G4LYQ4_SCHMA Loading...

Uncharacterized protein AlphaSync

AlphaFold DB , UniProt , Accession G4LYQ4, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 127 aa.

						>G4LYQ4_SCHMA|G4LYQ4
MPTEKEIGLAIYLESLNIGVCCLLGIRTQGSSEVIQARSPHFESLFRMRLSGHSVLFPSGFAGVDVPLSSRAEAELADGIPINLRLCAVRLESSVKVRRNLCGERCFLAISAYTPTGCCQDSTKDDL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	73.1	Confident	84.4	Confident	219 Å²	219	81.2 Å²	81.2	100%	1.079	42%	0.42	S	S	*	.				0	137.8	0	-76.2	-62.2	179.9	0	0	107.4
2	P	78	Confident	85	Confident	40 Å²	40	86 Å²	86	26%	0.26	43%	0.43	S	S	.	.			trans	-67	144.1	-177.8	28.3	-34.8	0	0	0	111.8	E6 I7 I35 Q36 A37	P2-E6 WeakPolarHBondContact CA-OE2 3.48Å; P2-E6 HydrophobicContact CB-CB 4.32Å; P2-I7 HydrophobicContact CB-CG1 4.07Å; P2-I7 HydrophobicContact CG-CD1 4.25Å; P2-I7 HydrophobicContact CG-CG1 4.13Å; P2-I35 HydrophobicContact CB-CG2 3.71Å; P2-Q36 WeakPolarHBondContact CG-O 3.3Å; P2-A37 HydrophobicContact CB-CB 4.22Å
3	T	83.6	Confident	85.5	Confident	65 Å²	65	79.8 Å²	79.8	40%	0.399	40%	0.399	S	S	.	.			trans	-78.1	160.4	174.2	67	0	0	0	0	111.2	K5 E6 I7	T3-K5 PolarHBondContact O-N 3.08Å; T3-E6 WeakPolarHBondContact CG2-OE1 3.36Å; T3-E6 PolarHBondContact N-OE2 2.83Å; T3-E6 PolarHBondContact O-N 3Å; T3-E6 WeakPolarHBondContact OG1-CG 3.36Å; T3-E6 PolarHBondContact OG1-N 3.06Å; T3-E6 PolarHBondContact OG1-OE1 3.09Å; T3-I7 WeakPolarHBondContact O-CG1 3.43Å; T3-I7 PolarHBondContact O-N 3.47Å
4	E	84.8	Confident	85.8	Confident	177 Å²	177	76.6 Å²	76.6	83%	0.827	38%	0.382	S	S	*	.	H	α-helix	trans	-56	-34.4	175.1	-171.7	-178.6	178	0	0	112	I7 G8	E4-I7 PolarHBondContact O-N 2.78Å; E4-G8 PolarHBondContact O-N 3.46Å
5	K	83.7	Confident	86.1	Confident	183 Å²	183	76.3 Å²	76.3	80%	0.796	39%	0.391	S	S	*	.	H	α-helix	trans	-64.9	-43.1	175.5	-67.5	-178	179.1	177.8	0	112.1	T3 G8 L9	T3-K5 PolarHBondContact O-N 3.08Å; K5-G8 PolarHBondContact O-N 2.84Å; K5-L9 VanDerWaalsContact O-CB 3.25Å; K5-L9 WeakPolarHBondContact O-CB 3.27Å; K5-L9 PolarHBondContact O-N 2.8Å
6	E	84	Confident	86.4	Confident	26 Å²	26	76.8 Å²	76.8	12%	0.121	39%	0.394	C	S	.	.	H	α-helix	trans	-68.6	-40.2	178.4	-69.7	149.8	-148.6	0	0	111.4	P2 T3 L9 A10 I35 M48	P2-E6 WeakPolarHBondContact CA-OE2 3.48Å; P2-E6 HydrophobicContact CB-CB 4.32Å; T3-E6 WeakPolarHBondContact CG2-OE1 3.36Å; T3-E6 PolarHBondContact N-OE2 2.83Å; T3-E6 PolarHBondContact O-N 3Å; T3-E6 WeakPolarHBondContact OG1-CG 3.36Å; T3-E6 PolarHBondContact OG1-N 3.06Å; T3-E6 PolarHBondContact OG1-OE1 3.09Å; E6-L9 PolarHBondContact O-N 2.88Å; E6-A10 WeakPolarHBondContact O-CB 3.31Å; E6-A10 PolarHBondContact O-N 2.77Å; E6-I35 WeakPolarHBondContact OE2-CD1 3.08Å; E6-I35 WeakPolarHBondContact OE2-CG2 3.37Å; E6-M48 HydrophobicContact CB-CE 4.15Å; E6-M48 HydrophobicContact CB-SD 3.66Å; E6-M48 HydrophobicContact CG-SD 3.67Å; E6-M48 WeakPolarHBondContact O-CE 3.44Å
7	I	86.2	Confident	86.7	Confident	55 Å²	55	81.3 Å²	81.3	28%	0.282	42%	0.419	S	S	.	.	H	α-helix	trans	-63.4	-47.9	174.6	-62.5	168.8	0	0	0	110.2	P2 T3 E4 L9 A10 I11	P2-I7 HydrophobicContact CB-CG1 4.07Å; P2-I7 HydrophobicContact CG-CD1 4.25Å; P2-I7 HydrophobicContact CG-CG1 4.13Å; T3-I7 WeakPolarHBondContact O-CG1 3.43Å; T3-I7 PolarHBondContact O-N 3.47Å; E4-I7 PolarHBondContact O-N 2.78Å; I7-L9 VanDerWaalsContact C-N 3.31Å; I7-L9 PolarHBondContact O-N 2.63Å; I7-A10 PolarHBondContact O-N 3.3Å; I7-I11 HydrophobicContact CG2-CD1 4Å; I7-I11 WeakPolarHBondContact O-CG1 3.19Å; I7-I11 PolarHBondContact O-N 2.77Å
8	G	88.9	Confident	86.9	Confident	37 Å²	37	80.2 Å²	80.2	38%	0.381	41%	0.413	S	S	.	.	H	α-helix	trans	-60.7	-39.8	177.7	0	0	0	0	0	112.7	E4 K5 I11 Y12	E4-G8 PolarHBondContact O-N 3.46Å; K5-G8 PolarHBondContact O-N 2.84Å; G8-I11 PolarHBondContact O-N 2.82Å; G8-Y12 WeakPolarHBondContact O-CB 3.47Å; G8-Y12 PolarHBondContact O-N 2.93Å
9	L	88.3	Confident	86.9	Confident	40 Å²	40	77.4 Å²	77.4	21%	0.209	41%	0.406	C	S	.	.	H	α-helix	trans	-63.4	-44	173.8	174.6	65.8	0	0	0	111.9	K5 E6 I7 I11 Y12 L13 L23 M48 P67	K5-L9 VanDerWaalsContact O-CB 3.25Å; K5-L9 WeakPolarHBondContact O-CB 3.27Å; K5-L9 PolarHBondContact O-N 2.8Å; E6-L9 PolarHBondContact O-N 2.88Å; I7-L9 VanDerWaalsContact C-N 3.31Å; I7-L9 PolarHBondContact O-N 2.63Å; L9-I11 PolarHBondContact O-N 2.87Å; L9-Y12 PolarHBondContact O-N 2.79Å; L9-L13 HydrophobicContact CD1-CD1 4.11Å; L9-L13 HydrophobicContact CD1-CD2 4.49Å; L9-L13 HydrophobicContact CD1-CG 4.04Å; L9-L13 HydrophobicContact CG-CD1 4.12Å; L9-L13 HydrophobicContact CG-CG 4.43Å; L9-L13 WeakPolarHBondContact O-CG 3.29Å; L9-L13 PolarHBondContact O-N 2.8Å; L9-L23 HydrophobicContact CD1-CD1 4.37Å; L9-L23 HydrophobicContact CD2-CD1 3.4Å; L9-L23 HydrophobicContact CG-CD1 4.49Å; L9-M48 HydrophobicContact CB-CE 4.13Å; L9-M48 HydrophobicContact CD2-CE 3.67Å; L9-M48 HydrophobicContact CD2-SD 4.19Å; L9-M48 HydrophobicContact CG-CE 3.96Å; L9-P67 HydrophobicContact CD2-CG 3.93Å
10	A	88.3	Confident	87	Confident	0 Å²	0	75.6 Å²	75.6	0%	0	40%	0.398	C	S	.	.	H	α-helix	trans	-60.1	-45.8	176.6	0	0	0	0	0	111.6	E6 I7 Y12 L13 E14 A37 F46 M48	E6-A10 WeakPolarHBondContact O-CB 3.31Å; E6-A10 PolarHBondContact O-N 2.77Å; I7-A10 PolarHBondContact O-N 3.3Å; A10-Y12 VanDerWaalsContact C-N 3.31Å; A10-Y12 PolarHBondContact O-N 3.05Å; A10-L13 PolarHBondContact O-N 3.25Å; A10-E14 WeakPolarHBondContact O-CB 3.2Å; A10-E14 PolarHBondContact O-N 3.1Å; A10-A37 HydrophobicContact CB-CB 3.87Å; A10-F46 HydrophobicContact CB-CB 4.03Å; A10-F46 HydrophobicContact CB-CD2 4.11Å; A10-F46 HydrophobicContact CB-CG 4.23Å; A10-M48 HydrophobicContact CB-CE 4.22Å
11	I	90	Very high	87.1	Confident	51 Å²	51	73.4 Å²	73.4	26%	0.262	39%	0.389	S	S	.	.	H	α-helix	trans	-59.4	-43.6	175.2	-65.1	165.7	0	0	0	110.8	I7 G8 L9 E14 S15 P40	I7-I11 HydrophobicContact CG2-CD1 4Å; I7-I11 WeakPolarHBondContact O-CG1 3.19Å; I7-I11 PolarHBondContact O-N 2.77Å; G8-I11 PolarHBondContact O-N 2.82Å; L9-I11 PolarHBondContact O-N 2.87Å; I11-E14 PolarHBondContact O-N 3.34Å; I11-S15 WeakPolarHBondContact O-CB 3.49Å; I11-S15 PolarHBondContact O-N 3.2Å; I11-P40 HydrophobicContact CD1-CG 4.24Å
12	Y	91.7	Very high	87.7	Confident	139 Å²	139	64.4 Å²	64.4	55%	0.545	35%	0.347	S	S	.	.	H	α-helix	trans	-65	-48.9	-179.4	-179.9	-108	0	0	0	112.3	G8 L9 A10 E14 S15 L16	G8-Y12 WeakPolarHBondContact O-CB 3.47Å; G8-Y12 PolarHBondContact O-N 2.93Å; L9-Y12 PolarHBondContact O-N 2.79Å; A10-Y12 VanDerWaalsContact C-N 3.31Å; A10-Y12 PolarHBondContact O-N 3.05Å; Y12-E14 VanDerWaalsContact C-N 3.27Å; Y12-E14 PolarHBondContact O-N 3.18Å; Y12-S15 PolarHBondContact O-N 3.07Å; Y12-S15 PolarHBondContact O-OG 3.4Å; Y12-L16 HydrophobicContact CD1-CD1 4.17Å; Y12-L16 HydrophobicContact CE1-CD1 3.54Å; Y12-L16 HydrophobicContact CE2-CD1 4Å; Y12-L16 HydrophobicContact CE2-CG 4.49Å; Y12-L16 VanDerWaalsContact CZ-CD1 3.45Å; Y12-L16 PolarHBondContact O-N 2.8Å
13	L	91.2	Very high	88	Confident	5 Å²	5	64.5 Å²	64.5	3%	0.026	35%	0.345	C	S	.	.	H	α-helix	trans	-60.2	-40.2	178.4	-69.2	176.4	0	0	0	111.8	L9 A10 L16 N17 I18 C21 F46 P67	L9-L13 HydrophobicContact CD1-CD1 4.11Å; L9-L13 HydrophobicContact CD1-CD2 4.49Å; L9-L13 HydrophobicContact CD1-CG 4.04Å; L9-L13 HydrophobicContact CG-CD1 4.12Å; L9-L13 HydrophobicContact CG-CG 4.43Å; L9-L13 WeakPolarHBondContact O-CG 3.29Å; L9-L13 PolarHBondContact O-N 2.8Å; A10-L13 PolarHBondContact O-N 3.25Å; L13-L16 CarbonylContact O-C 3.44Å; L13-L16 PolarHBondContact O-N 3.24Å; L13-N17 PolarHBondContact O-N 3.05Å; L13-N17 VanDerWaalsContact O-N 3.14Å; L13-I18 HydrophobicContact CB-CB 4.41Å; L13-I18 HydrophobicContact CD2-CB 4.08Å; L13-I18 HydrophobicContact CD2-CD1 4.13Å; L13-I18 HydrophobicContact CD2-CG2 3.94Å; L13-I18 PolarHBondContact O-N 3.08Å; L13-C21 HydrophobicContact CD1-CB 3.95Å; L13-C21 HydrophobicContact CD2-CB 3.81Å; L13-F46 HydrophobicContact CB-CE1 3.98Å; L13-F46 HydrophobicContact CB-CZ 3.97Å; L13-F46 HydrophobicContact CD1-CD1 4.22Å; L13-F46 HydrophobicContact CD1-CE1 4.05Å; L13-P67 HydrophobicContact CD1-CB 3.57Å; L13-P67 HydrophobicContact CD1-CG 4.07Å
