G4LYV2_SCHMA Loading...

Transcription factor Pcc1

AlphaFold DB , UniProt , Accession G4LYV2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 118 aa.

						>G4LYV2_SCHMA|G4LYV2
MTKNSMALSDTKLLSDEHQLSVSVSFDNPSFAEVAMRSLSVDPSPPRSTVKEQLDQKGSDLICTFSAPVTVSNRNQQLRKLRIAVNSWLDHVILVSETISAFGTIDSSFTSERAINGF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47	Very low	46.7	Very low	243 Å²	243	149.4 Å²	149.4	100%	1.197	83%	0.83	S	S	*	*				0	88.4	0	-80.1	177.9	171.2	0	0	108.5
2	T	42.8	Very low	46.2	Very low	142 Å²	142	154.4 Å²	154.4	87%	0.871	84%	0.837	S	S	*	*			trans	-85.8	107	-173.7	2.4	0	0	0	0	109.1	N4	T2-N4 PolarHBondContact O-N 3.18Å
3	K	50.2	Low	45.7	Very low	208 Å²	208	153.5 Å²	153.5	90%	0.904	83%	0.83	S	S	*	*			trans	-84.4	96.2	170.7	-76.1	-179.2	176.3	175.9	0	108.5	S5	K3-S5 PolarHBondContact O-N 3.34Å
4	N	48.2	Very low	46.2	Very low	165 Å²	165	154.2 Å²	154.2	88%	0.882	83%	0.832	S	S	*	*			trans	-65.2	104.6	161.1	-92.7	-3.3	0	0	0	108.3	T2	T2-N4 PolarHBondContact O-N 3.18Å
5	S	53.8	Low	46.9	Very low	116 Å²	116	149.8 Å²	149.8	81%	0.811	82%	0.817	S	S	*	*			trans	-97	101	164.7	179.1	0	0	0	0	107.2	K3 A7	K3-S5 PolarHBondContact O-N 3.34Å; S5-A7 PolarHBondContact O-N 3.19Å
6	M	54.4	Low	49.2	Very low	178 Å²	178	145.4 Å²	145.4	88%	0.877	79%	0.793	S	S	*	*			trans	-62.6	118.9	177.3	-167.5	163.6	169.9	0	0	109	L8	M6-L8 PolarHBondContact O-N 3.35Å; M6-L8 VanDerWaalsContact O-N 3.16Å
7	A	48.1	Very low	51.7	Low	78 Å²	78	141.1 Å²	141.1	65%	0.645	77%	0.766	S	S	*	*			trans	-60.6	112.3	179.1	0	0	0	0	0	110.7	S5 S9	S5-A7 PolarHBondContact O-N 3.19Å; A7-S9 VanDerWaalsContact C-N 3.28Å; A7-S9 PolarHBondContact O-N 2.93Å; A7-S9 PolarHBondContact O-OG 2.83Å
8	L	47.2	Very low	54.1	Low	167 Å²	167	135.7 Å²	135.7	87%	0.874	74%	0.735	S	S	*	*			trans	-62.2	89.6	161.3	-82.7	131.8	0	0	0	108.4	M6	M6-L8 PolarHBondContact O-N 3.35Å; M6-L8 VanDerWaalsContact O-N 3.16Å
9	S	41.9	Very low	56.2	Low	89 Å²	89	135.2 Å²	135.2	62%	0.622	73%	0.727	S	S	*	*			trans	-135	33.2	-178.4	36.6	0	0	0	0	113.4	A7	A7-S9 VanDerWaalsContact C-N 3.28Å; A7-S9 PolarHBondContact O-N 2.93Å; A7-S9 PolarHBondContact O-OG 2.83Å
10	D	40.9	Very low	58.3	Low	165 Å²	165	132.1 Å²	132.1	88%	0.882	71%	0.71	S	S	*	*			trans	-142.3	37.9	174.3	-80.9	-42.5	0	0	0	113.1
11	T	39.4	Very low	60.1	Low	92 Å²	92	129 Å²	129	56%	0.564	70%	0.699	S	S	*	*			trans	-94.9	108.7	163.4	36.5	0	0	0	0	108.9	L13	T11-L13 PolarHBondContact O-N 3.32Å
12	K	40.3	Very low	62.5	Low	210 Å²	210	118.9 Å²	118.9	91%	0.913	65%	0.65	S	S	*	*			trans	-55.3	68.7	156.7	-165.4	178.6	-173.6	-175.7	0	108.8	L14	K12-L14 PolarHBondContact O-N 3.3Å
13	L	40.2	Very low	65.2	Low	142 Å²	142	115.2 Å²	115.2	74%	0.743	63%	0.631	S	S	*	*			trans	-76.8	101.7	176.5	-69.5	177.3	0	0	0	106.7	T11 S15	T11-L13 PolarHBondContact O-N 3.32Å; L13-S15 PolarHBondContact O-N 3.02Å; L13-S15 VanDerWaalsContact O-N 3.13Å
14	L	52.1	Low	67.4	Low	164 Å²	164	107 Å²	107	86%	0.859	60%	0.598	S	S	*	*			trans	-20.3	111.8	161	-69.2	140.9	0	0	0	110.7	K12 D16	K12-L14 PolarHBondContact O-N 3.3Å; L14-D16 VanDerWaalsContact C-N 3.3Å; L14-D16 PolarHBondContact O-N 3.33Å
