WeakPolarHBondContact OD1-CA 3.46Å; D9-A11 VanDerWaalsContact OD1-CB 3.28Å; D9-A11 WeakPolarHBondContact OD1-CB 3.38Å; D9-A11 PolarHBondContact OD1-N 2.84Å
10	Y	62.1	Low	59.9	Low	181 Å²	181	140.7 Å²	140.7	71%	0.71	76%	0.763	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.9	9.8	171.1	-72.3	-73.7	0	0	0	112.5	L8	L8-Y10 VanDerWaalsContact C-N 3.26Å; L8-Y10 HydrophobicContact CB-CD2 3.71Å; L8-Y10 HydrophobicContact CB-CE2 3.32Å; L8-Y10 HydrophobicContact CD1-CE2 3.89Å; L8-Y10 HydrophobicContact CD2-CE2 4.32Å; L8-Y10 HydrophobicContact CG-CE2 4.03Å; L8-Y10 WeakPolarHBondContact O-CD2 3.28Å; L8-Y10 PolarHBondContact O-N 3.05Å
11	A	61.3	Low	60.7	Low	82 Å²	82	139.9 Å²	139.9	68%	0.678	76%	0.762	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.4	-2.4	-162.3	0	0	0	0	0	114.7	D9 Q13	D9-A11 PolarHBondContact O-N 2.83Å; D9-A11 WeakPolarHBondContact OD1-CA 3.46Å; D9-A11 VanDerWaalsContact OD1-CB 3.28Å; D9-A11 WeakPolarHBondContact OD1-CB 3.38Å; D9-A11 PolarHBondContact OD1-N 2.84Å; A11-Q13 PolarHBondContact O-N 3.21Å
12	S	60.7	Low	62.3	Low	109 Å²	109	132.7 Å²	132.7	76%	0.762	74%	0.736	S	S	*	*			trans	-84.1	60.8	164.4	79.6	0	0	0	0	110.9	G14	S12-G14 PolarHBondContact O-N 2.96Å
13	Q	57.4	Low	64.2	Low	180 Å²	180	130.1 Å²	130.1	84%	0.841	73%	0.733	S	S	*	*			trans	-65.8	88.9	156.3	-85.8	179.6	6.1	0	0	106.2	A11 M15	A11-Q13 PolarHBondContact O-N 3.21Å; Q13-M15 PolarHBondContact O-N 3.05Å
14	G	61.1	Low	65.3	Low	54 Å²	54	131.6 Å²	131.6	56%	0.557	73%	0.732	S	S	*	*			trans	-49.9	130.5	168	0	0	0	0	0	108.2	S12 M16	S12-G14 PolarHBondContact O-N 2.96Å; G14-M16 VanDerWaalsContact C-N 3.26Å; G14-M16 PolarHBondContact O-N 3.27Å
15	M	62.9	Low	65.7	Low	184 Å²	184	131.1 Å²	131.1	91%	0.906	73%	0.733	S	S	*	*			trans	-58.9	93.2	170.5	-62.9	177	-79.9	0	0	107.3	Q13	Q13-M15 PolarHBondContact O-N 3.05Å
16	M	62.7	Low	66.2	Low	143 Å²	143	129.2 Å²	129.2	70%	0.704	73%	0.732	S	S	*	*			trans	-94.9	101.8	170	-68.3	-151.8	179.9	0	0	107.6	G14 E18	G14-M16 VanDerWaalsContact C-N 3.26Å; G14-M16 PolarHBondContact O-N 3.27Å; M16-E18 PolarHBondContact O-N 3.04Å
17	D	68	Low	67.2	Low	175 Å²	175	129.4 Å²	129.4	94%	0.936	73%	0.733	S	S	*	*			trans	-75.7	51	164.6	-78.7	-55.9	0	0	0	110.3