14	E	88.9	Confident	87.8	Confident	35 Å²	35	63.3 Å²	63.3	16%	0.164	34%	0.336	C	S	.	.	H	α-helix	trans	-64.9	-42.9	175.6	179.4	164.6	-137.7	0	0	113	A10 I11 Y12 L16 N17 S39 F42 S44 F46	A10-E14 WeakPolarHBondContact O-CB 3.2Å; A10-E14 PolarHBondContact O-N 3.1Å; I11-E14 PolarHBondContact O-N 3.34Å; Y12-E14 VanDerWaalsContact C-N 3.27Å; Y12-E14 PolarHBondContact O-N 3.18Å; E14-L16 PolarHBondContact O-N 3.01Å; E14-L16 VanDerWaalsContact O-N 3.09Å; E14-N17 PolarHBondContact O-N 3.26Å; E14-S39 WeakPolarHBondContact OE2-CB 2.84Å; E14-S39 PolarHBondContact OE2-OG 3.09Å; E14-F42 VanDerWaalsContact CD-CD2 3.46Å; E14-F42 HydrophobicContact CG-CB 4.34Å; E14-F42 HydrophobicContact CG-CD1 4.19Å; E14-F42 HydrophobicContact CG-CD2 4.06Å; E14-F42 HydrophobicContact CG-CE1 4.49Å; E14-F42 HydrophobicContact CG-CE2 4.36Å; E14-F42 HydrophobicContact CG-CG 3.97Å; E14-F42 WeakPolarHBondContact OE1-CB 3.2Å; E14-F42 VanDerWaalsContact OE1-CG 3.3Å; E14-F42 WeakPolarHBondContact OE1-CG 3.25Å; E14-F42 WeakPolarHBondContact OE2-CB 3.47Å; E14-F42 WeakPolarHBondContact OE2-CD2 3.1Å; E14-F42 VanDerWaalsContact OE2-CG 3.24Å; E14-F42 WeakPolarHBondContact OE2-CG 3.24Å; E14-S44 WeakPolarHBondContact OE1-CB 3.37Å; E14-S44 PolarHBondContact OE1-OG 3.24Å; E14-S44 PolarHBondContact OE2-OG 3.19Å; E14-F46 HydrophobicContact CB-CE2 4.13Å
15	S	90.8	Very high	87.2	Confident	73 Å²	73	56.7 Å²	56.7	51%	0.51	32%	0.315	S	S	.	.	H	α-helix	trans	-58.6	-25.3	176.4	78.8	0	0	0	0	112.8	I11 Y12	I11-S15 WeakPolarHBondContact O-CB 3.49Å; I11-S15 PolarHBondContact O-N 3.2Å; Y12-S15 PolarHBondContact O-N 3.07Å; Y12-S15 PolarHBondContact O-OG 3.4Å
16	L	91.7	Very high	86.7	Confident	84 Å²	84	49.9 Å²	49.9	44%	0.44	29%	0.287	S	S	.	.	T	Hydrogen-bonded Turn	trans	-97.7	1.3	177.3	-61.6	-179.2	0	0	0	113.6	Y12 L13 E14 I18	Y12-L16 HydrophobicContact CD1-CD1 4.17Å; Y12-L16 HydrophobicContact CE1-CD1 3.54Å; Y12-L16 HydrophobicContact CE2-CD1 4Å; Y12-L16 HydrophobicContact CE2-CG 4.49Å; Y12-L16 VanDerWaalsContact CZ-CD1 3.45Å; Y12-L16 PolarHBondContact O-N 2.8Å; L13-L16 CarbonylContact O-C 3.44Å; L13-L16 PolarHBondContact O-N 3.24Å; E14-L16 PolarHBondContact O-N 3.01Å; E14-L16 VanDerWaalsContact O-N 3.09Å; L16-I18 HydrophobicContact CB-CD1 3.71Å; L16-I18 HydrophobicContact CB-CG1 3.8Å; L16-I18 HydrophobicContact CD1-CD1 3.8Å; L16-I18 HydrophobicContact CG-CD1 4.44Å; L16-I18 PolarHBondContact O-N 2.88Å
17	N	90.2	Very high	85.8	Confident	153 Å²	153	58.7 Å²	58.7	82%	0.818	32%	0.319	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.6	39	-173.9	-167.5	32.3	0	0	0	113.1	L13 E14	L13-N17 PolarHBondContact O-N 3.05Å; L13-N17 VanDerWaalsContact O-N 3.14Å; E14-N17 PolarHBondContact O-N 3.26Å
18	I	90.5	Very high	84.6	Confident	61 Å²	61	57.2 Å²	57.2	31%	0.313	31%	0.313	S	S	.	.			trans	-91.6	115.5	177.7	-64.7	172.7	0	0	0	108.9	L13 L16 V20 C21 F46	L13-I18 HydrophobicContact CB-CB 4.41Å; L13-I18 HydrophobicContact CD2-CB 4.08Å; L13-I18 HydrophobicContact CD2-CD1 4.13Å; L13-I18 HydrophobicContact CD2-CG2 3.94Å; L13-I18 PolarHBondContact O-N 3.08Å; L16-I18 HydrophobicContact CB-CD1 3.71Å; L16-I18 HydrophobicContact CB-CG1 3.8Å; L16-I18 HydrophobicContact CD1-CD1 3.8Å; L16-I18 HydrophobicContact CG-CD1 4.44Å; L16-I18 PolarHBondContact O-N 2.88Å; I18-V20 WeakPolarHBondContact CG2-O 3.19Å; I18-C21 HydrophobicContact CG2-CB 4.4Å; I18-F46 WeakPolarHBondContact O-CE1 2.82Å; I18-F46 WeakPolarHBondContact O-CZ 3.38Å
19	G	87.6	Confident	83.2	Confident	27 Å²	27	64 Å²	64	28%	0.278	34%	0.335	S	S	.	.	S	Bend	trans	-83.8	-25	178.5	0	0	0	0	0	114.8	L68 S69 A72	G19-L68 WeakPolarHBondContact O-CA 3.33Å; G19-S69 PolarHBondContact O-N 2.91Å; G19-A72 WeakPolarHBondContact O-CB 3.43Å
20	V	88.8	Confident	81.7	Confident	41 Å²	41	63.5 Å²	63.5	25%	0.248	34%	0.339	C	S	.	.	B	Isolated β-bridge	trans	-139.1	129.8	-178.2	-178.8	0	0	0	0	108.3	I18 V66 L68 A72 V89 L91	I18-V20 WeakPolarHBondContact CG2-O 3.19Å; V20-V66 HydrophobicContact CG1-CG1 4.32Å; V20-L68 HydrophobicContact CB-CD2 4.11Å; V20-L68 HydrophobicContact CG1-CD2 3.78Å; V20-L68 HydrophobicContact CG2-CD2 3.73Å; V20-A72 HydrophobicContact CG2-CB 3.72Å; V20-V89 HydrophobicContact CG1-CG1 4.32Å; V20-L91 HydrophobicContact CG2-CD1 3.61Å
21	C	88	Confident	80.1	Confident	30 Å²	30	66.7 Å²	66.7	20%	0.203	36%	0.361	C	S	.	.			trans	-128.8	143.4	170.1	-168.4	0	0	0	0	109.4	L13 I18 V66 P67	L13-C21 HydrophobicContact CD1-CB 3.95Å; L13-C21 HydrophobicContact CD2-CB 3.81Å; I18-C21 HydrophobicContact CG2-CB 4.4Å; C21-V66 WeakPolarHBondContact O-CA 2.96Å; C21-V66 WeakPolarHBondContact O-CG1 3.5Å; C21-P67 HydrophobicContact CB-CB 4.49Å; C21-P67 HydrophobicContact CB-CG 4.38Å; C21-P67 PolarHBondContact N-O 3.32Å; C21-P67 WeakPolarHBondContact O-CD 3.41Å
22	C	86.8	Confident	78.8	Confident	31 Å²	31	68.1 Å²	68.1	21%	0.209	38%	0.376	C	S	.	.			trans	-112.3	113	172.3	-66.5	0	0	0	0	108.3
23	L	84	Confident	77.7	Confident	42 Å²	42	66 Å²	66	22%	0.22	37%	0.371	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.3	114.2	-179.5	-60.8	179	0	0	0	109.2	L9 I26 V64 D65 P67	L9-L23 HydrophobicContact CD1-CD1 4.37Å; L9-L23 HydrophobicContact CD2-CD1 3.4Å; L9-L23 HydrophobicContact CG-CD1 4.49Å; L23-I26 HydrophobicContact CB-CG2 4.08Å; L23-V64 CarbonylContact O-C 3.56Å; L23-V64 VanDerWaalsContact O-CA 3.28Å; L23-V64 WeakPolarHBondContact O-CA 3.34Å; L23-D65 HydrophobicContact CB-CB 4.26Å; L23-D65 PolarHBondContact N-O 3.14Å; L23-D65 PolarHBondContact O-N 3.25Å; L23-P67 HydrophobicContact CD1-CG 3.76Å; L23-P67 HydrophobicContact CG-CG 4.29Å
24	L	79.6	Confident	77	Confident	39 Å²	39	69.2 Å²	69.2	20%	0.204	39%	0.391	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.4	155.6	176.7	-52.9	177.4	0	0	0	109.4	I26 V64 S111	L24-I26 VanDerWaalsContact C-N 3.3Å; L24-I26 PolarHBondContact O-N 3.06Å; L24-V64 HydrophobicContact CD2-CB 3.98Å; L24-V64 HydrophobicContact CD2-CG1 3.45Å; L24-V64 VanDerWaalsContact CD2-CG1 3.45Å; L24-V64 HydrophobicContact CD2-CG2 3.43Å; L24-V64 VanDerWaalsContact CD2-CG2 3.43Å; L24-S111 VanDerWaalsContact CD1-OG 3.29Å; L24-S111 WeakPolarHBondContact CD1-OG 3.45Å
25	G	72.9	Confident	76.6	Confident	38 Å²	38	68.5 Å²	68.5	39%	0.392	39%	0.388	S	S	.	.	E	Extended strand (participates in β ladder)	trans	81.9	8	173.5	0	0	0	0	0	114.5	G63	G25-G63 PolarHBondContact N-O 3.45Å; G25-G63 VanDerWaalsContact N-O 3.09Å
26	I	71.6	Confident	76.3	Confident	41 Å²	41	70.4 Å²	70.4	21%	0.21	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75	137	-176.2	54.3	162.8	0	0	0	110.6	L23 L24 T28 L50 A62 G63 D65	L23-I26 HydrophobicContact CB-CG2 4.08Å; L24-I26 VanDerWaalsContact C-N 3.3Å; L24-I26 PolarHBondContact O-N 3.06Å; I26-T28 HydrophobicContact CD1-CG2 3.68Å; I26-T28 HydrophobicContact CG1-CG2 4.25Å; I26-T28 PolarHBondContact O-N 3.49Å; I26-L50 HydrophobicContact CD1-CD2 3.56Å; I26-A62 CarbonylContact O-C 3.53Å; I26-A62 WeakPolarHBondContact O-CA 3.48Å; I26-G63 WeakPolarHBondContact CG1-O 3.32Å; I26-G63 PolarHBondContact N-O 2.74Å; I26-G63 PolarHBondContact O-N 2.94Å; I26-D65 HydrophobicContact CD1-CB 3.3Å
27	R	66.8	Low	75.9	Confident	210 Å²	210	66.4 Å²	66.4	79%	0.792	37%	0.368	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-91	102.5	173.2	-67.2	-173.4	-176.3	-173.4	0.2	109
