G4LYN0_SCHMA Loading...

Prophage protein

AlphaFold DB , UniProt , Accession G4LYN0, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 81 aa.

						>G4LYN0_SCHMA|G4LYN0
MRQIKKSAHSNYTMGRQSAQRYAEEIYFCSRLQDSMMANTTKKTVRSDPAKQVTEHKDAKMSSFKPGNTQSAWICNRCKGK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53	Low	63	Low	225 Å²	225	138 Å²	138	100%	1.108	68%	0.678	S	S	*	*				0	75.1	0	-66.6	-165.3	-67	0	0	112.6
2	R	63.3	Low	63.9	Low	243 Å²	243	138.2 Å²	138.2	92%	0.917	67%	0.667	S	S	*	*			trans	-107.7	-4.3	177.5	-91.7	-175.3	177.2	-168.7	-0.1	115.1
3	Q	61.2	Low	65.3	Low	155 Å²	155	131.3 Å²	131.3	72%	0.724	64%	0.639	S	S	*	*	S	Bend	trans	-78	-29.5	-172.4	-71	-81.9	28	0	0	114.7	K5 K6	Q3-K5 VanDerWaalsContact C-N 3.26Å; Q3-K5 PolarHBondContact O-N 3.43Å; Q3-K5 VanDerWaalsContact O-N 3.16Å; Q3-K6 PolarHBondContact O-N 3.45Å
4	I	59.9	Low	66.5	Low	127 Å²	127	129.8 Å²	129.8	65%	0.651	63%	0.632	S	S	*	*	H	α-helix	trans	-65.6	-25.7	-168.8	-57	173.6	0	0	0	112.9	K6 S7	I4-K6 PolarHBondContact O-N 3.27Å; I4-S7 PolarHBondContact O-OG 3.16Å
5	K	60.6	Low	67.8	Low	183 Å²	183	123.9 Å²	123.9	80%	0.796	62%	0.618	S	S	*	*	H	α-helix	trans	-71.8	-28.2	-174.7	-67.9	-172.3	177.3	-174	0	114.1	Q3	Q3-K5 VanDerWaalsContact C-N 3.26Å; Q3-K5 PolarHBondContact O-N 3.43Å; Q3-K5 VanDerWaalsContact O-N 3.16Å
6	K	59.7	Low	69	Low	162 Å²	162	126.1 Å²	126.1	70%	0.704	62%	0.617	S	S	*	*	H	α-helix	trans	-75.1	-37	-175.4	-67.7	-174.8	179.2	-177.3	0	112.7	Q3 I4 H9 S10	Q3-K6 PolarHBondContact O-N 3.45Å; I4-K6 PolarHBondContact O-N 3.27Å; K6-H9 PolarHBondContact O-N 3.07Å; K6-S10 PolarHBondContact O-N 3.46Å; K6-S10 VanDerWaalsContact O-N 3.15Å
7	S	63.6	Low	70.3	Confident	69 Å²	69	124.9 Å²	124.9	48%	0.483	61%	0.61	S	S	.	*	H	α-helix	trans	-69.1	-42.1	-178.8	62.1	0	0	0	0	112.1	I4 H9 S10 N11	I4-S7 PolarHBondContact O-OG 3.16Å; S7-H9 VanDerWaalsContact C-N 3.31Å; S7-H9 PolarHBondContact O-N 3.15Å; S7-S10 WeakPolarHBondContact O-CB 3.44Å; S7-S10 PolarHBondContact O-N 3.48Å; S7-N11 PolarHBondContact O-N 3.4Å
8	A	61.7	Low	71.4	Confident	60 Å²	60	122.3 Å²	122.3	50%	0.496	61%	0.606	S	S	.	*	H	α-helix	trans	-61.5	-40.1	177.1	0	0	0	0	0	112.1	N11 Y12	A8-N11 PolarHBondContact O-N 3.27Å; A8-Y12 PolarHBondContact O-N 3.05Å
9	H	67.9	Low	72.6	Confident	127 Å²	127	119.2 Å²	119.2	59%	0.588	60%	0.601	S	S	*	*	H	α-helix	trans	-64.6	-41.5	176.4	-170.9	68.3	0	0	0	111.8	K6 S7 N11 Y12 T13	K6-H9 PolarHBondContact O-N 3.07Å; S7-H9 VanDerWaalsContact C-N 3.31Å; S7-H9 PolarHBondContact O-N 3.15Å; H9-N11 VanDerWaalsContact C-N 3.35Å; H9-N11 PolarHBondContact O-N 3.22Å; H9-Y12 PolarHBondContact O-N 3.01Å; H9-T13 WeakPolarHBondContact O-CG2 3.28Å; H9-T13 PolarHBondContact O-N 3.35Å; H9-T13 PolarHBondContact O-OG1 2.96Å
10	S	70.7	Confident	73.7	Confident	57 Å²	57	119 Å²	119	40%	0.399	60%	0.598	S	S	.	*	H	α-helix	trans	-60	-42.8	175.5	-172.4	0	0	0	0	112.4	K6 S7 Y12 T13 M14	K6-S10 PolarHBondContact O-N 3.46Å; K6-S10 VanDerWaalsContact O-N 3.15Å; S7-S10 WeakPolarHBondContact O-CB 3.44Å; S7-S10 PolarHBondContact O-N 3.48Å; S10-Y12 VanDerWaalsContact C-N 3.34Å; S10-T13 PolarHBondContact O-N 3.44Å; S10-T13 PolarHBondContact O-OG1 3.29Å; S10-M14 VanDerWaalsContact O-CG 3.28Å; S10-M14 WeakPolarHBondContact O-CG 3.43Å; S10-M14 PolarHBondContact O-N 2.92Å
11	N	71.2	Confident	74.7	Confident	110 Å²	110	121 Å²	121	59%	0.588	60%	0.599	S	S	*	*	H	α-helix	trans	-67.4	-38.2	178.6	-66.1	-17.4	0	0	0	111.5	S7 A8 H9 M14 G15	S7-N11 PolarHBondContact O-N 3.4Å; A8-N11 PolarHBondContact O-N 3.27Å; H9-N11 VanDerWaalsContact C-N 3.35Å; H9-N11 PolarHBondContact O-N 3.22Å; N11-M14 PolarHBondContact O-N 3.38Å; N11-G15 PolarHBondContact O-N 3.48Å