15	S	57.4	Low	69.7	Low	88 Å²	88	103.3 Å²	103.3	62%	0.615	59%	0.585	S	S	*	*			trans	-56	107.5	153.5	51.7	0	0	0	0	105.5	L13 E17	L13-S15 PolarHBondContact O-N 3.02Å; L13-S15 VanDerWaalsContact O-N 3.13Å; S15-E17 PolarHBondContact O-N 3.07Å; S15-E17 VanDerWaalsContact O-N 3.12Å
16	D	83.4	Confident	71.7	Confident	80 Å²	80	98.9 Å²	98.9	43%	0.428	55%	0.551	S	S	.	*			trans	-53.3	121.8	174.1	-163.6	15.2	0	0	0	106.1	L14 V69 R74	L14-D16 VanDerWaalsContact C-N 3.3Å; L14-D16 PolarHBondContact O-N 3.33Å; D16-V69 WeakPolarHBondContact O-CA 3.28Å; D16-V69 WeakPolarHBondContact O-CB 3.31Å; D16-V69 PolarHBondContact O-N 3.45Å; D16-R74 IonicContact OD2-CZ 3.73Å; D16-R74 IonicContact OD2-NH2 2.78Å; D16-R74 PolarHBondContact OD2-NH2 2.84Å
17	E	91.9	Very high	73.6	Confident	72 Å²	72	97.5 Å²	97.5	34%	0.336	55%	0.547	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.2	144	177.8	64.9	173.1	-146.6	0	0	108.9	S15 Q19 S66 A67	S15-E17 PolarHBondContact O-N 3.07Å; S15-E17 VanDerWaalsContact O-N 3.12Å; E17-Q19 PolarHBondContact O-N 3.16Å; E17-S66 VanDerWaalsContact OE1-CB 3.31Å; E17-S66 WeakPolarHBondContact OE1-CB 3.27Å; E17-S66 PolarHBondContact OE1-OG 2.91Å; E17-A67 CarbonylContact C-O 3.55Å; E17-A67 VanDerWaalsContact CA-O 3.26Å; E17-A67 WeakPolarHBondContact CA-O 3.5Å; E17-A67 WeakPolarHBondContact CB-O 3.44Å
18	H	94.6	Very high	75.8	Confident	44 Å²	44	95.3 Å²	95.3	20%	0.204	53%	0.525	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.5	122.5	166	-65	-49.6	0	0	0	107.8	S66 A67 V69 L78 L81	H18-S66 WeakPolarHBondContact O-CA 3.44Å; H18-A67 HydrophobicContact CB-CB 4.38Å; H18-A67 PolarHBondContact N-O 3.46Å; H18-A67 PolarHBondContact O-N 3.19Å; H18-V69 HydrophobicContact CB-CG2 4.47Å; H18-V69 WeakPolarHBondContact CD2-CG2 3.48Å; H18-V69 WeakPolarHBondContact NE2-CG2 3.43Å; H18-L78 HydrophobicContact CB-CD2 4.17Å; H18-L78 VanDerWaalsContact CD2-CD2 3.43Å; H18-L78 WeakPolarHBondContact CD2-CD2 3.06Å; H18-L78 VanDerWaalsContact CD2-CG 3.49Å; H18-L78 WeakPolarHBondContact CD2-CG 3.41Å; H18-L78 WeakPolarHBondContact NE2-CG 3.36Å; H18-L81 HydrophobicContact CB-CD2 3.73Å
19	Q	95.1	Very high	78.1	Confident	126 Å²	126	90.6 Å²	90.6	59%	0.589	50%	0.504	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-116.6	136.8	178.3	-164.9	176.8	24.6	0	0	110.1	E17 T64 F65	E17-Q19 PolarHBondContact O-N 3.16Å; Q19-T64 HydrophobicContact CG-CG2 4.15Å; Q19-F65 VanDerWaalsContact CA-O 3.28Å; Q19-F65 WeakPolarHBondContact CA-O 3.19Å
20	L	96.9	Very high	80.6	Confident	72 Å²	72	89.5 Å²	89.5	38%	0.377	50%	0.497	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.3	131.3	170.6	-179.7	65.7	0	0	0	108.9	V22 F65 L81 V85	L20-V22 HydrophobicContact CD2-CG2 4.09Å; L20-V22 HydrophobicContact CG-CG2 4.12Å; L20-F65 PolarHBondContact N-O 3.42Å; L20-F65 WeakPolarHBondContact O-CD2 3.35Å; L20-F65 PolarHBondContact O-N 3.36Å; L20-L81 HydrophobicContact CB-CD2 4.4Å; L20-V85 HydrophobicContact CD2-CB 4.38Å; L20-V85 HydrophobicContact CD2-CG1 3.95Å; L20-V85 HydrophobicContact CD2-CG2 3.63Å