28	T	60.8	Low	75.4	Confident	24 Å²	24	66 Å²	66	15%	0.147	36%	0.355	C	S	.	.			trans	-109.2	123.4	173.7	53.4	0	0	0	0	109.2	I26 G30 L50 G52	I26-T28 HydrophobicContact CD1-CG2 3.68Å; I26-T28 HydrophobicContact CG1-CG2 4.25Å; I26-T28 PolarHBondContact O-N 3.49Å; T28-G30 PolarHBondContact O-N 3.36Å; T28-L50 HydrophobicContact CG2-CD1 4.48Å; T28-L50 HydrophobicContact CG2-CD2 3.61Å; T28-L50 HydrophobicContact CG2-CG 4.44Å; T28-G52 WeakPolarHBondContact OG1-CA 3.21Å
29	Q	59	Low	74.5	Confident	180 Å²	180	63.2 Å²	63.2	84%	0.841	34%	0.341	S	S	*	.			trans	-78.4	-8	174	-65	-169.3	22.1	0	0	112.8	S54	Q29-S54 VanDerWaalsContact O-CB 3.25Å; Q29-S54 WeakPolarHBondContact O-CB 3.23Å; Q29-S54 PolarHBondContact O-OG 3.32Å
30	G	55.6	Low	73.6	Confident	29 Å²	29	66.6 Å²	66.6	30%	0.299	36%	0.358	S	S	.	.	S	Bend	trans	-88.8	163.8	-177	0	0	0	0	0	114.3	T28	T28-G30 PolarHBondContact O-N 3.36Å
31	S	56.7	Low	72.7	Confident	67 Å²	67	72 Å²	72	47%	0.469	38%	0.38	S	S	.	.			trans	-67.5	172.5	165.9	73.9	0	0	0	0	110.5	E33	S31-E33 PolarHBondContact O-N 3.25Å; S31-E33 PolarHBondContact OG-OE1 2.53Å
32	S	62.3	Low	71.6	Confident	81 Å²	81	75.3 Å²	75.3	57%	0.566	39%	0.391	S	S	*	.	S	Bend	trans	-60.4	110	174	-172	0	0	0	0	109.6	L50	S32-L50 CarbonylContact C-O 3.59Å; S32-L50 WeakPolarHBondContact CA-O 3.15Å; S32-L50 WeakPolarHBondContact CB-O 3.49Å; S32-L50 PolarHBondContact OG-O 2.9Å
33	E	67.6	Low	70.7	Confident	94 Å²	94	81.7 Å²	81.7	44%	0.439	42%	0.418	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129	142.8	-173	-78.2	176.8	-150.2	0	0	109.5	S31 I35 L50	S31-E33 PolarHBondContact O-N 3.25Å; S31-E33 PolarHBondContact OG-OE1 2.53Å; E33-I35 HydrophobicContact CB-CG1 4.47Å; E33-L50 PolarHBondContact N-O 2.88Å; E33-L50 PolarHBondContact O-N 2.87Å
34	V	76.9	Confident	70.1	Confident	73 Å²	73	81.1 Å²	81.1	44%	0.442	42%	0.417	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.9	107.3	174.7	-169.9	0	0	0	0	108.3	R47 M48 R49	V34-R47 HydrophobicContact CG1-CG 3.3Å; V34-M48 CarbonylContact C-O 3.53Å; V34-M48 VanDerWaalsContact CA-O 3.27Å; V34-M48 WeakPolarHBondContact CA-O 3.34Å; V34-R49 HydrophobicContact CG1-CG 4.15Å; V34-R49 HydrophobicContact CG2-CG 4.26Å
35	I	81.2	Confident	70.3	Confident	21 Å²	21	80.9 Å²	80.9	11%	0.108	42%	0.416	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.9	136.3	-177.5	-57	-176.6	0	0	0	109.8	P2 E6 E33 R47 M48 L50	P2-I35 HydrophobicContact CB-CG2 3.71Å; E6-I35 WeakPolarHBondContact OE2-CD1 3.08Å; E6-I35 WeakPolarHBondContact OE2-CG2 3.37Å; E33-I35 HydrophobicContact CB-CG1 4.47Å; I35-R47 CarbonylContact O-C 3.6Å; I35-R47 WeakPolarHBondContact O-CA 3.24Å; I35-M48 HydrophobicContact CB-CB 4.49Å; I35-M48 PolarHBondContact N-O 2.95Å; I35-M48 PolarHBondContact O-N 2.93Å; I35-L50 HydrophobicContact CD1-CD1 3.4Å; I35-L50 HydrophobicContact CG1-CD1 3.96Å
36	Q	84.7	Confident	71	Confident	113 Å²	113	79.3 Å²	79.3	53%	0.528	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.4	112.9	177.6	176.6	172.7	-17.8	0	0	108.9	P2 L45 F46	P2-Q36 WeakPolarHBondContact CG-O 3.3Å; Q36-L45 HydrophobicContact CG-CD1 3.4Å; Q36-L45 HydrophobicContact CG-CD2 3.66Å; Q36-L45 HydrophobicContact CG-CG 3.61Å; Q36-F46 CarbonylContact C-O 3.54Å; Q36-F46 WeakPolarHBondContact CA-O 3.27Å
37	A	81.8	Confident	71.6	Confident	0 Å²	0	81.7 Å²	81.7	0%	0	41%	0.405	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.4	123.5	177.3	0	0	0	0	0	109.1	P2 A10 F46 M48	P2-A37 HydrophobicContact CB-CB 4.22Å; A10-A37 HydrophobicContact CB-CB 3.87Å; A37-F46 PolarHBondContact N-O 3.01Å; A37-F46 PolarHBondContact O-N 2.84Å; A37-M48 HydrophobicContact CB-CE 4.1Å
38	R	80.6	Confident	72.2	Confident	144 Å²	144	71.7 Å²	71.7	54%	0.543	37%	0.367	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.7	132.4	176	-163.9	177.2	-166.5	-177.9	0.6	109.1	E43 L45	R38-E43 IonicContact NH2-OE1 3.74Å; R38-L45 HydrophobicContact CB-CD1 3.87Å; R38-L45 HydrophobicContact CG-CD1 4.07Å
39	S	71.2	Confident	72.9	Confident	2 Å²	2	74.5 Å²	74.5	1%	0.014	38%	0.375	C	S	.	.			trans	-72.5	127.7	169.7	-170.6	0	0	0	0	108.9	E14 H41 F42 S44	E14-S39 WeakPolarHBondContact OE2-CB 2.84Å; E14-S39 PolarHBondContact OE2-OG 3.09Å; S39-H41 VanDerWaalsContact C-N 3.28Å; S39-F42 WeakPolarHBondContact OG-CD2 3.34Å; S39-S44 PolarHBondContact N-O 2.95Å
40	P	68.6	Low	73.3	Confident	99 Å²	99	66.7 Å²	66.7	64%	0.643	34%	0.339	S	S	*	.	S	Bend	trans	-74	-23.9	177.8	26.2	-30	0	0	0	112.2	I11	I11-P40 HydrophobicContact CD1-CG 4.24Å
41	H	70.1	Confident	73.8	Confident	153 Å²	153	65.7 Å²	65.7	71%	0.708	33%	0.328	S	S	*	.	S	Bend	trans	-87.3	-16.4	-178.3	-68.9	-81.4	0	0	0	113.3	S39	S39-H41 VanDerWaalsContact C-N 3.28Å
42	F	64.1	Low	74	Confident	100 Å²	100	62.8 Å²	62.8	44%	0.439	31%	0.308	S	S	.	.	S	Bend	trans	-139.7	148.6	-173.6	-57.1	-96.9	0	0	0	110	E14 S39 S44	E14-F42 VanDerWaalsContact CD-CD2 3.46Å; E14-F42 HydrophobicContact CG-CB 4.34Å; E14-F42 HydrophobicContact CG-CD1 4.19Å; E14-F42 HydrophobicContact CG-CD2 4.06Å; E14-F42 HydrophobicContact CG-CE1 4.49Å; E14-F42 HydrophobicContact CG-CE2 4.36Å; E14-F42 HydrophobicContact CG-CG 3.97Å; E14-F42 WeakPolarHBondContact OE1-CB 3.2Å; E14-F42 VanDerWaalsContact OE1-CG 3.3Å; E14-F42 WeakPolarHBondContact OE1-CG 3.25Å; E14-F42 WeakPolarHBondContact OE2-CB 3.47Å; E14-F42 WeakPolarHBondContact OE2-CD2 3.1Å; E14-F42 VanDerWaalsContact OE2-CG 3.24Å; E14-F42 WeakPolarHBondContact OE2-CG 3.24Å; S39-F42 WeakPolarHBondContact OG-CD2 3.34Å; F42-S44 PolarHBondContact O-N 2.67Å
43	E	69.1	Low	73.7	Confident	166 Å²	166	64 Å²	64	78%	0.776	31%	0.305	S	S	*	.	S	Bend	trans	-66.9	-10.3	-178.2	-74.3	-96.7	118.3	0	0	113.4	R38	R38-E43 IonicContact NH2-OE1 3.74Å
44	S	71.4	Confident	73	Confident	29 Å²	29	61.8 Å²	61.8	20%	0.203	30%	0.299	C	S	.	.			trans	-74.5	149.3	-171.7	86.9	0	0	0	0	113.2	E14 S39 F42	E14-S44 WeakPolarHBondContact OE1-CB 3.37Å; E14-S44 PolarHBondContact OE1-OG 3.24Å; E14-S44 PolarHBondContact OE2-OG 3.19Å; S39-S44 PolarHBondContact N-O 2.95Å; F42-S44 PolarHBondContact O-N 2.67Å
45	L	83.7	Confident	71.6	Confident	34 Å²	34	64.9 Å²	64.9	18%	0.178	32%	0.318	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.5	127.5	-178.6	-171.2	83.5	0	0	0	108.8	Q36 R38 S69 S70	Q36-L45 HydrophobicContact CG-CD1 3.4Å; Q36-L45 HydrophobicContact CG-CD2 3.66Å; Q36-L45 HydrophobicContact CG-CG 3.61Å; R38-L45 HydrophobicContact CB-CD1 3.87Å; R38-L45 HydrophobicContact CG-CD1 4.07Å; L45-S69 CarbonylContact O-C 3.49Å; L45-S70 WeakPolarHBondContact CB-OG 3.32Å; L45-S70 PolarHBondContact N-OG 2.79Å; L45-S70 PolarHBondContact O-N 2.76Å; L45-S70 PolarHBondContact O-OG 3.19Å
46	F	86.7	Confident	70.2	Confident	5 Å²	5	69.3 Å²	69.3	2%	0.022	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.1	135.6	170.8	-81.6	-100.7	0	0	0	110.2	A10 L13 E14 I18 Q36 A37 P67 L68	A10-F46 HydrophobicContact CB-CB 4.03Å; A10-F46 HydrophobicContact CB-CD2 4.11Å; A10-F46 HydrophobicContact CB-CG 4.23Å; L13-F46 HydrophobicContact CB-CE1 3.98Å; L13-F46 HydrophobicContact CB-CZ 3.97Å; L13-F46 HydrophobicContact CD1-CD1 4.22Å; L13-F46 HydrophobicContact CD1-CE1 4.05Å; E14-F46 HydrophobicContact CB-CE2 4.13Å; I18-F46 WeakPolarHBondContact O-CE1 2.82Å; I18-F46 WeakPolarHBondContact O-CZ 3.38Å; Q36-F46 CarbonylContact C-O 3.54Å; Q36-F46 WeakPolarHBondContact CA-O 3.27Å; A37-F46 PolarHBondContact N-O 3.01Å; A37-F46 PolarHBondContact O-N 2.84Å; F46-P67 HydrophobicContact CD1-CB 4.25Å; F46-L68 CarbonylContact C-O 3.59Å; F46-L68 VanDerWaalsContact CA-O 3.23Å; F46-L68 WeakPolarHBondContact CA-O 3.28Å; F46-L68 VanDerWaalsContact CD1-C 3.48Å