12	Y	74	Confident	76.7	Confident	140 Å²	140	117.4 Å²	117.4	55%	0.549	57%	0.574	S	S	.	*	H	α-helix	trans	-64.7	-43.4	176	179.7	-99	0	0	0	112.4	A8 H9 S10 G15 R16	A8-Y12 PolarHBondContact O-N 3.05Å; H9-Y12 PolarHBondContact O-N 3.01Å; S10-Y12 VanDerWaalsContact C-N 3.34Å; Y12-G15 PolarHBondContact O-N 3.05Å; Y12-R16 HydrophobicContact CE1-CG 4.09Å; Y12-R16 PolarHBondContact O-N 2.99Å
13	T	82.6	Confident	78.3	Confident	49 Å²	49	108.6 Å²	108.6	30%	0.301	55%	0.553	S	S	.	*	H	α-helix	trans	-64.8	-41	177.2	55.3	0	0	0	0	111.6	H9 S10 R16 Q17	H9-T13 WeakPolarHBondContact O-CG2 3.28Å; H9-T13 PolarHBondContact O-N 3.35Å; H9-T13 PolarHBondContact O-OG1 2.96Å; S10-T13 PolarHBondContact O-N 3.44Å; S10-T13 PolarHBondContact O-OG1 3.29Å; T13-R16 PolarHBondContact O-N 3.45Å; T13-Q17 WeakPolarHBondContact O-CG 3.38Å; T13-Q17 PolarHBondContact O-N 3.35Å
14	M	82.2	Confident	79.9	Confident	110 Å²	110	106.2 Å²	106.2	54%	0.542	54%	0.542	S	S	.	.	H	α-helix	trans	-61.1	-44.1	173.1	-71.7	176.2	69.1	0	0	112	S10 N11 R16 Q17 S18	S10-M14 VanDerWaalsContact O-CG 3.28Å; S10-M14 WeakPolarHBondContact O-CG 3.43Å; S10-M14 PolarHBondContact O-N 2.92Å; N11-M14 PolarHBondContact O-N 3.38Å; M14-R16 VanDerWaalsContact C-N 3.35Å; M14-R16 PolarHBondContact O-N 2.91Å; M14-Q17 PolarHBondContact O-N 3.47Å; M14-S18 PolarHBondContact O-N 3.02Å; M14-S18 PolarHBondContact O-OG 3.41Å; M14-S18 VanDerWaalsContact O-OG 3.14Å
15	G	84.7	Confident	81.6	Confident	41 Å²	41	105.2 Å²	105.2	42%	0.423	54%	0.535	S	S	.	.	H	α-helix	trans	-58.6	-44.3	176.2	0	0	0	0	0	112.6	N11 Y12 S18 A19	N11-G15 PolarHBondContact O-N 3.48Å; Y12-G15 PolarHBondContact O-N 3.05Å; G15-S18 PolarHBondContact O-N 2.87Å; G15-A19 PolarHBondContact O-N 2.88Å
16	R	87.8	Confident	83.3	Confident	160 Å²	160	100.7 Å²	100.7	60%	0.604	52%	0.518	S	S	*	.	H	α-helix	trans	-63.3	-44.1	175.3	-77	-168.9	68.9	125.7	0	112.9	Y12 T13 M14 S18 A19 Q20	Y12-R16 HydrophobicContact CE1-CG 4.09Å; Y12-R16 PolarHBondContact O-N 2.99Å; T13-R16 PolarHBondContact O-N 3.45Å; M14-R16 VanDerWaalsContact C-N 3.35Å; M14-R16 PolarHBondContact O-N 2.91Å; R16-S18 VanDerWaalsContact C-N 3.31Å; R16-S18 PolarHBondContact O-N 3.4Å; R16-A19 PolarHBondContact O-N 3.45Å; R16-Q20 WeakPolarHBondContact O-CB 3.41Å; R16-Q20 PolarHBondContact O-N 2.97Å
17	Q	90.2	Very high	84.9	Confident	106 Å²	106	99.8 Å²	99.8	50%	0.495	51%	0.512	S	S	.	.	H	α-helix	trans	-62.9	-40.3	178.6	-73.3	178.9	16.2	0	0	111.5	T13 M14 Q20 R21	T13-Q17 WeakPolarHBondContact O-CG 3.38Å; T13-Q17 PolarHBondContact O-N 3.35Å; M14-Q17 PolarHBondContact O-N 3.47Å; Q17-Q20 PolarHBondContact O-N 3.27Å; Q17-R21 WeakPolarHBondContact O-CG 3.42Å; Q17-R21 PolarHBondContact O-N 3.33Å
18	S	90.7	Very high	86.4	Confident	78 Å²	78	102.5 Å²	102.5	55%	0.545	52%	0.515	S	S	.	.	H	α-helix	trans	-63.3	-45.7	175.2	-64.1	0	0	0	0	112	M14 G15 R16 Q20 R21 Y22	M14-S18 PolarHBondContact O-N 3.02Å; M14-S18 PolarHBondContact O-OG 3.41Å; M14-S18 VanDerWaalsContact O-OG 3.14Å; G15-S18 PolarHBondContact O-N 2.87Å; R16-S18 VanDerWaalsContact C-N 3.31Å; R16-S18 PolarHBondContact O-N 3.4Å; S18-Q20 VanDerWaalsContact C-N 3.32Å; S18-Q20 PolarHBondContact O-N 2.96Å; S18-R21 PolarHBondContact O-N 3.14Å; S18-Y22 PolarHBondContact O-N 3.35Å
19	A	93.7	Very high	87.9	Confident	62 Å²	62	103.2 Å²	103.2	51%	0.512	52%	0.515	S	S	.	.	H	α-helix	trans	-62.6	-39.3	176.9	0	0	0	0	0	112.2	G15 R16 Y22 A23	G15-A19 PolarHBondContact O-N 2.88Å; R16-A19 PolarHBondContact O-N 3.45Å; A19-Y22 PolarHBondContact O-N 2.94Å; A19-A23 PolarHBondContact O-N 3.01Å