21	S	97.2	Very high	83.2	Confident	69 Å²	69	83 Å²	83	48%	0.483	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.8	131	169.6	-62.1	0	0	0	0	109.3	C63 T64	S21-C63 WeakPolarHBondContact CA-O 3.42Å; S21-T64 PolarHBondContact OG-OG1 3.36Å
22	V	97.5	Very high	86	Confident	29 Å²	29	78.6 Å²	78.6	18%	0.176	43%	0.433	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.2	133.1	177	-173.1	0	0	0	0	108.3	L20 V24 I62 C63 F65 V85 W88 L89	L20-V22 HydrophobicContact CD2-CG2 4.09Å; L20-V22 HydrophobicContact CG-CG2 4.12Å; V22-V24 HydrophobicContact CG1-CG2 4.43Å; V22-I62 CarbonylContact O-C 3.57Å; V22-I62 WeakPolarHBondContact O-CA 3.42Å; V22-C63 PolarHBondContact N-O 3.2Å; V22-C63 PolarHBondContact O-N 3.38Å; V22-F65 HydrophobicContact CG2-CE2 4.09Å; V22-V85 HydrophobicContact CG2-CG1 4.27Å; V22-W88 HydrophobicContact CB-CH2 4.42Å; V22-W88 HydrophobicContact CB-CZ3 3.89Å; V22-W88 HydrophobicContact CG1-CH2 4.34Å; V22-W88 HydrophobicContact CG1-CZ3 3.68Å; V22-L89 HydrophobicContact CG1-CD2 4.3Å
23	S	97.8	Very high	88.6	Confident	66 Å²	66	71.9 Å²	71.9	46%	0.462	41%	0.405	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.8	129.1	177.6	-171	0	0	0	0	109.5	L61	S23-L61 CarbonylContact C-O 3.58Å; S23-L61 WeakPolarHBondContact CA-O 3.38Å
24	V	97.2	Very high	91.2	Very high	36 Å²	36	68.1 Å²	68.1	22%	0.218	39%	0.388	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.9	118.6	177.4	179.7	0	0	0	0	108.7	V22 F26 L61 W88 V92	V22-V24 HydrophobicContact CG1-CG2 4.43Å; V24-F26 HydrophobicContact CG1-CE2 4.18Å; V24-L61 PolarHBondContact N-O 2.72Å; V24-L61 PolarHBondContact O-N 2.97Å; V24-W88 HydrophobicContact CG2-CH2 3.98Å; V24-W88 HydrophobicContact CG2-CZ3 4.17Å; V24-V92 HydrophobicContact CB-CG1 4.37Å; V24-V92 HydrophobicContact CG1-CG1 3.98Å; V24-V92 HydrophobicContact CG2-CG1 4.2Å
25	S	97.3	Very high	93.3	Very high	87 Å²	87	60.3 Å²	60.3	61%	0.608	35%	0.347	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87.3	129.3	179.3	-54.5	0	0	0	0	110.7	D60	S25-D60 WeakPolarHBondContact CA-OD1 3.35Å; S25-D60 VanDerWaalsContact CB-OD1 3.26Å; S25-D60 WeakPolarHBondContact CB-OD1 3.43Å; S25-D60 PolarHBondContact OG-OD1 3.22Å
26	F	95.9	Very high	95.1	Very high	22 Å²	22	58.6 Å²	58.6	10%	0.096	33%	0.33	C	S	.	.			trans	-98.3	164.2	170.9	-70.3	-96.4	0	0	0	110.8	V24 N28 F31 A32 A35 S59 L61 I99	V24-F26 HydrophobicContact CG1-CE2 4.18Å; F26-N28 PolarHBondContact O-N 3.33Å; F26-F31 HydrophobicContact CB-CB 3.91Å; F26-F31 HydrophobicContact CD1-CB 4.03Å; F26-F31 HydrophobicContact CG-CB 4.26Å; F26-A32 HydrophobicContact CB-CB 4.18Å; F26-A32 HydrophobicContact CD2-CB 3.91Å; F26-A32 HydrophobicContact CG-CB 4.28Å; F26-A35 HydrophobicContact CE1-CB 3.86Å; F26-A35 HydrophobicContact CE2-CB 3.75Å; F26-A35 HydrophobicContact CZ-CB 3.32Å; F26-S59 PolarHBondContact N-O 2.9Å; F26-S59 VanDerWaalsContact O-CB 3.29Å; F26-S59 WeakPolarHBondContact O-CB 3.45Å; F26-L61 HydrophobicContact CD2-CB 4.23Å; F26-L61 HydrophobicContact CE2-CB 3.72Å; F26-L61 HydrophobicContact CE2-CD2 4.05Å; F26-L61 HydrophobicContact CZ-CD2 4.48Å; F26-I99 HydrophobicContact CD1-CD1 4.14Å; F26-I99 HydrophobicContact CE1-CD1 3.89Å