47	R	85.5	Confident	68.6	Low	92 Å²	92	67.7 Å²	67.7	35%	0.347	33%	0.333	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.8	116.2	171.5	-157.1	174.4	-168.2	-174.8	-7.7	108.6	V34 I35 L68 E73	V34-R47 HydrophobicContact CG1-CG 3.3Å; I35-R47 CarbonylContact O-C 3.6Å; I35-R47 WeakPolarHBondContact O-CA 3.24Å; R47-L68 PolarHBondContact N-O 3.47Å; R47-L68 PolarHBondContact O-N 2.68Å; R47-E73 WeakPolarHBondContact CB-OE2 3.45Å; R47-E73 WeakPolarHBondContact CD-OE1 3.32Å; R47-E73 WeakPolarHBondContact CD-OE2 3.35Å; R47-E73 IonicContact CZ-OE1 3.5Å; R47-E73 IonicContact NE-OE1 3.55Å; R47-E73 IonicContact NH1-OE1 2.68Å; R47-E73 PolarHBondContact NH1-OE1 2.85Å
48	M	79	Confident	67.1	Low	0 Å²	0	73.6 Å²	73.6	0%	0	37%	0.372	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.7	128	179.7	-63.3	-178.5	-178.2	0	0	108.1	E6 L9 A10 V34 I35 A37 P67	E6-M48 HydrophobicContact CB-CE 4.15Å; E6-M48 HydrophobicContact CB-SD 3.66Å; E6-M48 HydrophobicContact CG-SD 3.67Å; E6-M48 WeakPolarHBondContact O-CE 3.44Å; L9-M48 HydrophobicContact CB-CE 4.13Å; L9-M48 HydrophobicContact CD2-CE 3.67Å; L9-M48 HydrophobicContact CD2-SD 4.19Å; L9-M48 HydrophobicContact CG-CE 3.96Å; A10-M48 HydrophobicContact CB-CE 4.22Å; V34-M48 CarbonylContact C-O 3.53Å; V34-M48 VanDerWaalsContact CA-O 3.27Å; V34-M48 WeakPolarHBondContact CA-O 3.34Å; I35-M48 HydrophobicContact CB-CB 4.49Å; I35-M48 PolarHBondContact N-O 2.95Å; I35-M48 PolarHBondContact O-N 2.93Å; A37-M48 HydrophobicContact CB-CE 4.1Å; M48-P67 HydrophobicContact CE-CB 4.38Å; M48-P67 HydrophobicContact CE-CG 4.46Å; M48-P67 HydrophobicContact CG-CB 4.03Å; M48-P67 HydrophobicContact CG-CG 4.12Å
49	R	74.6	Confident	65.9	Low	82 Å²	82	71.2 Å²	71.2	31%	0.309	38%	0.377	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	89.6	178.3	-67.9	-172.5	178.9	-178.1	3.5	108.6	V34 D65 V66	V34-R49 HydrophobicContact CG1-CG 4.15Å; V34-R49 HydrophobicContact CG2-CG 4.26Å; R49-D65 WeakPolarHBondContact CA-OD1 3.36Å; R49-D65 PolarHBondContact N-OD1 3.04Å; R49-D65 WeakPolarHBondContact O-CA 3.44Å; R49-D65 VanDerWaalsContact O-OD1 3.05Å; R49-V66 PolarHBondContact N-O 3.15Å; R49-V66 PolarHBondContact O-N 2.82Å
50	L	68.3	Low	65	Low	16 Å²	16	72 Å²	72	8%	0.084	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.3	131.3	-179.6	-62.8	161.4	0	0	0	108.7	I26 T28 S32 E33 I35 D65	I26-L50 HydrophobicContact CD1-CD2 3.56Å; T28-L50 HydrophobicContact CG2-CD1 4.48Å; T28-L50 HydrophobicContact CG2-CD2 3.61Å; T28-L50 HydrophobicContact CG2-CG 4.44Å; S32-L50 CarbonylContact C-O 3.59Å; S32-L50 WeakPolarHBondContact CA-O 3.15Å; S32-L50 WeakPolarHBondContact CB-O 3.49Å; S32-L50 PolarHBondContact OG-O 2.9Å; E33-L50 PolarHBondContact N-O 2.88Å; E33-L50 PolarHBondContact O-N 2.87Å; I35-L50 HydrophobicContact CD1-CD1 3.4Å; I35-L50 HydrophobicContact CG1-CD1 3.96Å; L50-D65 HydrophobicContact CD2-CB 3.58Å; L50-D65 VanDerWaalsContact CD2-CG 3.45Å; L50-D65 HydrophobicContact CG-CB 4.44Å; L50-D65 PolarHBondContact N-OD1 2.81Å
51	S	65.5	Low	64.3	Low	9 Å²	9	71.9 Å²	71.9	6%	0.063	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.3	87	168.8	65.7	0	0	0	0	108.4	G63 V64 P81	S51-G63 WeakPolarHBondContact O-CA 3.29Å; S51-V64 WeakPolarHBondContact CB-O 3.33Å; S51-V64 PolarHBondContact N-O 3.13Å; S51-V64 PolarHBondContact O-N 3.48Å; S51-V64 WeakPolarHBondContact OG-CA 3.33Å; S51-V64 WeakPolarHBondContact OG-CB 3.4Å; S51-V64 PolarHBondContact OG-N 2.93Å; S51-V64 VanDerWaalsContact OG-N 3.15Å; S51-V64 PolarHBondContact OG-O 2.77Å; S51-P81 VanDerWaalsContact CB-CB 3.41Å; S51-P81 VanDerWaalsContact CB-CG 3.47Å; S51-P81 VanDerWaalsContact OG-CB 3.28Å; S51-P81 WeakPolarHBondContact OG-CB 3.4Å
52	G	61.1	Low	63.9	Low	6 Å²	6	65.8 Å²	65.8	6%	0.062	35%	0.351	C	S	.	.			trans	-102.1	129.2	172.6	0	0	0	0	0	110	T28	T28-G52 WeakPolarHBondContact OG1-CA 3.21Å
53	H	56.4	Low	64.2	Low	106 Å²	106	61 Å²	61	49%	0.491	33%	0.33	S	S	.	.			trans	-101.4	63.6	164.3	-83.2	47.3	0	0	0	109.6	V55 L56 F57 L84	H53-V55 PolarHBondContact O-N 2.91Å; H53-L56 HydrophobicContact CB-CB 4.41Å; H53-L56 PolarHBondContact O-N 3.22Å; H53-F57 HydrophobicContact CB-CD2 4.5Å; H53-F57 PolarHBondContact O-N 3.47Å; H53-L84 HydrophobicContact CB-CD2 4.26Å
54	S	52	Low	64.5	Low	47 Å²	47	53.2 Å²	53.2	33%	0.329	29%	0.293	S	S	.	.	T	Hydrogen-bonded Turn	trans	-54.6	-36.6	175.4	179.8	0	0	0	0	111.8	Q29 L56 F57	Q29-S54 VanDerWaalsContact O-CB 3.25Å; Q29-S54 WeakPolarHBondContact O-CB 3.23Å; Q29-S54 PolarHBondContact O-OG 3.32Å; S54-L56 PolarHBondContact O-N 3.49Å; S54-F57 CarbonylContact O-C 3.5Å; S54-F57 PolarHBondContact O-N 3.42Å
55	V	49	Very low	65	Low	139 Å²	139	52 Å²	52	84%	0.842	29%	0.285	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.8	-37.5	-178	-175.1	0	0	0	0	113	H53	H53-V55 PolarHBondContact O-N 2.91Å
56	L	50.3	Low	65.1	Low	113 Å²	113	51 Å²	51	59%	0.592	28%	0.28	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.4	-25.2	-179.5	-64.9	-175.6	0	0	0	112.5	H53 S54	H53-L56 HydrophobicContact CB-CB 4.41Å; H53-L56 PolarHBondContact O-N 3.22Å; S54-L56 PolarHBondContact O-N 3.49Å
57	F	52	Low	65.2	Low	79 Å²	79	50.8 Å²	50.8	35%	0.346	28%	0.279	S	S	.	.			trans	-137.8	83	-171.2	-58.2	-74.3	0	0	0	111.8	H53 S54 S59 G60 F61 L84	H53-F57 HydrophobicContact CB-CD2 4.5Å; H53-F57 PolarHBondContact O-N 3.47Å; S54-F57 CarbonylContact O-C 3.5Å; S54-F57 PolarHBondContact O-N 3.42Å; F57-S59 PolarHBondContact O-N 3.28Å; F57-S59 VanDerWaalsContact O-N 3.12Å; F57-G60 PolarHBondContact O-N 3.44Å; F57-F61 HydrophobicContact CB-CB 3.84Å; F57-F61 HydrophobicContact CB-CD2 4.37Å; F57-F61 HydrophobicContact CD1-CD2 4.17Å; F57-F61 HydrophobicContact CD2-CB 4.19Å; F57-F61 HydrophobicContact CG-CB 3.99Å; F57-F61 HydrophobicContact CG-CD2 4.29Å; F57-F61 HydrophobicContact CG-CG 4.36Å; F57-L84 HydrophobicContact CD2-CD1 4.14Å; F57-L84 HydrophobicContact CE2-CD1 3.87Å
58	P	50.3	Low	65.3	Low	125 Å²	125	46.5 Å²	46.5	81%	0.812	26%	0.263	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.6	-18.5	-179.1	22.6	-31.8	0	0	0	113.7	G60	P58-G60 PolarHBondContact O-N 3.07Å
59	S	54.7	Low	65.9	Low	93 Å²	93	47.4 Å²	47.4	65%	0.65	27%	0.269	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.8	-1.8	173.1	64.1	0	0	0	0	113.9	F57	F57-S59 PolarHBondContact O-N 3.28Å; F57-S59 VanDerWaalsContact O-N 3.12Å
60	G	53.5	Low	66.6	Low	18 Å²	18	45.9 Å²	45.9	19%	0.186	27%	0.271	C	S	.	.	T	Hydrogen-bonded Turn	trans	72.3	83.1	-177.4	0	0	0	0	0	111.4	F57 P58	F57-G60 PolarHBondContact O-N 3.44Å; P58-G60 PolarHBondContact O-N 3.07Å
61	F	52.8	Low	67.5	Low	98 Å²	98	54 Å²	54	43%	0.43	30%	0.301	S	S	.	.			trans	-79.1	157.7	170.1	-120.9	-96.7	0	0	0	111.9	F57 G63 L84	F57-F61 HydrophobicContact CB-CB 3.84Å; F57-F61 HydrophobicContact CB-CD2 4.37Å; F57-F61 HydrophobicContact CD1-CD2 4.17Å; F57-F61 HydrophobicContact CD2-CB 4.19Å; F57-F61 HydrophobicContact CG-CB 3.99Å; F57-F61 HydrophobicContact CG-CD2 4.29Å; F57-F61 HydrophobicContact CG-CG 4.36Å; F61-G63 PolarHBondContact O-N 3.01Å; F61-G63 VanDerWaalsContact O-N 3.17Å; F61-L84 HydrophobicContact CB-CD1 4.43Å
62	A	61.1	Low	68.6	Low	25 Å²	25	53.9 Å²	53.9	21%	0.207	30%	0.3	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-50.8	112.9	172.7	0	0	0	0	0	110.8	I26 L84	I26-A62 CarbonylContact O-C 3.53Å; I26-A62 WeakPolarHBondContact O-CA 3.48Å; A62-L84 WeakPolarHBondContact O-CB 3.16Å
63	G	70.8	Confident	69.9	Low	0 Å²	0	55.7 Å²	55.7	0%	0	31%	0.307	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.7	176.2	165.3	0	0	0	0	0	111.2	G25 I26 S51 F61	G25-G63 PolarHBondContact N-O 3.45Å; G25-G63 VanDerWaalsContact N-O 3.09Å; I26-G63 WeakPolarHBondContact CG1-O 3.32Å; I26-G63 PolarHBondContact N-O 2.74Å; I26-G63 PolarHBondContact O-N 2.94Å; S51-G63 WeakPolarHBondContact O-CA 3.29Å; F61-G63 PolarHBondContact O-N 3.01Å; F61-G63 VanDerWaalsContact O-N 3.17Å