20	Q	95.4	Very high	89.1	Confident	115 Å²	115	99.4 Å²	99.4	54%	0.537	50%	0.503	S	S	.	.	H	α-helix	trans	-64.5	-48.2	176.7	-179.1	178.1	-12.4	0	0	111.8	R16 Q17 S18 Y22 A23 E24	R16-Q20 WeakPolarHBondContact O-CB 3.41Å; R16-Q20 PolarHBondContact O-N 2.97Å; Q17-Q20 PolarHBondContact O-N 3.27Å; S18-Q20 VanDerWaalsContact C-N 3.32Å; S18-Q20 PolarHBondContact O-N 2.96Å; Q20-Y22 VanDerWaalsContact C-N 3.26Å; Q20-Y22 PolarHBondContact O-N 3.13Å; Q20-A23 PolarHBondContact O-N 3.33Å; Q20-A23 VanDerWaalsContact O-N 3.13Å; Q20-E24 WeakPolarHBondContact CG-OE1 3.44Å; Q20-E24 PolarHBondContact NE2-OE1 3.42Å; Q20-E24 WeakPolarHBondContact O-CG 3.37Å; Q20-E24 PolarHBondContact O-N 3.07Å
21	R	94.5	Very high	90	Very high	163 Å²	163	104.1 Å²	104.1	62%	0.615	51%	0.512	S	S	*	.	H	α-helix	trans	-57.3	-42	176.9	-74.5	178.7	-178.8	-176.3	1.7	111.6	Q17 S18 E24 E25	Q17-R21 WeakPolarHBondContact O-CG 3.42Å; Q17-R21 PolarHBondContact O-N 3.33Å; S18-R21 PolarHBondContact O-N 3.14Å; R21-E24 PolarHBondContact O-N 3.4Å; R21-E25 WeakPolarHBondContact O-CG 3.35Å; R21-E25 PolarHBondContact O-N 2.85Å
22	Y	95.6	Very high	90.9	Very high	148 Å²	148	102.5 Å²	102.5	58%	0.58	50%	0.503	S	S	*	.	H	α-helix	trans	-63.2	-44.4	176.5	-176.2	-102.8	0	0	0	112.2	S18 A19 Q20 E24 E25 I26	S18-Y22 PolarHBondContact O-N 3.35Å; A19-Y22 PolarHBondContact O-N 2.94Å; Q20-Y22 VanDerWaalsContact C-N 3.26Å; Q20-Y22 PolarHBondContact O-N 3.13Å; Y22-E24 VanDerWaalsContact C-N 3.32Å; Y22-E24 PolarHBondContact O-N 3.43Å; Y22-E25 PolarHBondContact O-N 3.47Å; Y22-I26 HydrophobicContact CD1-CG1 4.23Å; Y22-I26 HydrophobicContact CE1-CD1 4.36Å; Y22-I26 HydrophobicContact CE1-CG1 3.83Å; Y22-I26 HydrophobicContact CE2-CD1 4.21Å; Y22-I26 HydrophobicContact CE2-CG1 4.26Å; Y22-I26 WeakPolarHBondContact O-CG1 3.3Å; Y22-I26 PolarHBondContact O-N 3Å
23	A	95.8	Very high	91.7	Very high	59 Å²	59	102 Å²	102	49%	0.488	51%	0.505	S	S	.	.	H	α-helix	trans	-61.5	-40.2	176.3	0	0	0	0	0	112.4	A19 Q20 I26 Y27	A19-A23 PolarHBondContact O-N 3.01Å; Q20-A23 PolarHBondContact O-N 3.33Å; Q20-A23 VanDerWaalsContact O-N 3.13Å; A23-I26 PolarHBondContact O-N 3.44Å; A23-Y27 WeakPolarHBondContact O-CB 3.39Å; A23-Y27 PolarHBondContact O-N 3.29Å
24	E	95.7	Very high	91.9	Very high	105 Å²	105	104.7 Å²	104.7	49%	0.491	52%	0.518	S	S	.	.	H	α-helix	trans	-65	-41.9	175.8	-72.1	170.8	-174.6	0	0	112	Q20 R21 Y22 Y27 F28	Q20-E24 WeakPolarHBondContact CG-OE1 3.44Å; Q20-E24 PolarHBondContact NE2-OE1 3.42Å; Q20-E24 WeakPolarHBondContact O-CG 3.37Å; Q20-E24 PolarHBondContact O-N 3.07Å; R21-E24 PolarHBondContact O-N 3.4Å; Y22-E24 VanDerWaalsContact C-N 3.32Å; Y22-E24 PolarHBondContact O-N 3.43Å; E24-Y27 PolarHBondContact O-N 2.94Å; E24-F28 VanDerWaalsContact O-CB 3.3Å; E24-F28 WeakPolarHBondContact O-CB 3.34Å; E24-F28 PolarHBondContact O-N 2.96Å
25	E	95.8	Very high	92	Very high	105 Å²	105	101.8 Å²	101.8	49%	0.491	51%	0.509	S	S	.	.	H	α-helix	trans	-61.4	-46.7	174.8	-76.1	178.7	176.8	0	0	111.6	R21 Y22 F28 C29	R21-E25 WeakPolarHBondContact O-CG 3.35Å; R21-E25 PolarHBondContact O-N 2.85Å; Y22-E25 PolarHBondContact O-N 3.47Å; E25-F28 PolarHBondContact O-N 2.89Å; E25-C29 WeakPolarHBondContact O-CB 3.43Å; E25-C29 PolarHBondContact O-N 3.11Å; E25-C29 PolarHBondContact O-SG 3.43Å
26	I	95.2	Very high	92	Very high	89 Å²	89	105.9 Å²	105.9	46%	0.456	52%	0.519	S	S	.	.	H	α-helix	trans	-63.2	-43.8	178.1	-64.7	-61	0	0	0	111.1	Y22 A23 C29 S30	Y22-I26 HydrophobicContact CD1-CG1 4.23Å; Y22-I26 HydrophobicContact CE1-CD1 4.36Å; Y22-I26 HydrophobicContact CE1-CG1 3.83Å; Y22-I26 HydrophobicContact CE2-CD1 4.21Å; Y22-I26 HydrophobicContact CE2-CG1 4.26Å; Y22-I26 WeakPolarHBondContact O-CG1 3.3Å; Y22-I26 PolarHBondContact O-N 3Å; A23-I26 PolarHBondContact O-N 3.44Å; I26-C29 PolarHBondContact O-N 3.47Å; I26-S30 PolarHBondContact O-N 2.98Å