18	E	67.9	Low	66.7	Low	142 Å²	142	137.7 Å²	137.7	66%	0.664	75%	0.746	S	S	*	*	S	Bend	trans	-123.4	128.2	172.2	-169.3	173.1	-179.8	0	0	108.5	M16 I20	M16-E18 PolarHBondContact O-N 3.04Å; E18-I20 HydrophobicContact CB-CG1 4.43Å; E18-I20 PolarHBondContact O-N 2.89Å
19	D	72.4	Confident	67.1	Low	159 Å²	159	135.2 Å²	135.2	85%	0.85	74%	0.744	S	S	*	*			trans	-66.2	77.5	171.3	-71.2	-40.7	0	0	0	109	T21	D19-T21 PolarHBondContact O-N 2.76Å
20	I	71.9	Confident	67.5	Low	110 Å²	110	133.2 Å²	133.2	56%	0.564	74%	0.738	S	S	*	*			trans	-67.9	99.5	176.8	-59.7	178.3	0	0	0	107.8	E18 C22	E18-I20 HydrophobicContact CB-CG1 4.43Å; E18-I20 PolarHBondContact O-N 2.89Å; I20-C22 PolarHBondContact O-N 3.19Å
21	T	76.2	Confident	68.2	Low	123 Å²	123	128.6 Å²	128.6	76%	0.755	73%	0.726	S	S	*	*			trans	-82.5	93.6	172.2	-57.1	0	0	0	0	108.7	D19 T23	D19-T21 PolarHBondContact O-N 2.76Å; T21-T23 PolarHBondContact O-N 3.28Å
22	C	69.5	Low	68.7	Low	99 Å²	99	129.7 Å²	129.7	67%	0.669	72%	0.719	S	S	*	*			trans	-73.7	109.3	170.4	-64.8	0	0	0	0	109.8	I20 I24	I20-C22 PolarHBondContact O-N 3.19Å; C22-I24 PolarHBondContact O-N 3.49Å
23	T	77.7	Confident	69.4	Low	127 Å²	127	128.6 Å²	128.6	78%	0.779	70%	0.702	S	S	*	*			trans	-79.1	109.3	164.3	53.6	0	0	0	0	108.8	T21 S25	T21-T23 PolarHBondContact O-N 3.28Å; T23-S25 PolarHBondContact O-N 3.39Å
24	I	69.3	Low	70.5	Confident	155 Å²	155	122.4 Å²	122.4	80%	0.795	68%	0.682	S	S	*	*			trans	-84	113.1	172.5	-57.4	166.5	0	0	0	107.5	C22 S26	C22-I24 PolarHBondContact O-N 3.49Å; I24-S26 PolarHBondContact O-N 3.24Å
25	S	71.4	Confident	71.5	Confident	92 Å²	92	122.3 Å²	122.3	64%	0.643	67%	0.669	S	S	*	*			trans	-73.2	120.9	165.3	-62.7	0	0	0	0	108.2	T23 E27	T23-S25 PolarHBondContact O-N 3.39Å; S25-E27 PolarHBondContact O-N 3.14Å
26	S	73.1	Confident	72.4	Confident	120 Å²	120	117.3 Å²	117.3	84%	0.839	64%	0.642	S	S	*	*			trans	-77.3	59.5	175.2	68.3	0	0	0	0	110.7	I24	I24-S26 PolarHBondContact O-N 3.24Å
27	E	78.6	Confident	73.4	Confident	167 Å²	167	115.6 Å²	115.6	78%	0.78	63%	0.627	S	S	*	*	P	Polyproline II helix	trans	-77.6	147.5	164.6	-60.7	-168.8	148.9	0	0	108	S25 A29	S25-E27 PolarHBondContact O-N 3.14Å; E27-A29 PolarHBondContact O-N 3.46Å
28	R	51.1	Low	74	Confident	234 Å²	234	115.3 Å²	115.3	88%	0.883	61%	0.613	S	S	*	*	P	Polyproline II helix	trans	-53.2	117.3	176.9	172	173.5	164.4	-179.6	-4.9	107.1
29	A	70.5	Confident	74.8	Confident	75 Å²	75	113.2 Å²	113.2	62%	0.62	61%	0.607	S	S	*	*	P	Polyproline II helix	trans	-49.6	130.9	176.7	0	0	0	0	0	108.1	E27 D31	E27-A29 PolarHBondContact O-N 3.46Å; A29-D31 PolarHBondContact O-N 3.35Å