27	D	93.7	Very high	95.7	Very high	149 Å²	149	62 Å²	62	80%	0.797	34%	0.337	S	S	*	.	S	Bend	trans	-62	-28.9	-177.6	-65.6	-23.7	0	0	0	113.5	F31	D27-F31 HydrophobicContact CB-CD2 4.23Å
28	N	93.3	Very high	95.8	Very high	32 Å²	32	61.3 Å²	61.3	17%	0.171	34%	0.341	C	S	.	.	S	Bend	trans	-150.9	162.4	178.5	67.2	74	0	0	0	111.7	F26 S30 F31 A32	F26-N28 PolarHBondContact O-N 3.33Å; N28-S30 PolarHBondContact O-N 3.02Å; N28-S30 WeakPolarHBondContact OD1-CA 3.49Å; N28-S30 WeakPolarHBondContact OD1-CB 3.34Å; N28-S30 PolarHBondContact OD1-N 2.93Å; N28-F31 WeakPolarHBondContact ND2-CD2 3.36Å; N28-F31 VanDerWaalsContact ND2-CE2 3.31Å; N28-F31 WeakPolarHBondContact ND2-CE2 3.46Å; N28-F31 WeakPolarHBondContact ND2-CG 3.17Å; N28-F31 PolarHBondContact O-N 3.22Å; N28-F31 PolarHBondContact OD1-N 3.07Å; N28-A32 PolarHBondContact O-N 3.08Å
29	P	95.8	Very high	95.8	Very high	69 Å²	69	60.6 Å²	60.6	45%	0.448	34%	0.338	S	S	.	.	H	α-helix	trans	-61.8	-27.5	-179	-25.4	35.7	0	0	0	114.6	A32 E33 Q56 G58 S59	P29-A32 PolarHBondContact O-N 2.84Å; P29-E33 WeakPolarHBondContact O-CB 3Å; P29-E33 PolarHBondContact O-N 2.72Å; P29-Q56 PolarHBondContact O-NE2 2.92Å; P29-G58 WeakPolarHBondContact CA-O 3.44Å; P29-S59 WeakPolarHBondContact CD-OG 3.42Å
30	S	95	Very high	95.6	Very high	66 Å²	66	58.2 Å²	58.2	46%	0.462	34%	0.335	S	S	.	.	H	α-helix	trans	-69.6	-39.1	178.5	-174.4	0	0	0	0	111.3	N28 E33 V34	N28-S30 PolarHBondContact O-N 3.02Å; N28-S30 WeakPolarHBondContact OD1-CA 3.49Å; N28-S30 WeakPolarHBondContact OD1-CB 3.34Å; N28-S30 PolarHBondContact OD1-N 2.93Å; S30-E33 WeakPolarHBondContact O-CB 3.38Å; S30-E33 PolarHBondContact O-N 3.38Å; S30-V34 WeakPolarHBondContact O-CG2 3.46Å; S30-V34 PolarHBondContact O-N 3.39Å
31	F	95.9	Very high	94.9	Very high	27 Å²	27	59.6 Å²	59.6	12%	0.118	35%	0.347	C	S	.	.	H	α-helix	trans	-66.8	-39.9	175	-70.5	-7.7	0	0	0	112.4	F26 D27 N28 E33 V34 A35 I99 I105	F26-F31 HydrophobicContact CB-CB 3.91Å; F26-F31 HydrophobicContact CD1-CB 4.03Å; F26-F31 HydrophobicContact CG-CB 4.26Å; D27-F31 HydrophobicContact CB-CD2 4.23Å; N28-F31 WeakPolarHBondContact ND2-CD2 3.36Å; N28-F31 VanDerWaalsContact ND2-CE2 3.31Å; N28-F31 WeakPolarHBondContact ND2-CE2 3.46Å; N28-F31 WeakPolarHBondContact ND2-CG 3.17Å; N28-F31 PolarHBondContact O-N 3.22Å; N28-F31 PolarHBondContact OD1-N 3.07Å; F31-E33 VanDerWaalsContact C-N 3.3Å; F31-E33 PolarHBondContact O-N 3.47Å; F31-V34 PolarHBondContact O-N 3.31Å; F31-A35 WeakPolarHBondContact O-CB 3.27Å; F31-A35 PolarHBondContact O-N 3.26Å; F31-I99 HydrophobicContact CB-CD1 4.2Å; F31-I99 HydrophobicContact CB-CG2 4.27Å; F31-I99 HydrophobicContact CD1-CG2 3.87Å; F31-I99 HydrophobicContact CD2-CG2 3.48Å; F31-I99 VanDerWaalsContact CD2-CG2 3.48Å; F31-I99 HydrophobicContact CE1-CG2 3.98Å; F31-I99 HydrophobicContact CE2-CG2 3.61Å; F31-I99 HydrophobicContact CG-CG2 3.62Å; F31-I99 HydrophobicContact CZ-CG2 3.85Å; F31-I105 HydrophobicContact CE1-CG1 4.32Å; F31-I105 HydrophobicContact CE2-CD1 4.15Å; F31-I105 HydrophobicContact CE2-CG1 4.26Å; F31-I105 HydrophobicContact CZ-CD1 4.03Å; F31-I105 HydrophobicContact CZ-CG1 3.62Å