27	Y	94.6	Very high	91.7	Very high	143 Å²	143	103.7 Å²	103.7	56%	0.561	52%	0.517	S	S	*	.	H	α-helix	trans	-62.4	-42.5	176.1	177.9	-103	0	0	0	111.9	A23 E24 S30 R31	A23-Y27 WeakPolarHBondContact O-CB 3.39Å; A23-Y27 PolarHBondContact O-N 3.29Å; E24-Y27 PolarHBondContact O-N 2.94Å; Y27-S30 PolarHBondContact O-N 3.35Å; Y27-S30 PolarHBondContact O-OG 3.25Å; Y27-R31 HydrophobicContact CD1-CG 4.49Å; Y27-R31 HydrophobicContact CE1-CG 4.15Å; Y27-R31 HydrophobicContact CE2-CG 4.35Å; Y27-R31 VanDerWaalsContact O-CG 3.3Å; Y27-R31 WeakPolarHBondContact O-CG 3.4Å; Y27-R31 PolarHBondContact O-N 3.43Å; Y27-R31 VanDerWaalsContact O-N 3.11Å
28	F	94	Very high	91.1	Very high	126 Å²	126	101 Å²	101	55%	0.553	51%	0.512	S	S	*	.	H	α-helix	trans	-64.2	-43.7	176.9	-177.5	-106.4	0	0	0	111.6	E24 E25 S30 R31 L32	E24-F28 VanDerWaalsContact O-CB 3.3Å; E24-F28 WeakPolarHBondContact O-CB 3.34Å; E24-F28 PolarHBondContact O-N 2.96Å; E25-F28 PolarHBondContact O-N 2.89Å; F28-S30 PolarHBondContact O-N 2.89Å; F28-R31 PolarHBondContact O-N 2.97Å; F28-L32 HydrophobicContact CD1-CD1 3.77Å; F28-L32 HydrophobicContact CD1-CG 4.21Å; F28-L32 HydrophobicContact CE1-CD1 3.29Å; F28-L32 HydrophobicContact CE1-CD2 4.4Å; F28-L32 HydrophobicContact CE1-CG 3.87Å; F28-L32 HydrophobicContact CE2-CG 4.43Å; F28-L32 HydrophobicContact CZ-CD1 3.81Å; F28-L32 HydrophobicContact CZ-CD2 4.06Å; F28-L32 HydrophobicContact CZ-CG 3.98Å; F28-L32 WeakPolarHBondContact O-CG 3.3Å; F28-L32 PolarHBondContact O-N 3.31Å
29	C	94.1	Very high	90.1	Very high	74 Å²	74	101.9 Å²	101.9	50%	0.5	51%	0.511	S	S	.	.	H	α-helix	trans	-60.2	-42.6	176.2	-74.1	0	0	0	0	112.6	E25 I26 L32 Q33	E25-C29 WeakPolarHBondContact O-CB 3.43Å; E25-C29 PolarHBondContact O-N 3.11Å; E25-C29 PolarHBondContact O-SG 3.43Å; I26-C29 PolarHBondContact O-N 3.47Å; C29-L32 PolarHBondContact O-N 3.49Å; C29-Q33 PolarHBondContact O-N 3.2Å
30	S	91.9	Very high	88.7	Confident	48 Å²	48	102.2 Å²	102.2	34%	0.336	51%	0.506	S	S	.	.	H	α-helix	trans	-65	-42.4	177.3	66.1	0	0	0	0	111.7	I26 Y27 F28 L32 Q33 D34	I26-S30 PolarHBondContact O-N 2.98Å; Y27-S30 PolarHBondContact O-N 3.35Å; Y27-S30 PolarHBondContact O-OG 3.25Å; F28-S30 PolarHBondContact O-N 2.89Å; S30-L32 VanDerWaalsContact C-N 3.33Å; S30-L32 PolarHBondContact O-N 2.9Å; S30-Q33 PolarHBondContact O-N 3.31Å; S30-D34 PolarHBondContact O-N 3.22Å
31	R	91.3	Very high	87	Confident	155 Å²	155	100.6 Å²	100.6	59%	0.585	50%	0.504	S	S	*	.	H	α-helix	trans	-63.6	-38.1	174.9	-62	-140.9	91.9	170.6	9.8	112.6	Y27 F28 D34 S35	Y27-R31 HydrophobicContact CD1-CG 4.49Å; Y27-R31 HydrophobicContact CE1-CG 4.15Å; Y27-R31 HydrophobicContact CE2-CG 4.35Å; Y27-R31 VanDerWaalsContact O-CG 3.3Å; Y27-R31 WeakPolarHBondContact O-CG 3.4Å; Y27-R31 PolarHBondContact O-N 3.43Å; Y27-R31 VanDerWaalsContact O-N 3.11Å; F28-R31 PolarHBondContact O-N 2.97Å; R31-D34 PolarHBondContact O-N 2.94Å; R31-S35 WeakPolarHBondContact O-CB 3.36Å; R31-S35 PolarHBondContact O-N 2.91Å
32	L	88.8	Confident	85.3	Confident	76 Å²	76	100 Å²	100	40%	0.398	51%	0.506	S	S	.	.	H	α-helix	trans	-62.9	-44.7	174.3	-77	-177.6	0	0	0	110.9	F28 C29 S30 S35 M36	F28-L32 HydrophobicContact CD1-CD1 3.77Å; F28-L32 HydrophobicContact CD1-CG 4.21Å; F28-L32 HydrophobicContact CE1-CD1 3.29Å; F28-L32 HydrophobicContact CE1-CD2 4.4Å; F28-L32 HydrophobicContact CE1-CG 3.87Å; F28-L32 HydrophobicContact CE2-CG 4.43Å; F28-L32 HydrophobicContact CZ-CD1 3.81Å; F28-L32 HydrophobicContact CZ-CD2 4.06Å; F28-L32 HydrophobicContact CZ-CG 3.98Å; F28-L32 WeakPolarHBondContact O-CG 3.3Å; F28-L32 PolarHBondContact O-N 3.31Å; C29-L32 PolarHBondContact O-N 3.49Å; S30-L32 VanDerWaalsContact C-N 3.33Å; S30-L32 PolarHBondContact O-N 2.9Å; L32-S35 PolarHBondContact O-N 2.68Å; L32-S35 PolarHBondContact O-OG 2.9Å; L32-M36 WeakPolarHBondContact O-CG 3.37Å; L32-M36 PolarHBondContact O-N 3.5Å