30	P	71.4	Confident	75.2	Confident	86 Å²	86	111.5 Å²	111.5	56%	0.558	59%	0.592	S	S	*	*	P	Polyproline II helix	trans	-53.5	145	174.3	23.3	-32.1	0	0	0	108.5	L32	P30-L32 VanDerWaalsContact C-N 3.26Å; P30-L32 PolarHBondContact O-N 2.91Å
31	D	76.8	Confident	75.9	Confident	85 Å²	85	109.3 Å²	109.3	46%	0.455	60%	0.596	S	S	.	*			trans	-69.2	92.4	176.3	-173	-19.7	0	0	0	108.1	A29 H33 A34 D35	A29-D31 PolarHBondContact O-N 3.35Å; D31-H33 PolarHBondContact O-N 3.36Å; D31-H33 WeakPolarHBondContact OD1-CB 3.44Å; D31-H33 IonicContact OD1-CD2 2.61Å; D31-H33 PolarHBondContact OD1-N 2.88Å; D31-A34 HydrophobicContact CB-CB 3.96Å; D31-A34 PolarHBondContact O-N 2.89Å; D31-A34 PolarHBondContact OD1-N 3.3Å; D31-D35 PolarHBondContact O-N 2.99Å
32	L	72.3	Confident	75.9	Confident	104 Å²	104	109.6 Å²	109.6	55%	0.545	59%	0.585	S	S	.	*	H	α-helix	trans	-56.8	-35	-175.7	-66.8	172.3	0	0	0	110.9	P30 D35 F36	P30-L32 VanDerWaalsContact C-N 3.26Å; P30-L32 PolarHBondContact O-N 2.91Å; L32-D35 PolarHBondContact O-N 3.48Å; L32-F36 WeakPolarHBondContact O-CB 3.36Å; L32-F36 WeakPolarHBondContact O-CD2 3.24Å; L32-F36 PolarHBondContact O-N 2.97Å
33	H	75.3	Confident	76.4	Confident	86 Å²	86	105 Å²	105	40%	0.398	55%	0.554	S	S	.	*	H	α-helix	trans	-63.8	-45.3	177.4	-62.4	-86.4	0	0	0	111.3	D31 R37 D43 F45	D31-H33 PolarHBondContact O-N 3.36Å; D31-H33 WeakPolarHBondContact OD1-CB 3.44Å; D31-H33 IonicContact OD1-CD2 2.61Å; D31-H33 PolarHBondContact OD1-N 2.88Å; H33-R37 VanDerWaalsContact O-CB 3.27Å; H33-R37 WeakPolarHBondContact O-CB 3.27Å; H33-R37 PolarHBondContact O-N 3.44Å; H33-D43 VanDerWaalsContact CB-OD2 3.23Å; H33-D43 WeakPolarHBondContact CB-OD2 3.34Å; H33-D43 IonicContact CE1-OD2 3.34Å; H33-D43 IonicContact CG-OD2 3.86Å; H33-D43 IonicContact ND1-OD1 3.74Å; H33-D43 IonicContact ND1-OD2 3.61Å; H33-D43 PolarHBondContact ND1-OD2 2.93Å; H33-F45 WeakPolarHBondContact CE1-CB 3.44Å; H33-F45 AromaticContact CE1-CG 3.92Å
34	A	81	Confident	76.1	Confident	50 Å²	50	102.7 Å²	102.7	41%	0.413	54%	0.54	S	S	.	.	H	α-helix	trans	-66.3	-39.4	178.4	0	0	0	0	0	112.6	D31 R38	D31-A34 HydrophobicContact CB-CB 3.96Å; D31-A34 PolarHBondContact O-N 2.89Å; D31-A34 PolarHBondContact OD1-N 3.3Å; A34-R38 WeakPolarHBondContact O-CB 3.23Å; A34-R38 PolarHBondContact O-N 3.49Å