64	V	75.6	Confident	71.4	Confident	1 Å²	1	54.9 Å²	54.9	1%	0.006	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.3	138	169.3	-178.6	0	0	0	0	109	L23 L24 S51 L84 C87	L23-V64 CarbonylContact O-C 3.56Å; L23-V64 VanDerWaalsContact O-CA 3.28Å; L23-V64 WeakPolarHBondContact O-CA 3.34Å; L24-V64 HydrophobicContact CD2-CB 3.98Å; L24-V64 HydrophobicContact CD2-CG1 3.45Å; L24-V64 VanDerWaalsContact CD2-CG1 3.45Å; L24-V64 HydrophobicContact CD2-CG2 3.43Å; L24-V64 VanDerWaalsContact CD2-CG2 3.43Å; S51-V64 WeakPolarHBondContact CB-O 3.33Å; S51-V64 PolarHBondContact N-O 3.13Å; S51-V64 PolarHBondContact O-N 3.48Å; S51-V64 WeakPolarHBondContact OG-CA 3.33Å; S51-V64 WeakPolarHBondContact OG-CB 3.4Å; S51-V64 PolarHBondContact OG-N 2.93Å; S51-V64 VanDerWaalsContact OG-N 3.15Å; S51-V64 PolarHBondContact OG-O 2.77Å; V64-L84 WeakPolarHBondContact CG2-O 3.13Å; V64-C87 HydrophobicContact CB-CB 4.5Å; V64-C87 HydrophobicContact CG1-CB 3.48Å; V64-C87 VanDerWaalsContact CG1-CB 3.48Å; V64-C87 VanDerWaalsContact CG1-SG 3.51Å
65	D	81.4	Confident	73.2	Confident	4 Å²	4	55 Å²	55	2%	0.021	31%	0.314	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.3	148.3	169	-177.8	30.6	0	0	0	110.7	L23 I26 R49 L50	L23-D65 HydrophobicContact CB-CB 4.26Å; L23-D65 PolarHBondContact N-O 3.14Å; L23-D65 PolarHBondContact O-N 3.25Å; I26-D65 HydrophobicContact CD1-CB 3.3Å; R49-D65 WeakPolarHBondContact CA-OD1 3.36Å; R49-D65 PolarHBondContact N-OD1 3.04Å; R49-D65 WeakPolarHBondContact O-CA 3.44Å; R49-D65 VanDerWaalsContact O-OD1 3.05Å; L50-D65 HydrophobicContact CD2-CB 3.58Å; L50-D65 VanDerWaalsContact CD2-CG 3.45Å; L50-D65 HydrophobicContact CG-CB 4.44Å; L50-D65 PolarHBondContact N-OD1 2.81Å
66	V	86.2	Confident	75.1	Confident	14 Å²	14	49.8 Å²	49.8	9%	0.085	28%	0.281	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.2	93.7	174.8	-175.7	0	0	0	0	108.8	V20 C21 R49 L68 C87 V89	V20-V66 HydrophobicContact CG1-CG1 4.32Å; C21-V66 WeakPolarHBondContact O-CA 2.96Å; C21-V66 WeakPolarHBondContact O-CG1 3.5Å; R49-V66 PolarHBondContact N-O 3.15Å; R49-V66 PolarHBondContact O-N 2.82Å; V66-L68 HydrophobicContact CG1-CD2 3.76Å; V66-L68 HydrophobicContact CG1-CG 3.96Å; V66-L68 PolarHBondContact O-N 2.77Å; V66-C87 HydrophobicContact CG2-CB 4.44Å; V66-V89 HydrophobicContact CB-CG2 4.27Å; V66-V89 HydrophobicContact CG1-CG1 4.49Å; V66-V89 HydrophobicContact CG1-CG2 3.51Å; V66-V89 HydrophobicContact CG2-CG2 3.83Å
67	P	88.3	Confident	76.9	Confident	0 Å²	0	46.7 Å²	46.7	0%	0	27%	0.273	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.6	123.8	165.6	-20.6	31.5	0	0	0	110.9	L9 L13 C21 L23 F46 M48	L9-P67 HydrophobicContact CD2-CG 3.93Å; L13-P67 HydrophobicContact CD1-CB 3.57Å; L13-P67 HydrophobicContact CD1-CG 4.07Å; C21-P67 HydrophobicContact CB-CB 4.49Å; C21-P67 HydrophobicContact CB-CG 4.38Å; C21-P67 PolarHBondContact N-O 3.32Å; C21-P67 WeakPolarHBondContact O-CD 3.41Å; L23-P67 HydrophobicContact CD1-CG 3.76Å; L23-P67 HydrophobicContact CG-CG 4.29Å; F46-P67 HydrophobicContact CD1-CB 4.25Å; M48-P67 HydrophobicContact CE-CB 4.38Å; M48-P67 HydrophobicContact CE-CG 4.46Å; M48-P67 HydrophobicContact CG-CB 4.03Å; M48-P67 HydrophobicContact CG-CG 4.12Å
68	L	89.6	Confident	78.5	Confident	1 Å²	1	46 Å²	46	1%	0.005	27%	0.272	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.2	131.3	175.5	-62	173.9	0	0	0	109.6	G19 V20 F46 R47 V66 A72 E73 L76 V89	G19-L68 WeakPolarHBondContact O-CA 3.33Å; V20-L68 HydrophobicContact CB-CD2 4.11Å; V20-L68 HydrophobicContact CG1-CD2 3.78Å; V20-L68 HydrophobicContact CG2-CD2 3.73Å; F46-L68 CarbonylContact C-O 3.59Å; F46-L68 VanDerWaalsContact CA-O 3.23Å; F46-L68 WeakPolarHBondContact CA-O 3.28Å; F46-L68 VanDerWaalsContact CD1-C 3.48Å; R47-L68 PolarHBondContact N-O 3.47Å; R47-L68 PolarHBondContact O-N 2.68Å; V66-L68 HydrophobicContact CG1-CD2 3.76Å; V66-L68 HydrophobicContact CG1-CG 3.96Å; V66-L68 PolarHBondContact O-N 2.77Å; L68-A72 HydrophobicContact CB-CB 4.47Å; L68-A72 HydrophobicContact CD2-CB 4.31Å; L68-E73 HydrophobicContact CB-CB 4.3Å; L68-L76 HydrophobicContact CD1-CD1 4.14Å; L68-L76 HydrophobicContact CD1-CD2 3.63Å; L68-L76 HydrophobicContact CD1-CG 4.35Å; L68-V89 HydrophobicContact CD2-CG1 4.25Å
69	S	90.1	Very high	79.8	Confident	19 Å²	19	41.1 Å²	41.1	13%	0.133	25%	0.245	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-66	159	166.9	73.3	0	0	0	0	110	G19 L45 R71 A72 E73	G19-S69 PolarHBondContact O-N 2.91Å; L45-S69 CarbonylContact O-C 3.49Å; S69-R71 PolarHBondContact O-N 3.06Å; S69-R71 VanDerWaalsContact O-N 3.08Å; S69-A72 PolarHBondContact O-N 3.46Å; S69-A72 PolarHBondContact OG-N 3.38Å; S69-E73 WeakPolarHBondContact O-CB 3.38Å; S69-E73 PolarHBondContact O-N 3.4Å
70	S	88.9	Confident	80.5	Confident	51 Å²	51	41.8 Å²	41.8	36%	0.357	24%	0.24	S	C	.	.	H	α-helix	trans	-56.9	-32.3	-179.3	-23.9	0	0	0	0	112.5	L45 A74	L45-S70 WeakPolarHBondContact CB-OG 3.32Å; L45-S70 PolarHBondContact N-OG 2.79Å; L45-S70 PolarHBondContact O-N 2.76Å; L45-S70 PolarHBondContact O-OG 3.19Å; S70-A74 WeakPolarHBondContact O-CB 3.44Å; S70-A74 PolarHBondContact O-N 2.88Å; S70-A74 VanDerWaalsContact O-N 3.07Å
71	R	87.6	Confident	81.3	Confident	186 Å²	186	43.7 Å²	43.7	70%	0.702	25%	0.249	S	C	*	.	H	α-helix	trans	-69.1	-50.1	174.9	179.5	179.6	173.7	-178.1	-0	111.7	S69 E73 A74 E75	S69-R71 PolarHBondContact O-N 3.06Å; S69-R71 VanDerWaalsContact O-N 3.08Å; R71-E73 PolarHBondContact O-N 2.79Å; R71-A74 PolarHBondContact O-N 2.81Å; R71-E75 IonicContact NE-OE1 3.05Å; R71-E75 PolarHBondContact NE-OE1 3.19Å; R71-E75 IonicContact NH2-OE1 3.82Å; R71-E75 PolarHBondContact O-N 2.77Å
72	A	88.7	Confident	82.5	Confident	6 Å²	6	43.9 Å²	43.9	5%	0.05	25%	0.254	C	S	.	.	H	α-helix	trans	-63.8	-34.6	178.6	0	0	0	0	0	111.2	G19 V20 L68 S69 E75 L76 L91	G19-A72 WeakPolarHBondContact O-CB 3.43Å; V20-A72 HydrophobicContact CG2-CB 3.72Å; L68-A72 HydrophobicContact CB-CB 4.47Å; L68-A72 HydrophobicContact CD2-CB 4.31Å; S69-A72 PolarHBondContact O-N 3.46Å; S69-A72 PolarHBondContact OG-N 3.38Å; A72-E75 CarbonylContact O-C 3.39Å; A72-E75 PolarHBondContact O-N 2.77Å; A72-L76 PolarHBondContact O-N 2.92Å; A72-L91 HydrophobicContact CB-CD1 4.29Å; A72-L91 WeakPolarHBondContact O-CD2 3.47Å
73	E	87.8	Confident	83.1	Confident	44 Å²	44	45 Å²	45	21%	0.206	26%	0.256	C	S	.	.	H	α-helix	trans	-63.9	-41.5	174.3	-169	-173.5	178.8	0	0	112.1	R47 L68 S69 R71 E75 L76	R47-E73 WeakPolarHBondContact CB-OE2 3.45Å; R47-E73 WeakPolarHBondContact CD-OE1 3.32Å; R47-E73 WeakPolarHBondContact CD-OE2 3.35Å; R47-E73 IonicContact CZ-OE1 3.5Å; R47-E73 IonicContact NE-OE1 3.55Å; R47-E73 IonicContact NH1-OE1 2.68Å; R47-E73 PolarHBondContact NH1-OE1 2.85Å; L68-E73 HydrophobicContact CB-CB 4.3Å; S69-E73 WeakPolarHBondContact O-CB 3.38Å; S69-E73 PolarHBondContact O-N 3.4Å; R71-E73 PolarHBondContact O-N 2.79Å; E73-E75 PolarHBondContact O-N 2.83Å; E73-L76 VanDerWaalsContact O-CB 3.25Å; E73-L76 WeakPolarHBondContact O-CB 3.28Å; E73-L76 PolarHBondContact O-N 3.42Å; E73-L76 VanDerWaalsContact O-N 3.1Å
74	A	88.4	Confident	83.1	Confident	90 Å²	90	46.9 Å²	46.9	74%	0.744	27%	0.266	S	S	*	.	H	α-helix	trans	-65.6	-26	175.7	0	0	0	0	0	113	S70 R71	S70-A74 WeakPolarHBondContact O-CB 3.44Å; S70-A74 PolarHBondContact O-N 2.88Å; S70-A74 VanDerWaalsContact O-N 3.07Å; R71-A74 PolarHBondContact O-N 2.81Å
75	E	90.2	Very high	83.2	Confident	48 Å²	48	48.3 Å²	48.3	22%	0.224	27%	0.271	C	S	.	.	T	Hydrogen-bonded Turn	trans	-90.7	-1.9	175.6	-65.6	173.7	-172.2	0	0	112.1	R71 A72 E73 A77 L91 E92	R71-E75 IonicContact NE-OE1 3.05Å; R71-E75 PolarHBondContact NE-OE1 3.19Å; R71-E75 IonicContact NH2-OE1 3.82Å; R71-E75 PolarHBondContact O-N 2.77Å; A72-E75 CarbonylContact O-C 3.39Å; A72-E75 PolarHBondContact O-N 2.77Å; E73-E75 PolarHBondContact O-N 2.83Å; E75-A77 PolarHBondContact O-N 2.9Å; E75-L91 HydrophobicContact CB-CB 4.38Å; E75-L91 CarbonylContact O-C 3.51Å; E75-L91 WeakPolarHBondContact O-CA 3.21Å; E75-E92 PolarHBondContact O-N 3.01Å