33	Q	91	Very high	83.3	Confident	129 Å²	129	100.9 Å²	100.9	60%	0.603	51%	0.513	S	S	*	.	H	α-helix	trans	-61.3	-46.8	176.8	-171.8	173.4	3	0	0	111.7	C29 S30 S35 M36 M37	C29-Q33 PolarHBondContact O-N 3.2Å; S30-Q33 PolarHBondContact O-N 3.31Å; Q33-S35 VanDerWaalsContact C-N 3.27Å; Q33-S35 PolarHBondContact O-N 3.42Å; Q33-M36 PolarHBondContact O-N 2.92Å; Q33-M36 VanDerWaalsContact O-N 3.14Å; Q33-M37 VanDerWaalsContact O-CG 3.3Å; Q33-M37 WeakPolarHBondContact O-CG 3.28Å; Q33-M37 PolarHBondContact O-N 3.27Å
34	D	87.3	Confident	81.3	Confident	106 Å²	106	102.3 Å²	102.3	57%	0.567	52%	0.516	S	S	*	.	H	α-helix	trans	-59	-40.9	175.3	-71.4	-19.5	0	0	0	111.6	S30 R31 M37 A38	S30-D34 PolarHBondContact O-N 3.22Å; R31-D34 PolarHBondContact O-N 2.94Å; D34-M37 PolarHBondContact O-N 3.22Å; D34-A38 VanDerWaalsContact O-CB 3.28Å; D34-A38 WeakPolarHBondContact O-CB 3.43Å; D34-A38 PolarHBondContact O-N 3.02Å
35	S	84.2	Confident	79.2	Confident	49 Å²	49	102.2 Å²	102.2	34%	0.343	52%	0.522	S	S	.	.	H	α-helix	trans	-64.7	-40.6	177	82.5	0	0	0	0	111.7	R31 L32 Q33 N39	R31-S35 WeakPolarHBondContact O-CB 3.36Å; R31-S35 PolarHBondContact O-N 2.91Å; L32-S35 PolarHBondContact O-N 2.68Å; L32-S35 PolarHBondContact O-OG 2.9Å; Q33-S35 VanDerWaalsContact C-N 3.27Å; Q33-S35 PolarHBondContact O-N 3.42Å; S35-N39 WeakPolarHBondContact O-CB 3.3Å; S35-N39 VanDerWaalsContact O-CG 3.28Å; S35-N39 PolarHBondContact O-N 2.86Å; S35-N39 PolarHBondContact O-ND2 3.38Å
36	M	85	Confident	77.1	Confident	128 Å²	128	106 Å²	106	63%	0.631	53%	0.532	S	S	*	.	H	α-helix	trans	-65.3	-45.2	176.5	-71.4	177.9	69	0	0	110.4	L32 Q33 N39 T40	L32-M36 WeakPolarHBondContact O-CG 3.37Å; L32-M36 PolarHBondContact O-N 3.5Å; Q33-M36 PolarHBondContact O-N 2.92Å; Q33-M36 VanDerWaalsContact O-N 3.14Å; M36-N39 PolarHBondContact O-N 3.31Å; M36-T40 WeakPolarHBondContact O-CG2 3.26Å; M36-T40 PolarHBondContact O-N 3.1Å; M36-T40 PolarHBondContact O-OG1 3.24Å
37	M	80.8	Confident	75.1	Confident	114 Å²	114	105.2 Å²	105.2	56%	0.562	54%	0.535	S	S	*	.	H	α-helix	trans	-63.5	-42.7	178.1	-66.9	-60.8	-75	0	0	111.9	Q33 D34 N39 T40 T41	Q33-M37 VanDerWaalsContact O-CG 3.3Å; Q33-M37 WeakPolarHBondContact O-CG 3.28Å; Q33-M37 PolarHBondContact O-N 3.27Å; D34-M37 PolarHBondContact O-N 3.22Å; M37-N39 VanDerWaalsContact C-N 3.32Å; M37-N39 PolarHBondContact O-N 3.13Å; M37-T40 VanDerWaalsContact CA-OG1 3.26Å; M37-T40 WeakPolarHBondContact CA-OG1 3.43Å; M37-T40 PolarHBondContact O-N 2.83Å; M37-T40 PolarHBondContact O-OG1 2.79Å; M37-T41 PolarHBondContact O-N 3.26Å; M37-T41 PolarHBondContact O-OG1 3.42Å
38	A	78.5	Confident	72.9	Confident	48 Å²	48	104.1 Å²	104.1	40%	0.397	54%	0.539	S	S	.	.	H	α-helix	trans	-62.4	-39.4	175.8	0	0	0	0	0	112	D34 K42	D34-A38 VanDerWaalsContact O-CB 3.28Å; D34-A38 WeakPolarHBondContact O-CB 3.43Å; D34-A38 PolarHBondContact O-N 3.02Å; A38-K42 VanDerWaalsContact O-CG 3.31Å; A38-K42 WeakPolarHBondContact O-CG 3.31Å; A38-K42 PolarHBondContact O-N 3.03Å; A38-K42 VanDerWaalsContact O-N 3.08Å
39	N	68.8	Low	70.9	Confident	97 Å²	97	102.8 Å²	102.8	52%	0.519	54%	0.543	S	S	.	.	H	α-helix	trans	-70.3	-37.2	176.2	-74	-51.9	0	0	0	112.1	S35 M36 M37 K43	S35-N39 WeakPolarHBondContact O-CB 3.3Å; S35-N39 VanDerWaalsContact O-CG 3.28Å; S35-N39 PolarHBondContact O-N 2.86Å; S35-N39 PolarHBondContact O-ND2 3.38Å; M36-N39 PolarHBondContact O-N 3.31Å; M37-N39 VanDerWaalsContact C-N 3.32Å; M37-N39 PolarHBondContact O-N 3.13Å; N39-K43 PolarHBondContact O-N 2.88Å
40	T	64.4	Low	68.9	Low	69 Å²	69	103.6 Å²	103.6	42%	0.423	55%	0.554	S	S	.	*	H	α-helix	trans	-67.2	-44.2	174.3	51	0	0	0	0	111.3	M36 M37 K42 K43 T44	M36-T40 WeakPolarHBondContact O-CG2 3.26Å; M36-T40 PolarHBondContact O-N 3.1Å; M36-T40 PolarHBondContact O-OG1 3.24Å; M37-T40 VanDerWaalsContact CA-OG1 3.26Å; M37-T40 WeakPolarHBondContact CA-OG1 3.43Å; M37-T40 PolarHBondContact O-N 2.83Å; M37-T40 PolarHBondContact O-OG1 2.79Å; T40-K42 VanDerWaalsContact C-N 3.34Å; T40-K42 PolarHBondContact O-N 3.31Å; T40-K43 CarbonylContact O-C 3.56Å; T40-K43 WeakPolarHBondContact O-CA 3.26Å; T40-K43 WeakPolarHBondContact O-CB 3.47Å; T40-K43 PolarHBondContact O-N 3.22Å; T40-T44 PolarHBondContact O-N 2.87Å; T40-T44 PolarHBondContact O-OG1 3.24Å