32	A	96.8	Very high	93.8	Very high	0 Å²	0	62.3 Å²	62.3	0%	0	36%	0.356	C	S	.	.	H	α-helix	trans	-61.7	-39.6	172.5	0	0	0	0	0	111.9	F26 N28 P29 A35 M36 Q56 S59	F26-A32 HydrophobicContact CB-CB 4.18Å; F26-A32 HydrophobicContact CD2-CB 3.91Å; F26-A32 HydrophobicContact CG-CB 4.28Å; N28-A32 PolarHBondContact O-N 3.08Å; P29-A32 PolarHBondContact O-N 2.84Å; A32-A35 PolarHBondContact O-N 3.17Å; A32-M36 WeakPolarHBondContact O-CB 3.47Å; A32-M36 PolarHBondContact O-N 3.49Å; A32-Q56 HydrophobicContact CB-CG 4.1Å; A32-S59 WeakPolarHBondContact CB-O 3.2Å
33	E	95.7	Very high	92.6	Very high	69 Å²	69	66.4 Å²	66.4	32%	0.322	38%	0.383	S	S	.	.	H	α-helix	trans	-66.7	-42.7	176.2	-175.7	175.8	-158.6	0	0	112.2	P29 S30 F31 A35 M36 R37 Q56	P29-E33 WeakPolarHBondContact O-CB 3Å; P29-E33 PolarHBondContact O-N 2.72Å; S30-E33 WeakPolarHBondContact O-CB 3.38Å; S30-E33 PolarHBondContact O-N 3.38Å; F31-E33 VanDerWaalsContact C-N 3.3Å; F31-E33 PolarHBondContact O-N 3.47Å; E33-A35 VanDerWaalsContact C-N 3.3Å; E33-A35 PolarHBondContact O-N 2.75Å; E33-M36 PolarHBondContact O-N 2.92Å; E33-R37 VanDerWaalsContact CD-NH2 3.33Å; E33-R37 VanDerWaalsContact O-CG 3.31Å; E33-R37 WeakPolarHBondContact O-CG 3.39Å; E33-R37 PolarHBondContact O-N 3.17Å; E33-R37 IonicContact OE1-CZ 3.35Å; E33-R37 IonicContact OE1-NE 3.54Å; E33-R37 IonicContact OE1-NH2 2.63Å; E33-R37 PolarHBondContact OE1-NH2 3.23Å; E33-R37 IonicContact OE2-NH2 3.93Å; E33-Q56 VanDerWaalsContact CA-OE1 3.28Å
34	V	95.1	Very high	91.3	Very high	63 Å²	63	65.5 Å²	65.5	38%	0.382	38%	0.376	S	S	.	.	H	α-helix	trans	-59	-44.4	173.5	168.6	0	0	0	0	110.2	S30 F31 R37 S38 I99	S30-V34 WeakPolarHBondContact O-CG2 3.46Å; S30-V34 PolarHBondContact O-N 3.39Å; F31-V34 PolarHBondContact O-N 3.31Å; V34-R37 PolarHBondContact O-N 3.3Å; V34-S38 WeakPolarHBondContact O-CB 3.35Å; V34-S38 PolarHBondContact O-N 2.94Å; V34-S38 PolarHBondContact O-OG 3.14Å; V34-I99 HydrophobicContact CG1-CD1 4.27Å; V34-I99 HydrophobicContact CG1-CG1 4.41Å
35	A	96.1	Very high	90.3	Very high	0 Å²	0	67.9 Å²	67.9	0%	0	39%	0.393	C	S	.	.	H	α-helix	trans	-65.2	-44	177.9	0	0	0	0	0	112.4	F26 F31 A32 E33 R37 S38 L39 L61 V95	F26-A35 HydrophobicContact CE1-CB 3.86Å; F26-A35 HydrophobicContact CE2-CB 3.75Å; F26-A35 HydrophobicContact CZ-CB 3.32Å; F31-A35 WeakPolarHBondContact O-CB 3.27Å; F31-A35 PolarHBondContact O-N 3.26Å; A32-A35 PolarHBondContact O-N 3.17Å; E33-A35 VanDerWaalsContact C-N 3.3Å; E33-A35 PolarHBondContact O-N 2.75Å; A35-R37 VanDerWaalsContact C-N 3.34Å; A35-R37 PolarHBondContact O-N 2.87Å; A35-S38 PolarHBondContact O-N 2.83Å; A35-L39 WeakPolarHBondContact O-CB 3.43Å; A35-L39 VanDerWaalsContact O-CG 3.29Å; A35-L39 WeakPolarHBondContact O-CG 3.21Å; A35-L39 PolarHBondContact O-N 3.45Å; A35-L61 HydrophobicContact CB-CD2 4.1Å; A35-V95 HydrophobicContact CB-CG1 3.66Å