76	L	89.1	Confident	83.2	Confident	30 Å²	30	49.5 Å²	49.5	16%	0.157	28%	0.278	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.8	114.2	-175.2	-175.1	73.5	0	0	0	111.5	L68 A72 E73 D78 V89 L91	L68-L76 HydrophobicContact CD1-CD1 4.14Å; L68-L76 HydrophobicContact CD1-CD2 3.63Å; L68-L76 HydrophobicContact CD1-CG 4.35Å; A72-L76 PolarHBondContact O-N 2.92Å; E73-L76 VanDerWaalsContact O-CB 3.25Å; E73-L76 WeakPolarHBondContact O-CB 3.28Å; E73-L76 PolarHBondContact O-N 3.42Å; E73-L76 VanDerWaalsContact O-N 3.1Å; L76-D78 VanDerWaalsContact CD1-O 3.27Å; L76-D78 WeakPolarHBondContact CD1-O 3.32Å; L76-V89 HydrophobicContact CD1-CG1 3.5Å; L76-V89 VanDerWaalsContact CD1-CG1 3.5Å; L76-L91 HydrophobicContact CB-CD2 3.97Å; L76-L91 HydrophobicContact CD1-CD2 3.63Å; L76-L91 HydrophobicContact CG-CD2 4.4Å
77	A	88.7	Confident	83.1	Confident	49 Å²	49	48.9 Å²	48.9	41%	0.405	27%	0.274	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83	-48.4	172	0	0	0	0	0	110.8	E75 R90 E92	E75-A77 PolarHBondContact O-N 2.9Å; A77-R90 HydrophobicContact CB-CG 4.46Å; A77-R90 PolarHBondContact N-O 2.66Å; A77-E92 HydrophobicContact CB-CB 4.24Å; A77-E92 HydrophobicContact CB-CG 3.7Å
78	D	85.4	Confident	83	Confident	63 Å²	63	49.8 Å²	49.8	34%	0.337	28%	0.281	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.9	146.4	-178.5	50.8	-66.6	0	0	0	111	L76 R90	L76-D78 VanDerWaalsContact CD1-O 3.27Å; L76-D78 WeakPolarHBondContact CD1-O 3.32Å; D78-R90 VanDerWaalsContact CG-CB 3.49Å; D78-R90 PolarHBondContact N-O 3.41Å; D78-R90 PolarHBondContact O-N 3.38Å; D78-R90 WeakPolarHBondContact OD1-CB 3.42Å; D78-R90 WeakPolarHBondContact OD1-CD 3.15Å; D78-R90 VanDerWaalsContact OD1-CG 3.29Å; D78-R90 WeakPolarHBondContact OD1-CG 3.47Å; D78-R90 IonicContact OD1-CZ 3.93Å; D78-R90 IonicContact OD1-NE 3.99Å; D78-R90 IonicContact OD1-NH1 2.87Å; D78-R90 PolarHBondContact OD1-NH1 2.75Å; D78-R90 WeakPolarHBondContact OD2-CB 3.27Å
79	G	76.7	Confident	83	Confident	23 Å²	23	49.9 Å²	49.9	24%	0.237	28%	0.282	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-159.9	100.8	-178	0	0	0	0	0	109.6	A88	G79-A88 WeakPolarHBondContact CA-O 3.46Å
80	I	69	Low	83.1	Confident	108 Å²	108	52.8 Å²	52.8	55%	0.554	29%	0.29	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-125.1	125.9	-170.5	-54.2	177.2	0	0	0	108.9	I82 A88	I80-I82 PolarHBondContact O-N 2.89Å; I80-I82 VanDerWaalsContact O-N 3.15Å; I80-A88 PolarHBondContact N-O 2.89Å; I80-A88 PolarHBondContact O-N 3.1Å
81	P	72	Confident	83.2	Confident	58 Å²	58	51.2 Å²	51.2	38%	0.377	28%	0.278	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.9	108	159.8	30.9	-34.1	0	0	0	107.5	S51 N83	S51-P81 VanDerWaalsContact CB-CB 3.41Å; S51-P81 VanDerWaalsContact CB-CG 3.47Å; S51-P81 VanDerWaalsContact OG-CB 3.28Å; S51-P81 WeakPolarHBondContact OG-CB 3.4Å; P81-N83 VanDerWaalsContact C-N 3.33Å
82	I	76.4	Confident	83.4	Confident	102 Å²	102	46.7 Å²	46.7	52%	0.523	26%	0.264	S	S	.	.			trans	-68	-42.5	180	-59.9	-178.7	0	0	0	108.9	I80 L86 A88	I80-I82 PolarHBondContact O-N 2.89Å; I80-I82 VanDerWaalsContact O-N 3.15Å; I82-L86 HydrophobicContact CB-CB 4.21Å; I82-L86 HydrophobicContact CB-CD2 3.94Å; I82-L86 HydrophobicContact CB-CG 3.99Å; I82-L86 WeakPolarHBondContact CB-O 3.45Å; I82-L86 HydrophobicContact CD1-CD2 3.73Å; I82-L86 HydrophobicContact CD1-CG 3.91Å; I82-L86 HydrophobicContact CG1-CD2 4.37Å; I82-L86 HydrophobicContact CG1-CG 4.33Å; I82-L86 HydrophobicContact CG2-CD2 3.87Å; I82-L86 HydrophobicContact CG2-CG 4.46Å; I82-L86 PolarHBondContact N-O 2.87Å; I82-A88 HydrophobicContact CD1-CB 4.12Å
83	N	73.6	Confident	83.4	Confident	48 Å²	48	46.9 Å²	46.9	26%	0.257	27%	0.265	S	S	.	.	S	Bend	trans	-155.1	-171.4	170.4	61.5	39.2	0	0	0	109.7	P81 R85 L86 D126	P81-N83 VanDerWaalsContact C-N 3.33Å; N83-R85 PolarHBondContact O-N 3.42Å; N83-R85 WeakPolarHBondContact OD1-CA 3.25Å; N83-R85 WeakPolarHBondContact OD1-CB 3.49Å; N83-R85 PolarHBondContact OD1-N 3.09Å; N83-L86 PolarHBondContact N-O 3.49Å; N83-L86 VanDerWaalsContact N-O 3.13Å; N83-L86 PolarHBondContact O-N 3.23Å; N83-L86 WeakPolarHBondContact OD1-CB 3.35Å; N83-L86 PolarHBondContact OD1-N 2.84Å; N83-D126 PolarHBondContact ND2-O 3.28Å
84	L	72.5	Confident	83.3	Confident	40 Å²	40	49.1 Å²	49.1	21%	0.209	29%	0.286	C	S	.	.	S	Bend	trans	-63.2	-9.4	178.8	-67.5	-179.1	0	0	0	114.7	H53 F57 F61 A62 V64	H53-L84 HydrophobicContact CB-CD2 4.26Å; F57-L84 HydrophobicContact CD2-CD1 4.14Å; F57-L84 HydrophobicContact CE2-CD1 3.87Å; F61-L84 HydrophobicContact CB-CD1 4.43Å; A62-L84 WeakPolarHBondContact O-CB 3.16Å; V64-L84 WeakPolarHBondContact CG2-O 3.13Å
85	R	76.8	Confident	83.1	Confident	30 Å²	30	46.2 Å²	46.2	11%	0.113	26%	0.259	C	S	.	.	S	Bend	trans	-125.1	-14.7	-174.2	-65.2	172.2	-177.9	-91.5	-6.1	113.3	N83 A112 Y113 P115 T123 L127	N83-R85 PolarHBondContact O-N 3.42Å; N83-R85 WeakPolarHBondContact OD1-CA 3.25Å; N83-R85 WeakPolarHBondContact OD1-CB 3.49Å; N83-R85 PolarHBondContact OD1-N 3.09Å; R85-A112 CarbonylContact O-C 3.5Å; R85-A112 VanDerWaalsContact O-CA 3.24Å; R85-A112 WeakPolarHBondContact O-CA 3.42Å; R85-Y113 PolarHBondContact O-N 2.75Å; R85-P115 VanDerWaalsContact NH1-CA 3.35Å; R85-P115 VanDerWaalsContact NH1-CG 3.27Å; R85-T123 VanDerWaalsContact CZ-CG2 3.49Å; R85-L127 HydrophobicContact CB-CD1 4.29Å
86	L	81.5	Confident	82.8	Confident	30 Å²	30	51.2 Å²	51.2	16%	0.157	28%	0.28	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.8	126.1	-170.6	-178.7	67	0	0	0	109.4	I82 N83 I110 S111 A112	I82-L86 HydrophobicContact CB-CB 4.21Å; I82-L86 HydrophobicContact CB-CD2 3.94Å; I82-L86 HydrophobicContact CB-CG 3.99Å; I82-L86 WeakPolarHBondContact CB-O 3.45Å; I82-L86 HydrophobicContact CD1-CD2 3.73Å; I82-L86 HydrophobicContact CD1-CG 3.91Å; I82-L86 HydrophobicContact CG1-CD2 4.37Å; I82-L86 HydrophobicContact CG1-CG 4.33Å; I82-L86 HydrophobicContact CG2-CD2 3.87Å; I82-L86 HydrophobicContact CG2-CG 4.46Å; I82-L86 PolarHBondContact N-O 2.87Å; N83-L86 PolarHBondContact N-O 3.49Å; N83-L86 VanDerWaalsContact N-O 3.13Å; N83-L86 PolarHBondContact O-N 3.23Å; N83-L86 WeakPolarHBondContact OD1-CB 3.35Å; N83-L86 PolarHBondContact OD1-N 2.84Å; L86-I110 HydrophobicContact CD1-CG2 3.72Å; L86-S111 WeakPolarHBondContact CA-O 3.38Å; L86-A112 HydrophobicContact CD1-CB 3.56Å
87	C	83.7	Confident	82.5	Confident	1 Å²	1	54.1 Å²	54.1	1%	0.007	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129	153.9	167.1	65.2	0	0	0	0	111.8	V64 V66 I110 S111	V64-C87 HydrophobicContact CB-CB 4.5Å; V64-C87 HydrophobicContact CG1-CB 3.48Å; V64-C87 VanDerWaalsContact CG1-CB 3.48Å; V64-C87 VanDerWaalsContact CG1-SG 3.51Å; V66-C87 HydrophobicContact CG2-CB 4.44Å; C87-I110 WeakPolarHBondContact O-CA 3.43Å; C87-S111 PolarHBondContact N-O 2.77Å; C87-S111 PolarHBondContact O-N 3.49Å
88	A	87.1	Confident	82.4	Confident	19 Å²	19	60.8 Å²	60.8	16%	0.157	31%	0.313	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.4	139.7	170.7	0	0	0	0	0	109.7	G79 I80 I82 L108 A109 I110	G79-A88 WeakPolarHBondContact CA-O 3.46Å; I80-A88 PolarHBondContact N-O 2.89Å; I80-A88 PolarHBondContact O-N 3.1Å; I82-A88 HydrophobicContact CD1-CB 4.12Å; A88-L108 HydrophobicContact CB-CD1 4.38Å; A88-A109 CarbonylContact C-O 3.5Å; A88-A109 WeakPolarHBondContact CA-O 3.38Å; A88-I110 HydrophobicContact CB-CG1 4.23Å