41	T	60.3	Low	67	Low	81 Å²	81	110.6 Å²	110.6	50%	0.497	58%	0.579	S	S	.	*	H	α-helix	trans	-61.1	-42.6	177.1	-56.8	0	0	0	0	111.2	M37 K43 T44 V45	M37-T41 PolarHBondContact O-N 3.26Å; M37-T41 PolarHBondContact O-OG1 3.42Å; T41-K43 VanDerWaalsContact C-N 3.3Å; T41-K43 PolarHBondContact O-N 3.14Å; T41-T44 PolarHBondContact O-N 3.35Å; T41-V45 HydrophobicContact CG2-CG2 4.31Å; T41-V45 WeakPolarHBondContact O-CB 3.42Å; T41-V45 VanDerWaalsContact O-CG2 3.26Å; T41-V45 WeakPolarHBondContact O-CG2 3.47Å; T41-V45 PolarHBondContact O-N 2.74Å
42	K	57.6	Low	65	Low	151 Å²	151	109.9 Å²	109.9	66%	0.657	58%	0.582	S	S	*	*	H	α-helix	trans	-62.1	-36.8	174.3	-72.5	177.5	-175.6	-177.5	0	112.5	A38 T40 R46	A38-K42 VanDerWaalsContact O-CG 3.31Å; A38-K42 WeakPolarHBondContact O-CG 3.31Å; A38-K42 PolarHBondContact O-N 3.03Å; A38-K42 VanDerWaalsContact O-N 3.08Å; T40-K42 VanDerWaalsContact C-N 3.34Å; T40-K42 PolarHBondContact O-N 3.31Å; K42-R46 PolarHBondContact O-N 3.4Å
43	K	55	Low	62.8	Low	167 Å²	167	112.4 Å²	112.4	73%	0.726	60%	0.6	S	S	*	*	H	α-helix	trans	-67.8	-43.7	173.5	-92.4	-174.7	172	-178.8	0	112	N39 T40 T41 R46 S47	N39-K43 PolarHBondContact O-N 2.88Å; T40-K43 CarbonylContact O-C 3.56Å; T40-K43 WeakPolarHBondContact O-CA 3.26Å; T40-K43 WeakPolarHBondContact O-CB 3.47Å; T40-K43 PolarHBondContact O-N 3.22Å; T41-K43 VanDerWaalsContact C-N 3.3Å; T41-K43 PolarHBondContact O-N 3.14Å; K43-R46 CarbonylContact O-C 3.59Å; K43-R46 PolarHBondContact O-N 2.85Å; K43-S47 PolarHBondContact O-N 3.42Å
44	T	52.2	Low	60.6	Low	88 Å²	88	111.3 Å²	111.3	54%	0.54	60%	0.603	S	S	.	*	H	α-helix	trans	-65.4	-41.7	179.2	-52.6	0	0	0	0	111.5	T40 T41 R46 S47 D48	T40-T44 PolarHBondContact O-N 2.87Å; T40-T44 PolarHBondContact O-OG1 3.24Å; T41-T44 PolarHBondContact O-N 3.35Å; T44-R46 VanDerWaalsContact C-N 3.26Å; T44-R46 PolarHBondContact O-N 3.24Å; T44-S47 WeakPolarHBondContact CA-OG 3.47Å; T44-S47 CarbonylContact O-C 3.5Å; T44-S47 WeakPolarHBondContact O-CA 3.33Å; T44-S47 PolarHBondContact O-N 3.4Å; T44-S47 PolarHBondContact O-OG 3.01Å; T44-D48 PolarHBondContact O-N 3.08Å
45	V	53.3	Low	58.6	Low	104 Å²	104	115 Å²	115	63%	0.63	62%	0.616	S	S	*	*	H	α-helix	trans	-62.7	-35.2	174.9	172	0	0	0	0	111.2	T41 S47	T41-V45 HydrophobicContact CG2-CG2 4.31Å; T41-V45 WeakPolarHBondContact O-CB 3.42Å; T41-V45 VanDerWaalsContact O-CG2 3.26Å; T41-V45 WeakPolarHBondContact O-CG2 3.47Å; T41-V45 PolarHBondContact O-N 2.74Å; V45-S47 VanDerWaalsContact C-N 3.3Å
46	R	51.6	Low	56.7	Low	184 Å²	184	120.3 Å²	120.3	69%	0.694	64%	0.635	S	S	*	*	H	α-helix	trans	-76.5	-19.1	174.3	-154.3	178.9	-177.2	-160.3	-0.3	112.9	K42 K43 T44 D48	K42-R46 PolarHBondContact O-N 3.4Å; K43-R46 CarbonylContact O-C 3.59Å; K43-R46 PolarHBondContact O-N 2.85Å; T44-R46 VanDerWaalsContact C-N 3.26Å; T44-R46 PolarHBondContact O-N 3.24Å; R46-D48 VanDerWaalsContact C-N 3.32Å
47	S	52.7	Low	54.8	Low	73 Å²	73	123.1 Å²	123.1	51%	0.51	64%	0.644	S	S	.	*	T	Hydrogen-bonded Turn	trans	-92.1	19.8	176.9	74.4	0	0	0	0	113.9	K43 T44 V45 P49	K43-S47 PolarHBondContact O-N 3.42Å; T44-S47 WeakPolarHBondContact CA-OG 3.47Å; T44-S47 CarbonylContact O-C 3.5Å; T44-S47 WeakPolarHBondContact O-CA 3.33Å; T44-S47 PolarHBondContact O-N 3.4Å; T44-S47 PolarHBondContact O-OG 3.01Å; V45-S47 VanDerWaalsContact C-N 3.3Å; S47-P49 WeakPolarHBondContact O-CD 3.07Å
48	D	48.8	Very low	53.3	Low	120 Å²	120	124.9 Å²	124.9	64%	0.642	66%	0.656	S	S	*	*			trans	-92.8	77.5	153.7	-86.5	-31.9	0	0	0	109.4	T44 R46 A50	T44-D48 PolarHBondContact O-N 3.08Å; R46-D48 VanDerWaalsContact C-N 3.32Å; D48-A50 PolarHBondContact O-N 3.39Å