36	M	95.6	Very high	88.9	Confident	53 Å²	53	70.4 Å²	70.4	26%	0.261	41%	0.407	S	S	.	.	H	α-helix	trans	-56.6	-47.6	175.3	-174.9	-174.6	70.4	0	0	111.5	A32 E33 S38 L39 S40 L54 Q56 L61	A32-M36 WeakPolarHBondContact O-CB 3.47Å; A32-M36 PolarHBondContact O-N 3.49Å; E33-M36 PolarHBondContact O-N 2.92Å; M36-S38 VanDerWaalsContact C-N 3.34Å; M36-S38 PolarHBondContact O-N 3.37Å; M36-L39 PolarHBondContact O-N 3.21Å; M36-S40 VanDerWaalsContact O-CB 3.27Å; M36-S40 WeakPolarHBondContact O-CB 3.4Å; M36-S40 PolarHBondContact O-N 3.46Å; M36-S40 VanDerWaalsContact O-N 3.09Å; M36-S40 PolarHBondContact O-OG 3.13Å; M36-L54 HydrophobicContact CG-CD2 4.04Å; M36-L54 HydrophobicContact CG-CG 4.26Å; M36-L54 WeakPolarHBondContact O-CD2 3.49Å; M36-Q56 HydrophobicContact SD-CB 3.65Å; M36-L61 HydrophobicContact CB-CD1 3.71Å; M36-L61 HydrophobicContact CG-CD1 4.25Å
37	R	95.4	Very high	87.9	Confident	150 Å²	150	80.4 Å²	80.4	57%	0.566	44%	0.444	S	S	*	.	H	α-helix	trans	-66.4	-35.5	178.8	-69.4	174.7	-175.5	-175.8	1.7	112.6	E33 V34 A35 S40	E33-R37 VanDerWaalsContact CD-NH2 3.33Å; E33-R37 VanDerWaalsContact O-CG 3.31Å; E33-R37 WeakPolarHBondContact O-CG 3.39Å; E33-R37 PolarHBondContact O-N 3.17Å; E33-R37 IonicContact OE1-CZ 3.35Å; E33-R37 IonicContact OE1-NE 3.54Å; E33-R37 IonicContact OE1-NH2 2.63Å; E33-R37 PolarHBondContact OE1-NH2 3.23Å; E33-R37 IonicContact OE2-NH2 3.93Å; V34-R37 PolarHBondContact O-N 3.3Å; A35-R37 VanDerWaalsContact C-N 3.34Å; A35-R37 PolarHBondContact O-N 2.87Å; R37-S40 PolarHBondContact O-OG 2.71Å
38	S	94.7	Very high	87.3	Confident	59 Å²	59	75.3 Å²	75.3	41%	0.413	42%	0.42	S	S	.	.	H	α-helix	trans	-70.9	-33.6	179.7	-57.8	0	0	0	0	112.1	V34 A35 M36	V34-S38 WeakPolarHBondContact O-CB 3.35Å; V34-S38 PolarHBondContact O-N 2.94Å; V34-S38 PolarHBondContact O-OG 3.14Å; A35-S38 PolarHBondContact O-N 2.83Å; M36-S38 VanDerWaalsContact C-N 3.34Å; M36-S38 PolarHBondContact O-N 3.37Å
39	L	93.6	Very high	87.1	Confident	28 Å²	28	76.2 Å²	76.2	15%	0.147	43%	0.427	C	S	.	.	H	α-helix	trans	-93.8	-13.8	-175.4	-63.2	173	0	0	0	113.9	A35 M36 L54 L61 H91 V92 V95	A35-L39 WeakPolarHBondContact O-CB 3.43Å; A35-L39 VanDerWaalsContact O-CG 3.29Å; A35-L39 WeakPolarHBondContact O-CG 3.21Å; A35-L39 PolarHBondContact O-N 3.45Å; M36-L39 PolarHBondContact O-N 3.21Å; L39-L54 HydrophobicContact CB-CD2 3.9Å; L39-L61 HydrophobicContact CD1-CD2 3.72Å; L39-H91 HydrophobicContact CD2-CB 3.43Å; L39-H91 VanDerWaalsContact CD2-CB 3.43Å; L39-V92 HydrophobicContact CD1-CG2 3.59Å; L39-V95 HydrophobicContact CD2-CG2 4.01Å; L39-V95 HydrophobicContact CG-CG2 4.29Å
40	S	91	Very high	87	Confident	77 Å²	77	73.1 Å²	73.1	54%	0.538	41%	0.406	S	S	.	.	S	Bend	trans	-83.2	-8.7	-177.5	64.1	0	0	0	0	114.9	M36 R37	M36-S40 VanDerWaalsContact O-CB 3.27Å; M36-S40 WeakPolarHBondContact O-CB 3.4Å; M36-S40 PolarHBondContact O-N 3.46Å; M36-S40 VanDerWaalsContact O-N 3.09Å; M36-S40 PolarHBondContact O-OG 3.13Å; R37-S40 PolarHBondContact O-OG 2.71Å