35	D	81.5	Confident	76.1	Confident	53 Å²	53	102 Å²	102	28%	0.283	53%	0.532	S	S	.	.	H	α-helix	trans	-68.2	-45.6	177.5	-78	-38.1	0	0	0	111.8	D31 L32 R37 R38 D39	D31-D35 PolarHBondContact O-N 2.99Å; L32-D35 PolarHBondContact O-N 3.48Å; D35-R37 PolarHBondContact O-N 2.99Å; D35-R38 PolarHBondContact O-N 2.98Å; D35-R38 IonicContact OD1-CZ 3.51Å; D35-R38 IonicContact OD1-NH1 2.89Å; D35-R38 PolarHBondContact OD1-NH1 3.27Å; D35-R38 IonicContact OD1-NH2 3.58Å; D35-D39 PolarHBondContact O-N 3.06Å; D35-D39 VanDerWaalsContact O-N 3.14Å
36	F	81.2	Confident	76.2	Confident	78 Å²	78	99.9 Å²	99.9	34%	0.342	51%	0.514	S	S	.	.	H	α-helix	trans	-59.3	-48.5	174.9	-95.4	-78.9	0	0	0	111.5	L32 R38 D39 F40	L32-F36 WeakPolarHBondContact O-CB 3.36Å; L32-F36 WeakPolarHBondContact O-CD2 3.24Å; L32-F36 PolarHBondContact O-N 2.97Å; F36-R38 VanDerWaalsContact C-N 3.31Å; F36-R38 PolarHBondContact O-N 2.95Å; F36-D39 PolarHBondContact O-N 3.21Å; F36-F40 AromaticContact CD1-CD2 3.6Å; F36-F40 HydrophobicContact CD1-CD2 3.6Å; F36-F40 AromaticContact CD1-CE2 3.71Å; F36-F40 HydrophobicContact CD1-CE2 3.71Å; F36-F40 HydrophobicContact CE1-CD2 4.19Å; F36-F40 AromaticContact CE1-CE2 3.86Å; F36-F40 HydrophobicContact CE1-CE2 3.86Å; F36-F40 WeakPolarHBondContact O-CD2 3.37Å; F36-F40 PolarHBondContact O-N 3.24Å
37	R	84.7	Confident	76.1	Confident	107 Å²	107	100 Å²	100	40%	0.404	51%	0.505	S	S	.	.	H	α-helix	trans	-61.6	-38.1	178.8	-178	175	-74.9	145.7	-5.8	112.4	H33 D35 G41 D46	H33-R37 VanDerWaalsContact O-CB 3.27Å; H33-R37 WeakPolarHBondContact O-CB 3.27Å; H33-R37 PolarHBondContact O-N 3.44Å; D35-R37 PolarHBondContact O-N 2.99Å; R37-G41 VanDerWaalsContact O-CA 3.24Å; R37-G41 WeakPolarHBondContact O-CA 3.38Å; R37-G41 PolarHBondContact O-N 3Å; R37-D46 IonicContact CZ-OD2 3.93Å; R37-D46 IonicContact NH2-OD2 2.74Å; R37-D46 PolarHBondContact NH2-OD2 3.05Å
38	R	80.7	Confident	75.7	Confident	169 Å²	169	99.5 Å²	99.5	64%	0.638	51%	0.507	S	S	*	.	H	α-helix	trans	-63.6	-42.4	177.7	-174.3	-169.9	69.6	-137.6	-7.7	111.8	A34 D35 F36	A34-R38 WeakPolarHBondContact O-CB 3.23Å; A34-R38 PolarHBondContact O-N 3.49Å; D35-R38 PolarHBondContact O-N 2.98Å; D35-R38 IonicContact OD1-CZ 3.51Å; D35-R38 IonicContact OD1-NH1 2.89Å; D35-R38 PolarHBondContact OD1-NH1 3.27Å; D35-R38 IonicContact OD1-NH2 3.58Å; F36-R38 VanDerWaalsContact C-N 3.31Å; F36-R38 PolarHBondContact O-N 2.95Å