89	V	89.3	Confident	82.2	Confident	3 Å²	3	68.7 Å²	68.7	2%	0.018	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.7	122.3	179.7	-176.6	0	0	0	0	107.8	V20 V66 L68 L76 L91 L108 A109	V20-V89 HydrophobicContact CG1-CG1 4.32Å; V66-V89 HydrophobicContact CB-CG2 4.27Å; V66-V89 HydrophobicContact CG1-CG1 4.49Å; V66-V89 HydrophobicContact CG1-CG2 3.51Å; V66-V89 HydrophobicContact CG2-CG2 3.83Å; L68-V89 HydrophobicContact CD2-CG1 4.25Å; L76-V89 HydrophobicContact CD1-CG1 3.5Å; L76-V89 VanDerWaalsContact CD1-CG1 3.5Å; V89-L91 HydrophobicContact CG1-CD2 4.17Å; V89-L108 CarbonylContact O-C 3.51Å; V89-L108 WeakPolarHBondContact O-CA 3.21Å; V89-A109 PolarHBondContact N-O 3.47Å; V89-A109 PolarHBondContact O-N 3.15Å
90	R	91.5	Very high	82.5	Confident	80 Å²	80	75.4 Å²	75.4	30%	0.302	37%	0.369	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.2	120.4	-179.6	179.2	163.6	173.9	-89.6	-5.7	109.7	A77 D78 E92 F107 L108	A77-R90 HydrophobicContact CB-CG 4.46Å; A77-R90 PolarHBondContact N-O 2.66Å; D78-R90 VanDerWaalsContact CG-CB 3.49Å; D78-R90 PolarHBondContact N-O 3.41Å; D78-R90 PolarHBondContact O-N 3.38Å; D78-R90 WeakPolarHBondContact OD1-CB 3.42Å; D78-R90 WeakPolarHBondContact OD1-CD 3.15Å; D78-R90 VanDerWaalsContact OD1-CG 3.29Å; D78-R90 WeakPolarHBondContact OD1-CG 3.47Å; D78-R90 IonicContact OD1-CZ 3.93Å; D78-R90 IonicContact OD1-NE 3.99Å; D78-R90 IonicContact OD1-NH1 2.87Å; D78-R90 PolarHBondContact OD1-NH1 2.75Å; D78-R90 WeakPolarHBondContact OD2-CB 3.27Å; R90-E92 IonicContact CZ-OE1 3Å; R90-E92 IonicContact NH1-OE1 3.3Å; R90-E92 PolarHBondContact NH1-OE1 3.33Å; R90-E92 IonicContact NH2-OE1 2.63Å; R90-E92 PolarHBondContact NH2-OE1 3.29Å; R90-F107 CarbonylContact C-O 3.52Å; R90-F107 VanDerWaalsContact CA-O 3.27Å; R90-F107 WeakPolarHBondContact CA-O 3.43Å; R90-L108 HydrophobicContact CB-CD1 3.98Å
91	L	90.8	Very high	83.3	Confident	18 Å²	18	75 Å²	75	9%	0.094	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.1	134.3	176.8	-55.1	-175.3	0	0	0	110	V20 A72 E75 L76 V89 C106 F107	V20-L91 HydrophobicContact CG2-CD1 3.61Å; A72-L91 HydrophobicContact CB-CD1 4.29Å; A72-L91 WeakPolarHBondContact O-CD2 3.47Å; E75-L91 HydrophobicContact CB-CB 4.38Å; E75-L91 CarbonylContact O-C 3.51Å; E75-L91 WeakPolarHBondContact O-CA 3.21Å; L76-L91 HydrophobicContact CB-CD2 3.97Å; L76-L91 HydrophobicContact CD1-CD2 3.63Å; L76-L91 HydrophobicContact CG-CD2 4.4Å; V89-L91 HydrophobicContact CG1-CD2 4.17Å; L91-C106 CarbonylContact O-C 3.56Å; L91-C106 VanDerWaalsContact O-CA 3.31Å; L91-C106 WeakPolarHBondContact O-CA 3.3Å; L91-F107 HydrophobicContact CB-CB 4.33Å; L91-F107 PolarHBondContact N-O 2.97Å; L91-F107 PolarHBondContact O-N 3.04Å
92	E	92	Very high	83.8	Confident	90 Å²	90	75.9 Å²	75.9	42%	0.421	37%	0.374	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.5	117.2	171.9	-70.5	179.5	-175.9	0	0	108.4	E75 A77 R90	E75-E92 PolarHBondContact O-N 3.01Å; A77-E92 HydrophobicContact CB-CB 4.24Å; A77-E92 HydrophobicContact CB-CG 3.7Å; R90-E92 IonicContact CZ-OE1 3Å; R90-E92 IonicContact NH1-OE1 3.3Å; R90-E92 PolarHBondContact NH1-OE1 3.33Å; R90-E92 IonicContact NH2-OE1 2.63Å; R90-E92 PolarHBondContact NH2-OE1 3.29Å
93	S	88.2	Confident	84.2	Confident	11 Å²	11	72.1 Å²	72.1	8%	0.077	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	133.1	180	65.2	0	0	0	0	110.5	R105	S93-R105 PolarHBondContact N-O 2.86Å; S93-R105 PolarHBondContact O-N 3.45Å; S93-R105 PolarHBondContact OG-O 3.36Å
94	S	85.7	Confident	84.9	Confident	91 Å²	91	78 Å²	78	64%	0.636	39%	0.386	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81.7	129.5	169	-88.8	0	0	0	0	109.9
95	V	84.3	Confident	85.6	Confident	28 Å²	28	82.2 Å²	82.2	17%	0.17	40%	0.399	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128	125.3	-176.4	175.1	0	0	0	0	109.8	V97 C102 G103 R105	V95-V97 PolarHBondContact O-N 2.94Å; V95-V97 VanDerWaalsContact O-N 3.09Å; V95-C102 WeakPolarHBondContact O-CA 3.43Å; V95-C102 PolarHBondContact O-SG 2.73Å; V95-G103 PolarHBondContact N-O 3.44Å; V95-G103 PolarHBondContact O-N 3.17Å; V95-R105 HydrophobicContact CB-CG 4.29Å; V95-R105 VanDerWaalsContact CG1-CZ 3.46Å; V95-R105 HydrophobicContact CG2-CB 4.49Å; V95-R105 HydrophobicContact CG2-CG 3.88Å; V95-R105 VanDerWaalsContact CG2-CZ 3.48Å
96	K	84.8	Confident	86.2	Confident	154 Å²	154	84.4 Å²	84.4	67%	0.67	42%	0.419	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-65.8	110.5	172.1	-167.9	169.6	-173.3	165.3	0	110.3	R98 R99	K96-R98 WeakPolarHBondContact CG-O 3.33Å; K96-R99 WeakPolarHBondContact CE-O 3.13Å
97	V	83.7	Confident	86.5	Confident	90 Å²	90	88 Å²	88	55%	0.545	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.1	-40.9	177.2	-176.8	0	0	0	0	110.2	V95 L101	V95-V97 PolarHBondContact O-N 2.94Å; V95-V97 VanDerWaalsContact O-N 3.09Å; V97-L101 HydrophobicContact CB-CD2 4.48Å; V97-L101 PolarHBondContact N-O 3.24Å
98	R	85.3	Confident	86.8	Confident	189 Å²	189	93.2 Å²	93.2	71%	0.713	46%	0.46	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-141.4	170.9	175.3	-63	-175.9	171.1	176.4	-2.9	110.5	K96 N100 L101	K96-R98 WeakPolarHBondContact CG-O 3.33Å; R98-N100 PolarHBondContact O-N 2.88Å; R98-L101 HydrophobicContact CB-CB 4.02Å; R98-L101 PolarHBondContact N-O 3.09Å; R98-L101 PolarHBondContact O-N 2.96Å; R98-L101 VanDerWaalsContact O-N 3.08Å
99	R	81.7	Confident	86.7	Confident	230 Å²	230	94.4 Å²	94.4	87%	0.868	47%	0.47	S	S	*	.	T	Hydrogen-bonded Turn	trans	-45.7	-40	-178.2	-81.7	-174.4	175.2	160.2	-0.9	113.3	K96	K96-R99 WeakPolarHBondContact CE-O 3.13Å
100	N	82.8	Confident	86.6	Confident	164 Å²	164	99.4 Å²	99.4	88%	0.877	50%	0.496	S	S	*	.	T	Hydrogen-bonded Turn	trans	-122.9	21.5	-177.7	-57.1	-19.6	0	0	0	113.1	R98	R98-N100 PolarHBondContact O-N 2.88Å
101	L	85.3	Confident	86.3	Confident	98 Å²	98	97.1 Å²	97.1	51%	0.513	49%	0.492	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.4	116.6	178.7	-173.1	67.2	0	0	0	109.8	V97 R98	V97-L101 HydrophobicContact CB-CD2 4.48Å; V97-L101 PolarHBondContact N-O 3.24Å; R98-L101 HydrophobicContact CB-CB 4.02Å; R98-L101 PolarHBondContact N-O 3.09Å; R98-L101 PolarHBondContact O-N 2.96Å; R98-L101 VanDerWaalsContact O-N 3.08Å
102	C	82.6	Confident	85.9	Confident	78 Å²	78	98.9 Å²	98.9	53%	0.527	51%	0.509	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.7	135.2	166.9	-156.3	0	0	0	0	108.1	V95	V95-C102 WeakPolarHBondContact O-CA 3.43Å; V95-C102 PolarHBondContact O-SG 2.73Å
103	G	86	Confident	85.1	Confident	23 Å²	23	100.1 Å²	100.1	24%	0.237	51%	0.511	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112	152.9	168.4	0	0	0	0	0	109.2	V95	V95-G103 PolarHBondContact N-O 3.44Å; V95-G103 PolarHBondContact O-N 3.17Å
104	E	87.8	Confident	84.4	Confident	171 Å²	171	104 Å²	104	80%	0.799	53%	0.534	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93.3	140	175.1	-65.6	174.4	160.6	0	0	109.3
105	R	87.1	Confident	83.5	Confident	128 Å²	128	100.6 Å²	100.6	48%	0.483	51%	0.509	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.4	129.3	169.4	-59.8	-168.3	-153.1	148.4	-0.8	109	S93 V95 F107	S93-R105 PolarHBondContact N-O 2.86Å; S93-R105 PolarHBondContact O-N 3.45Å; S93-R105 PolarHBondContact OG-O 3.36Å; V95-R105 HydrophobicContact CB-CG 4.29Å; V95-R105 VanDerWaalsContact CG1-CZ 3.46Å; V95-R105 HydrophobicContact CG2-CB 4.49Å; V95-R105 HydrophobicContact CG2-CG 3.88Å; V95-R105 VanDerWaalsContact CG2-CZ 3.48Å; R105-F107 HydrophobicContact CB-CE2 3.95Å; R105-F107 HydrophobicContact CB-CZ 4.44Å
106	C	89.1	Confident	82.9	Confident	77 Å²	77	103.2 Å²	103.2	52%	0.52	53%	0.526	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.3	131.2	169.8	-64.3	0	0	0	0	109.1	L91	L91-C106 CarbonylContact O-C 3.56Å; L91-C106 VanDerWaalsContact O-CA 3.31Å; L91-C106 WeakPolarHBondContact O-CA 3.3Å