41	V	82	Confident	86.9	Confident	101 Å²	101	77.5 Å²	77.5	61%	0.612	42%	0.417	S	S	*	.	S	Bend	trans	-76.9	-25.1	-171.3	-64.1	0	0	0	0	113.8
42	D	75	Confident	86.7	Confident	125 Å²	125	79.6 Å²	79.6	67%	0.668	43%	0.428	S	S	*	.	S	Bend	trans	-100	122.8	-174.7	-73.8	-24.8	0	0	0	111.4
43	P	71.7	Confident	86.6	Confident	115 Å²	115	86 Å²	86	75%	0.747	46%	0.457	S	S	*	.	P	Polyproline II helix	trans	-67.2	147.1	171.4	29.1	-33.4	0	0	0	110
44	S	71.2	Confident	86.6	Confident	47 Å²	47	85 Å²	85	33%	0.329	45%	0.454	S	S	.	.	P	Polyproline II helix	trans	-52.4	140.3	173.4	-54.9	0	0	0	0	110.7
45	P	75.3	Confident	86.6	Confident	86 Å²	86	86.4 Å²	86.4	56%	0.558	46%	0.459	S	S	*	.	P	Polyproline II helix	trans	-52	139.4	-177.2	-27.9	33	0	0	0	111.8	R47 S48	P45-R47 PolarHBondContact O-N 3.12Å; P45-S48 WeakPolarHBondContact O-CB 3.47Å; P45-S48 PolarHBondContact O-N 3.07Å
46	P	67.9	Low	86.6	Confident	140 Å²	140	88.6 Å²	88.6	91%	0.909	47%	0.47	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.2	-17.8	-171.4	-28.8	33.8	0	0	0	116.3
47	R	74.2	Confident	86.6	Confident	233 Å²	233	93.5 Å²	93.5	88%	0.879	49%	0.489	S	S	*	.	T	Hydrogen-bonded Turn	trans	-101.8	-1.3	-179.2	-53.6	-175	-160.8	178.4	6.4	113.4	P45	P45-R47 PolarHBondContact O-N 3.12Å
48	S	81.1	Confident	86.7	Confident	42 Å²	42	88.5 Å²	88.5	29%	0.294	49%	0.485	S	S	.	.			trans	-72.7	134.3	173.6	-169.8	0	0	0	0	109.4	P45 V50	P45-S48 WeakPolarHBondContact O-CB 3.47Å; P45-S48 PolarHBondContact O-N 3.07Å; S48-V50 WeakPolarHBondContact OG-CB 3.43Å; S48-V50 PolarHBondContact OG-N 3.43Å; S48-V50 VanDerWaalsContact OG-N 3.08Å; S48-V50 PolarHBondContact OG-O 2.95Å
49	T	90	Very high	86.8	Confident	50 Å²	50	87.3 Å²	87.3	31%	0.307	48%	0.477	S	S	.	.			trans	-95.8	-2.8	165.5	44.4	0	0	0	0	111.4	P68 Q77 K80	T49-P68 WeakPolarHBondContact O-CD 3.31Å; T49-Q77 PolarHBondContact OG1-NE2 3.03Å; T49-Q77 PolarHBondContact OG1-OE1 2.83Å; T49-K80 WeakPolarHBondContact OG1-CD 3.42Å; T49-K80 PolarHBondContact OG1-NZ 2.68Å
50	V	93.5	Very high	87	Confident	4 Å²	4	88.5 Å²	88.5	2%	0.024	48%	0.483	C	S	.	.			trans	-85.1	127	177.9	-172.5	0	0	0	0	107.9	S48 F65 S66 A67 K80 L81 A84	S48-V50 WeakPolarHBondContact OG-CB 3.43Å; S48-V50 PolarHBondContact OG-N 3.43Å; S48-V50 VanDerWaalsContact OG-N 3.08Å; S48-V50 PolarHBondContact OG-O 2.95Å; V50-F65 HydrophobicContact CG1-CB 4.09Å; V50-F65 HydrophobicContact CG1-CD1 4.17Å; V50-S66 CarbonylContact C-O 3.59Å; V50-S66 WeakPolarHBondContact CA-O 3.47Å; V50-A67 HydrophobicContact CG2-CB 4.12Å; V50-K80 HydrophobicContact CG2-CB 3.83Å; V50-L81 HydrophobicContact CG1-CD1 3.95Å; V50-A84 HydrophobicContact CB-CB 4.04Å; V50-A84 HydrophobicContact CG1-CB 3.89Å; V50-A84 HydrophobicContact CG2-CB 4.18Å
51	K	92.7	Very high	87.3	Confident	159 Å²	159	84.8 Å²	84.8	69%	0.691	46%	0.457	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-90.8	139.9	169.5	-64.5	-177.5	179.6	178.8	0	109.1	F65 S66	K51-F65 CarbonylContact O-C 3.56Å; K51-F65 VanDerWaalsContact O-CA 3.26Å; K51-F65 WeakPolarHBondContact O-CA 3.26Å; K51-S66 PolarHBondContact N-O 3.28Å; K51-S66 PolarHBondContact O-N 2.98Å