39	D	84.3	Confident	76.4	Confident	99 Å²	99	91.5 Å²	91.5	53%	0.529	48%	0.482	S	S	.	.	H	α-helix	trans	-87.8	-35.2	-169.7	-64.8	-12.7	0	0	0	112.3	D35 F36	D35-D39 PolarHBondContact O-N 3.06Å; D35-D39 VanDerWaalsContact O-N 3.14Å; F36-D39 PolarHBondContact O-N 3.21Å
40	F	81.3	Confident	75.7	Confident	122 Å²	122	94.5 Å²	94.5	54%	0.535	49%	0.487	S	S	.	.	H	α-helix	trans	-108.8	-15.4	-175.5	-61.1	-80.1	0	0	0	114.4	F36 Y42	F36-F40 AromaticContact CD1-CD2 3.6Å; F36-F40 HydrophobicContact CD1-CD2 3.6Å; F36-F40 AromaticContact CD1-CE2 3.71Å; F36-F40 HydrophobicContact CD1-CE2 3.71Å; F36-F40 HydrophobicContact CE1-CD2 4.19Å; F36-F40 AromaticContact CE1-CE2 3.86Å; F36-F40 HydrophobicContact CE1-CE2 3.86Å; F36-F40 WeakPolarHBondContact O-CD2 3.37Å; F36-F40 PolarHBondContact O-N 3.24Å; F40-Y42 HydrophobicContact CB-CD1 3.86Å; F40-Y42 HydrophobicContact CB-CE1 3.69Å; F40-Y42 HydrophobicContact CG-CE1 4.45Å; F40-Y42 PolarHBondContact O-N 2.84Å
41	G	85.4	Confident	75.3	Confident	64 Å²	64	101.1 Å²	101.1	66%	0.66	52%	0.518	S	S	*	.	S	Bend	trans	78.6	-2.9	-178.2	0	0	0	0	0	115	R37	R37-G41 VanDerWaalsContact O-CA 3.24Å; R37-G41 WeakPolarHBondContact O-CA 3.38Å; R37-G41 PolarHBondContact O-N 3Å
42	Y	75.8	Confident	75.2	Confident	129 Å²	129	101.9 Å²	101.9	51%	0.506	52%	0.521	S	S	.	.	S	Bend	trans	-135.1	158.2	172.4	71.8	-88.7	0	0	0	109.1	F40 P44	F40-Y42 HydrophobicContact CB-CD1 3.86Å; F40-Y42 HydrophobicContact CB-CE1 3.69Å; F40-Y42 HydrophobicContact CG-CE1 4.45Å; F40-Y42 PolarHBondContact O-N 2.84Å; Y42-P44 HydrophobicContact CE2-CB 4.21Å; Y42-P44 HydrophobicContact CE2-CG 4.45Å
43	D	81	Confident	75.4	Confident	4 Å²	4	101.8 Å²	101.8	2%	0.021	52%	0.519	C	S	.	.			trans	-117.3	112.9	172.5	178.1	7.5	0	0	0	109.1	H33 F45 D46	H33-D43 VanDerWaalsContact CB-OD2 3.23Å; H33-D43 WeakPolarHBondContact CB-OD2 3.34Å; H33-D43 IonicContact CE1-OD2 3.34Å; H33-D43 IonicContact CG-OD2 3.86Å; H33-D43 IonicContact ND1-OD1 3.74Å; H33-D43 IonicContact ND1-OD2 3.61Å; H33-D43 PolarHBondContact ND1-OD2 2.93Å; D43-F45 PolarHBondContact O-N 3Å; D43-F45 WeakPolarHBondContact OD1-CD2 3.38Å; D43-F45 PolarHBondContact OD1-N 3.05Å; D43-D46 HydrophobicContact CB-CB 3.87Å; D43-D46 PolarHBondContact O-N 2.74Å