107	F	87.9	Confident	82.1	Confident	106 Å²	106	99.1 Å²	99.1	47%	0.465	53%	0.528	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.7	130.9	168.8	-64.9	-84.1	0	0	0	108.6	R90 L91 R105	R90-F107 CarbonylContact C-O 3.52Å; R90-F107 VanDerWaalsContact CA-O 3.27Å; R90-F107 WeakPolarHBondContact CA-O 3.43Å; L91-F107 HydrophobicContact CB-CB 4.33Å; L91-F107 PolarHBondContact N-O 2.97Å; L91-F107 PolarHBondContact O-N 3.04Å; R105-F107 HydrophobicContact CB-CE2 3.95Å; R105-F107 HydrophobicContact CB-CZ 4.44Å
108	L	88.9	Confident	81.4	Confident	110 Å²	110	101 Å²	101	58%	0.576	54%	0.543	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-120.3	117.4	174.7	178.2	65.1	0	0	0	108.3	A88 V89 R90 I110	A88-L108 HydrophobicContact CB-CD1 4.38Å; V89-L108 CarbonylContact O-C 3.51Å; V89-L108 WeakPolarHBondContact O-CA 3.21Å; R90-L108 HydrophobicContact CB-CD1 3.98Å; L108-I110 HydrophobicContact CD1-CG1 4.36Å; L108-I110 HydrophobicContact CD2-CD1 4.02Å; L108-I110 HydrophobicContact CD2-CG1 4.33Å; L108-I110 HydrophobicContact CG-CD1 4.28Å; L108-I110 HydrophobicContact CG-CG1 4.03Å
109	A	85.7	Confident	80.3	Confident	43 Å²	43	93.9 Å²	93.9	36%	0.355	52%	0.522	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.9	125.7	172	0	0	0	0	0	108.8	A88 V89	A88-A109 CarbonylContact C-O 3.5Å; A88-A109 WeakPolarHBondContact CA-O 3.38Å; V89-A109 PolarHBondContact N-O 3.47Å; V89-A109 PolarHBondContact O-N 3.15Å
110	I	87.5	Confident	79.3	Confident	109 Å²	109	90 Å²	90	56%	0.559	51%	0.514	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-120.5	132.2	175.4	-56	176.1	0	0	0	107.4	L86 C87 A88 L108	L86-I110 HydrophobicContact CD1-CG2 3.72Å; C87-I110 WeakPolarHBondContact O-CA 3.43Å; A88-I110 HydrophobicContact CB-CG1 4.23Å; L108-I110 HydrophobicContact CD1-CG1 4.36Å; L108-I110 HydrophobicContact CD2-CD1 4.02Å; L108-I110 HydrophobicContact CD2-CG1 4.33Å; L108-I110 HydrophobicContact CG-CD1 4.28Å; L108-I110 HydrophobicContact CG-CG1 4.03Å
111	S	84.4	Confident	78.5	Confident	32 Å²	32	87.3 Å²	87.3	22%	0.224	50%	0.499	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.7	128.2	176.7	-164.7	0	0	0	0	109.4	L24 L86 C87	L24-S111 VanDerWaalsContact CD1-OG 3.29Å; L24-S111 WeakPolarHBondContact CD1-OG 3.45Å; L86-S111 WeakPolarHBondContact CA-O 3.38Å; C87-S111 PolarHBondContact N-O 2.77Å; C87-S111 PolarHBondContact O-N 3.49Å
112	A	84	Confident	77.5	Confident	55 Å²	55	85.9 Å²	85.9	46%	0.455	50%	0.497	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.6	140.9	-176.4	0	0	0	0	0	111.3	R85 L86	R85-A112 CarbonylContact O-C 3.5Å; R85-A112 VanDerWaalsContact O-CA 3.24Å; R85-A112 WeakPolarHBondContact O-CA 3.42Å; L86-A112 HydrophobicContact CD1-CB 3.56Å
113	Y	73.4	Confident	76.5	Confident	116 Å²	116	83.5 Å²	83.5	46%	0.455	48%	0.481	S	S	.	.			trans	-116.5	99	175.7	-174.7	-101.1	0	0	0	110.9	R85	R85-Y113 PolarHBondContact O-N 2.75Å
114	T	73.6	Confident	75.4	Confident	92 Å²	92	86.5 Å²	86.5	56%	0.564	49%	0.487	S	S	*	.	P	Polyproline II helix	trans	-69	128.9	177.5	53.1	0	0	0	0	110.7	L127	T114-L127 HydrophobicContact CG2-CD1 4.44Å; T114-L127 HydrophobicContact CG2-CD2 3.8Å
115	P	68.5	Low	74.5	Confident	19 Å²	19	84.8 Å²	84.8	12%	0.123	48%	0.483	C	S	.	.	P	Polyproline II helix	trans	-56.4	144.9	171.8	-8.2	16.4	0	0	0	111	R85 C119 T123 K124	R85-P115 VanDerWaalsContact NH1-CA 3.35Å; R85-P115 VanDerWaalsContact NH1-CG 3.27Å; P115-C119 HydrophobicContact CB-CB 3.6Å; P115-T123 HydrophobicContact CB-CG2 4Å; P115-T123 HydrophobicContact CG-CG2 3.89Å; P115-T123 WeakPolarHBondContact CG-O 3.11Å; P115-K124 HydrophobicContact CG-CG 4.47Å
116	T	71.5	Confident	73.6	Confident	83 Å²	83	84.1 Å²	84.1	51%	0.509	49%	0.489	S	S	.	.	P	Polyproline II helix	trans	-68.2	158.2	175.9	56.3	0	0	0	0	110.4	C118 C119	T116-C118 PolarHBondContact O-N 3.19Å; T116-C119 VanDerWaalsContact O-CB 3.3Å; T116-C119 WeakPolarHBondContact O-CB 3.34Å; T116-C119 PolarHBondContact O-N 3.37Å
117	G	67.4	Low	72.4	Confident	69 Å²	69	85.2 Å²	85.2	71%	0.711	49%	0.489	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.9	-20.3	-175.7	0	0	0	0	0	115.2	C119	G117-C119 VanDerWaalsContact C-N 3.35Å
118	C	69	Low	71.7	Confident	130 Å²	130	84.2 Å²	84.2	88%	0.878	49%	0.491	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.5	-4.6	176.3	-58.1	0	0	0	0	114.2	T116	T116-C118 PolarHBondContact O-N 3.19Å
119	C	61.6	Low	70.7	Confident	38 Å²	38	82.8 Å²	82.8	26%	0.257	49%	0.486	S	S	.	.	S	Bend	trans	-73.9	148.3	176	-67.9	0	0	0	0	111.1	P115 T116 G117 T123	P115-C119 HydrophobicContact CB-CB 3.6Å; T116-C119 VanDerWaalsContact O-CB 3.3Å; T116-C119 WeakPolarHBondContact O-CB 3.34Å; T116-C119 PolarHBondContact O-N 3.37Å; G117-C119 VanDerWaalsContact C-N 3.35Å; C119-T123 HydrophobicContact CB-CG2 4.35Å
120	Q	60.8	Low	69.9	Low	150 Å²	150	85 Å²	85	70%	0.701	49%	0.493	S	S	*	.			trans	-56.8	145.5	175.8	-66.9	-178	-38	0	0	110.6	S122 T123	Q120-S122 PolarHBondContact O-N 3.26Å; Q120-T123 WeakPolarHBondContact O-CA 3.44Å; Q120-T123 WeakPolarHBondContact O-CB 3.12Å; Q120-T123 PolarHBondContact O-N 3.41Å; Q120-T123 PolarHBondContact O-OG1 3.47Å
121	D	66.3	Low	68.9	Low	106 Å²	106	83.6 Å²	83.6	57%	0.567	49%	0.49	S	S	*	.	H	α-helix	trans	-60.9	-32.8	-175.8	-65.5	-39	0	0	0	112.5	T123 K124 D125	D121-T123 PolarHBondContact O-N 3.23Å; D121-T123 VanDerWaalsContact O-N 3.1Å; D121-K124 WeakPolarHBondContact O-CA 3.47Å; D121-K124 WeakPolarHBondContact O-CB 3.25Å; D121-K124 PolarHBondContact O-N 2.98Å; D121-K124 IonicContact OD1-NZ 2.84Å; D121-K124 PolarHBondContact OD1-NZ 3.46Å; D121-D125 PolarHBondContact O-N 3.12Å; D121-D125 VanDerWaalsContact O-N 3.09Å
122	S	64.8	Low	67.9	Low	68 Å²	68	86.8 Å²	86.8	48%	0.476	51%	0.506	S	S	.	.	H	α-helix	trans	-55	-31.8	171.7	58.1	0	0	0	0	113.3	Q120 K124	Q120-S122 PolarHBondContact O-N 3.26Å; S122-K124 VanDerWaalsContact C-N 3.35Å
123	T	61.1	Low	66.8	Low	29 Å²	29	88.9 Å²	88.9	18%	0.178	51%	0.51	C	S	.	.	H	α-helix	trans	-78	-23.2	178.5	-50.8	0	0	0	0	112.2	R85 P115 C119 Q120 D121	R85-T123 VanDerWaalsContact CZ-CG2 3.49Å; P115-T123 HydrophobicContact CB-CG2 4Å; P115-T123 HydrophobicContact CG-CG2 3.89Å; P115-T123 WeakPolarHBondContact CG-O 3.11Å; C119-T123 HydrophobicContact CB-CG2 4.35Å; Q120-T123 WeakPolarHBondContact O-CA 3.44Å; Q120-T123 WeakPolarHBondContact O-CB 3.12Å; Q120-T123 PolarHBondContact O-N 3.41Å; Q120-T123 PolarHBondContact O-OG1 3.47Å; D121-T123 PolarHBondContact O-N 3.23Å; D121-T123 VanDerWaalsContact O-N 3.1Å
124	K	63.8	Low	66.4	Low	86 Å²	86	87 Å²	87	37%	0.374	51%	0.513	S	S	.	.	H	α-helix	trans	-79.2	-34.5	175.2	-62	176.2	-170.7	153.9	0	111.4	P115 D121 S122 D126	P115-K124 HydrophobicContact CG-CG 4.47Å; D121-K124 WeakPolarHBondContact O-CA 3.47Å; D121-K124 WeakPolarHBondContact O-CB 3.25Å; D121-K124 PolarHBondContact O-N 2.98Å; D121-K124 IonicContact OD1-NZ 2.84Å; D121-K124 PolarHBondContact OD1-NZ 3.46Å; S122-K124 VanDerWaalsContact C-N 3.35Å; K124-D126 PolarHBondContact O-N 2.83Å
125	D	69	Low	65.8	Low	135 Å²	135	86.6 Å²	86.6	72%	0.722	51%	0.51	S	S	*	.	H	α-helix	trans	-69.9	-21.3	178.7	-65.3	-28.9	0	0	0	113.1	D121 L127	D121-D125 PolarHBondContact O-N 3.12Å; D121-D125 VanDerWaalsContact O-N 3.09Å; D125-L127 VanDerWaalsContact C-N 3.33Å; D125-L127 PolarHBondContact O-N 3.25Å
126	D	67	Low	65.6	Low	113 Å²	113	92.3 Å²	92.3	60%	0.604	54%	0.542	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.1	-6	179.7	-77.5	-23.5	0	0	0	114.8	N83 K124	N83-D126 PolarHBondContact ND2-O 3.28Å; K124-D126 PolarHBondContact O-N 2.83Å
127	L	65	Low	65.1	Low	100 Å²	100	93.1 Å²	93.1	52%	0.524	55%	0.545	S	S	.	.			trans	-84.2	0	179.9	-171.7	94.5	0	0	0	111.7	R85 T114 D125	R85-L127 HydrophobicContact CB-CD1 4.29Å; T114-L127 HydrophobicContact CG2-CD1 4.44Å; T114-L127 HydrophobicContact CG2-CD2 3.8Å; D125-L127 VanDerWaalsContact C-N 3.33Å; D125-L127 PolarHBondContact O-N 3.25Å

Retrieved 127 of 127 residues in 41.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).