49	P	51	Low	51.8	Low	98 Å²	98	125.8 Å²	125.8	64%	0.636	66%	0.664	S	S	*	*	G	3₁₀ helix	trans	-67.5	-14.5	179.4	29.2	-36.6	0	0	0	112.8	S47 K51	S47-P49 WeakPolarHBondContact O-CD 3.07Å; P49-K51 PolarHBondContact O-N 3.01Å
50	A	52.2	Low	50.7	Low	90 Å²	90	131 Å²	131	74%	0.744	68%	0.682	S	S	*	*	G	3₁₀ helix	trans	-70.5	-14.3	-173.2	0	0	0	0	0	114.4	D48	D48-A50 PolarHBondContact O-N 3.39Å
51	K	52.6	Low	49.9	Very low	195 Å²	195	135.8 Å²	135.8	85%	0.848	70%	0.701	S	S	*	*	G	3₁₀ helix	trans	-118.9	-0.2	-177.9	-71.8	-170.5	-180	-178.3	0	116.1	P49	P49-K51 PolarHBondContact O-N 3.01Å
52	Q	48.2	Very low	49.4	Very low	140 Å²	140	136.9 Å²	136.9	65%	0.654	71%	0.712	S	S	*	*			trans	-102.8	19.9	-177.5	-148.5	178.8	101.1	0	0	113.9	T54	Q52-T54 PolarHBondContact O-N 2.79Å
53	V	43.7	Very low	48.9	Very low	130 Å²	130	134.5 Å²	134.5	79%	0.788	71%	0.714	S	S	*	*	S	Bend	trans	-69.5	-8.3	-179.8	178.4	0	0	0	0	113.1
54	T	44	Very low	48.5	Very low	106 Å²	106	135.3 Å²	135.3	65%	0.65	72%	0.718	S	S	*	*	S	Bend	trans	-127.5	123.7	177.7	38.6	0	0	0	0	110.4	Q52	Q52-T54 PolarHBondContact O-N 2.79Å
55	E	45.5	Very low	48.4	Very low	182 Å²	182	139.8 Å²	139.8	85%	0.85	73%	0.73	S	S	*	*	S	Bend	trans	88.7	66.5	162.1	-54.7	172.6	-164.4	0	0	117.5
56	H	44.4	Very low	48.2	Very low	161 Å²	161	140 Å²	140	75%	0.745	73%	0.734	S	S	*	*				-153.6	78.3	127	-139.4	-47.7	0	0	0	110.6	D58	H56-D58 PolarHBondContact O-N 3.06Å
57	K	45.7	Very low	47.7	Very low	188 Å²	188	133.5 Å²	133.5	82%	0.817	72%	0.724	S	S	*	*			trans	-67.6	127	163.5	-74	-160.6	173.9	-172.7	0	108.7	A59	K57-A59 PolarHBondContact O-N 2.87Å
58	D	48.1	Very low	47.4	Very low	150 Å²	150	137.4 Å²	137.4	80%	0.802	74%	0.739	S	S	*	*			trans	64.3	36.4	149.8	-47.5	-39.6	0	0	0	119.6	H56 K60	H56-D58 PolarHBondContact O-N 3.06Å; D58-K60 VanDerWaalsContact C-N 3.34Å; D58-K60 PolarHBondContact O-N 3.04Å
59	A	48.5	Very low	47.4	Very low	68 Å²	68	137.6 Å²	137.6	56%	0.562	75%	0.745	S	S	*	*			trans	-77.8	90.1	158.9	0	0	0	0	0	109.9	K57 M61	K57-A59 PolarHBondContact O-N 2.87Å; A59-M61 PolarHBondContact O-N 3Å
60	K	44.4	Very low	47.4	Very low	206 Å²	206	142.2 Å²	142.2	90%	0.896	76%	0.758	S	S	*	*			trans	-19.2	89	162.7	-157.2	172.9	-170.9	-179.3	0	112.7	D58 S62	D58-K60 VanDerWaalsContact C-N 3.34Å; D58-K60 PolarHBondContact O-N 3.04Å; K60-S62 VanDerWaalsContact C-N 3.31Å; K60-S62 PolarHBondContact O-N 3.22Å
61	M	48.2	Very low	47.2	Very low	169 Å²	169	141.7 Å²	141.7	83%	0.833	75%	0.749	S	S	*	*			trans	-74.3	90.3	-178.7	-131.8	157.2	-178.5	0	0	107.6	A59 S63	A59-M61 PolarHBondContact O-N 3Å; M61-S63 PolarHBondContact O-N 3.36Å; M61-S63 VanDerWaalsContact O-N 3.15Å
62	S	50.4	Low	47.3	Very low	105 Å²	105	136.4 Å²	136.4	73%	0.734	74%	0.741	S	S	*	*			trans	-45.8	119.5	165.7	176.7	0	0	0	0	108.3	K60 F64	K60-S62 VanDerWaalsContact C-N 3.31Å; K60-S62 PolarHBondContact O-N 3.22Å; S62-F64 VanDerWaalsContact C-N 3.28Å; S62-F64 PolarHBondContact O-N 3.2Å
63	S	47.1	Very low	47.9	Very low	100 Å²	100	140.7 Å²	140.7	70%	0.699	75%	0.752	S	S	*	*			trans	-68.3	89.7	178.4	54.4	0	0	0	0	108.9	M61 K65	M61-S63 PolarHBondContact O-N 3.36Å; M61-S63 VanDerWaalsContact O-N 3.15Å; S63-K65 PolarHBondContact O-N 3.47Å
64	F	45.5	Very low	48.8	Very low	184 Å²	184	141.3 Å²	141.3	81%	0.807	75%	0.749	S	S	*	*			trans	-66.7	101.5	166.6	-163.5	-97.3	0	0	0	106.9	S62 P66	S62-F64 VanDerWaalsContact C-N 3.28Å; S62-F64 PolarHBondContact O-N 3.2Å; F64-P66 WeakPolarHBondContact O-CD 2.85Å
65	K	50.9	Low	49.1	Very low	183 Å²	183	140.2 Å²	140.2	80%	0.796	75%	0.745	S	S	*	*			trans	-75.9	107.4	169.2	-69.4	-175.3	178.5	-178.6	0	107.3	S63 G67	S63-K65 PolarHBondContact O-N 3.47Å; K65-G67 PolarHBondContact O-N 2.99Å