44	P	71	Confident	75.4	Confident	77 Å²	77	102.7 Å²	102.7	50%	0.5	53%	0.526	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64	-10.5	-178.4	27.4	-35.1	0	0	0	114.2	Y42	Y42-P44 HydrophobicContact CE2-CB 4.21Å; Y42-P44 HydrophobicContact CE2-CG 4.45Å
45	F	69.5	Low	75	Confident	142 Å²	142	105.8 Å²	105.8	62%	0.623	53%	0.533	S	S	*	.	T	Hydrogen-bonded Turn	trans	-101.2	-9.2	175.9	-54.1	-75.4	0	0	0	113.5	H33 D43	H33-F45 WeakPolarHBondContact CE1-CB 3.44Å; H33-F45 AromaticContact CE1-CG 3.92Å; D43-F45 PolarHBondContact O-N 3Å; D43-F45 WeakPolarHBondContact OD1-CD2 3.38Å; D43-F45 PolarHBondContact OD1-N 3.05Å
46	D	74	Confident	74.6	Confident	47 Å²	47	109.1 Å²	109.1	25%	0.251	55%	0.548	S	S	.	.			trans	-90	123.7	173.1	-158.3	-7.7	0	0	0	108.7	R37 D43 D48 D49	R37-D46 IonicContact CZ-OD2 3.93Å; R37-D46 IonicContact NH2-OD2 2.74Å; R37-D46 PolarHBondContact NH2-OD2 3.05Å; D43-D46 HydrophobicContact CB-CB 3.87Å; D43-D46 PolarHBondContact O-N 2.74Å; D46-D48 PolarHBondContact OD1-N 2.61Å; D46-D49 VanDerWaalsContact O-OD1 3.13Å
47	D	70.9	Confident	74.2	Confident	123 Å²	123	111.1 Å²	111.1	66%	0.658	56%	0.562	S	S	*	*	S	Bend	trans	-91.4	-7.9	-176.9	-170.7	9.8	0	0	0	110.9	D49 L50	D47-D49 VanDerWaalsContact C-N 3.31Å; D47-D49 PolarHBondContact O-N 3.41Å; D47-L50 HydrophobicContact CB-CD1 4.22Å; D47-L50 WeakPolarHBondContact OD1-CD1 3Å
48	D	70	Confident	73.4	Confident	155 Å²	155	111.4 Å²	111.4	83%	0.829	57%	0.573	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.8	-11.7	-176.8	-71.4	-31.7	0	0	0	113.7	D46	D46-D48 PolarHBondContact OD1-N 2.61Å
49	D	65.4	Low	72.9	Confident	66 Å²	66	107 Å²	107	35%	0.353	57%	0.569	S	S	.	*	T	Hydrogen-bonded Turn	trans	-117.3	21	174.5	65.1	-29.2	0	0	0	113.9	D46 D47 D51	D46-D49 VanDerWaalsContact O-OD1 3.13Å; D47-D49 VanDerWaalsContact C-N 3.31Å; D47-D49 PolarHBondContact O-N 3.41Å; D49-D51 PolarHBondContact O-N 3.34Å
50	L	56.8	Low	71.9	Confident	139 Å²	139	107.7 Å²	107.7	73%	0.728	57%	0.572	S	S	*	*			trans	-75.7	64.3	174.4	-88.3	173.4	0	0	0	113	D47	D47-L50 HydrophobicContact CB-CD1 4.22Å; D47-L50 WeakPolarHBondContact OD1-CD1 3Å
51	D	61.9	Low	71.1	Confident	224 Å²	224	106.4 Å²	106.4	100%	1.198	58%	0.575	S	S	*	*			trans	-102	0	169.4	73.6	-17	0	0	0	115.6	D49	D49-D51 PolarHBondContact O-N 3.34Å

Retrieved 51 of 51 residues in 13.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).