66	P	48.4	Very low	49.7	Very low	108 Å²	108	138.3 Å²	138.3	70%	0.701	74%	0.741	S	S	*	*			trans	-67.9	106.1	166.6	28.3	-31.9	0	0	0	107.4	F64 N68	F64-P66 WeakPolarHBondContact O-CD 2.85Å; P66-N68 PolarHBondContact O-N 2.93Å
67	G	41.3	Very low	50.2	Low	48 Å²	48	140.4 Å²	140.4	50%	0.495	74%	0.742	S	S	.	*			trans	-58.1	108.7	169.1	0	0	0	0	0	109.5	K65 T69	K65-G67 PolarHBondContact O-N 2.99Å; G67-T69 PolarHBondContact O-N 2.95Å; G67-T69 PolarHBondContact O-OG1 2.84Å
68	N	46.1	Very low	50.6	Low	155 Å²	155	137 Å²	137	83%	0.829	74%	0.74	S	S	*	*			trans	13.4	71	141.5	65.4	-9.5	0	0	0	117.3	P66	P66-N68 PolarHBondContact O-N 2.93Å
69	T	49.4	Very low	50.9	Low	124 Å²	124	139.3 Å²	139.3	76%	0.761	74%	0.743	S	S	*	*			trans	-122.6	84.3	157.7	34.5	0	0	0	0	108.3	G67 S71	G67-T69 PolarHBondContact O-N 2.95Å; G67-T69 PolarHBondContact O-OG1 2.84Å; T69-S71 VanDerWaalsContact C-N 3.29Å; T69-S71 PolarHBondContact O-N 2.98Å
70	Q	50.5	Low	51.3	Low	195 Å²	195	139.1 Å²	139.1	91%	0.911	75%	0.748	S	S	*	*			trans	-61.9	93.2	159	-72.7	176.4	-6.8	0	0	107.9	A72	Q70-A72 PolarHBondContact O-N 2.82Å
71	S	48.9	Very low	51.3	Low	78 Å²	78	142.9 Å²	142.9	55%	0.545	77%	0.765	S	S	.	*			trans	-92.5	82.9	158.2	-57.2	0	0	0	0	107.2	T69 W73	T69-S71 VanDerWaalsContact C-N 3.29Å; T69-S71 PolarHBondContact O-N 2.98Å; S71-W73 PolarHBondContact O-N 3.03Å; S71-W73 PolarHBondContact O-NE1 2.87Å
72	A	55	Low	51.5	Low	84 Å²	84	141.6 Å²	141.6	69%	0.694	76%	0.761	S	S	*	*			trans	-76.8	100.2	167.8	0	0	0	0	0	108	Q70 I74	Q70-A72 PolarHBondContact O-N 2.82Å; A72-I74 PolarHBondContact O-N 3.15Å; A72-I74 VanDerWaalsContact O-N 3.13Å
73	W	59.4	Low	51.6	Low	231 Å²	231	143.5 Å²	143.5	88%	0.875	76%	0.763	S	S	*	*			trans	-80.5	91.4	175.7	-48.2	84.1	0	0	0	108.4	S71 C75	S71-W73 PolarHBondContact O-N 3.03Å; S71-W73 PolarHBondContact O-NE1 2.87Å; W73-C75 PolarHBondContact O-N 3.22Å
74	I	62.7	Low	51.8	Low	142 Å²	142	145.9 Å²	145.9	73%	0.728	77%	0.766	S	S	*	*			trans	-73.5	110.9	171.3	-68.4	171.3	0	0	0	107.9	A72 N76	A72-I74 PolarHBondContact O-N 3.15Å; A72-I74 VanDerWaalsContact O-N 3.13Å; I74-N76 PolarHBondContact O-N 3.18Å; I74-N76 VanDerWaalsContact O-N 3.1Å
75	C	51.3	Low	52.2	Low	83 Å²	83	143.6 Å²	143.6	56%	0.561	76%	0.764	S	S	*	*			trans	-71	100.7	173.6	-174.8	0	0	0	0	109.6	W73 R77 C78	W73-C75 PolarHBondContact O-N 3.22Å; C75-R77 PolarHBondContact O-N 3.38Å; C75-C78 PolarHBondContact O-N 3.21Å
76	N	57.1	Low	52.3	Low	142 Å²	142	141.2 Å²	141.2	76%	0.759	76%	0.762	S	S	*	*	G	3₁₀ helix	trans	-59.2	-9.8	175.5	-83.1	-31.6	0	0	0	114	I74 C78	I74-N76 PolarHBondContact O-N 3.18Å; I74-N76 VanDerWaalsContact O-N 3.1Å; N76-C78 VanDerWaalsContact C-N 3.32Å; N76-C78 PolarHBondContact O-N 3.46Å
77	R	55.7	Low	52.5	Low	205 Å²	205	143.4 Å²	143.4	77%	0.774	77%	0.766	S	S	*	*	G	3₁₀ helix	trans	-73.9	-19.4	178.1	-169.9	159.5	-77.8	171.6	-1	113.4	C75 K79	C75-R77 PolarHBondContact O-N 3.38Å; R77-K79 VanDerWaalsContact C-N 3.31Å; R77-K79 PolarHBondContact O-N 3.05Å
78	C	54.1	Low	53.3	Low	116 Å²	116	150.2 Å²	150.2	78%	0.784	79%	0.785	S	S	*	*	G	3₁₀ helix	trans	-80.2	-6.5	179.7	-63.5	0	0	0	0	114.4	C75 N76	C75-C78 PolarHBondContact O-N 3.21Å; N76-C78 VanDerWaalsContact C-N 3.32Å; N76-C78 PolarHBondContact O-N 3.46Å
79	K	54.1	Low	53.9	Low	199 Å²	199	149.8 Å²	149.8	87%	0.865	78%	0.782	S	S	*	*	G	3₁₀ helix	trans	-92.8	3.4	-176.3	-115.3	-164	-176.5	-169.6	0	115.4	R77	R77-K79 VanDerWaalsContact C-N 3.31Å; R77-K79 PolarHBondContact O-N 3.05Å
80	G	55.9	Low	54.3	Low	65 Å²	65	152 Å²	152	67%	0.67	78%	0.783	S	S	*	*			trans	-120.5	76.9	-177.7	0	0	0	0	0	112.5
81	K	46.4	Very low	54.6	Low	284 Å²	284	148.1 Å²	148.1	100%	1.235	77%	0.772	S	S	*	*			trans	-150.1	0	150.3	-88.7	-163.5	179.5	179.5	0	109.3

Retrieved 81 of 81 residues in 37.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).