52	E	92.9	Very high	88.1	Confident	71 Å²	71	81.8 Å²	81.8	33%	0.332	44%	0.437	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.9	129.3	176.9	-64.8	173.2	-144.4	0	0	108.2	F65	E52-F65 HydrophobicContact CG-CD1 3.66Å; E52-F65 HydrophobicContact CG-CE1 3.72Å
53	Q	93.9	Very high	89.1	Confident	134 Å²	134	75.9 Å²	75.9	63%	0.626	41%	0.406	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123.9	109.2	175.1	-177.1	176.9	3	0	0	108.6	C63 T64	Q53-C63 WeakPolarHBondContact O-CA 3.49Å; Q53-T64 PolarHBondContact N-O 2.83Å; Q53-T64 PolarHBondContact O-N 2.93Å
54	L	95	Very high	90.3	Very high	47 Å²	47	71.7 Å²	71.7	25%	0.246	38%	0.378	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92	136.4	179	-163.1	64.8	0	0	0	110.3	M36 L39 L61 I62 C63 W88	M36-L54 HydrophobicContact CG-CD2 4.04Å; M36-L54 HydrophobicContact CG-CG 4.26Å; M36-L54 WeakPolarHBondContact O-CD2 3.49Å; L39-L54 HydrophobicContact CB-CD2 3.9Å; L54-L61 HydrophobicContact CD1-CD1 3.75Å; L54-L61 HydrophobicContact CD1-CD2 4.4Å; L54-L61 HydrophobicContact CD1-CG 4.04Å; L54-L61 HydrophobicContact CD2-CD1 4.37Å; L54-L61 HydrophobicContact CG-CD1 4.04Å; L54-I62 CarbonylContact C-O 3.59Å; L54-I62 WeakPolarHBondContact CA-O 3.35Å; L54-C63 HydrophobicContact CD1-CB 3.91Å; L54-W88 HydrophobicContact CD1-CZ2 4.04Å
55	D	95.9	Very high	91.5	Very high	93 Å²	93	69.4 Å²	69.4	50%	0.497	36%	0.362	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.3	162.4	178.1	-164.5	10.9	0	0	0	110.2	I62	D55-I62 PolarHBondContact N-O 2.91Å; D55-I62 PolarHBondContact O-N 3.27Å
56	Q	95.9	Very high	92.4	Very high	47 Å²	47	66.1 Å²	66.1	22%	0.22	34%	0.341	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.5	131	176.6	-177.6	-164.4	-7.9	0	0	110.4	P29 A32 E33 M36 G58 D60	P29-Q56 PolarHBondContact O-NE2 2.92Å; A32-Q56 HydrophobicContact CB-CG 4.1Å; E33-Q56 VanDerWaalsContact CA-OE1 3.28Å; M36-Q56 HydrophobicContact SD-CB 3.65Å; Q56-G58 PolarHBondContact NE2-O 2.86Å; Q56-D60 WeakPolarHBondContact CA-O 3.26Å
57	K	96.7	Very high	93.6	Very high	155 Å²	155	59.5 Å²	59.5	67%	0.674	30%	0.298	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-127.5	97	172.8	-170.6	178.8	179.1	-177.3	0	110.8	S59 D60 I62	K57-S59 PolarHBondContact O-N 3.48Å; K57-D60 PolarHBondContact N-O 2.78Å; K57-D60 PolarHBondContact O-N 3.12Å; K57-I62 HydrophobicContact CB-CD1 4.03Å
58	G	96.6	Very high	94.5	Very high	45 Å²	45	51.1 Å²	51.1	46%	0.464	27%	0.274	S	S	.	.	T	Hydrogen-bonded Turn	trans	63.9	-118.8	-176.2	0	0	0	0	0	110.6	P29 Q56 D60	P29-G58 WeakPolarHBondContact CA-O 3.44Å; Q56-G58 PolarHBondContact NE2-O 2.86Å; G58-D60 VanDerWaalsContact C-N 3.33Å
59	S	97.2	Very high	95	Very high	35 Å²	35	49.8 Å²	49.8	25%	0.245	26%	0.264	C	S	.	.	T	Hydrogen-bonded Turn	trans	-86.4	-1.1	176	-55.4	0	0	0	0	114.1	F26 P29 A32 K57	F26-S59 PolarHBondContact N-O 2.9Å; F26-S59 VanDerWaalsContact O-CB 3.29Å; F26-S59 WeakPolarHBondContact O-CB 3.45Å; P29-S59 WeakPolarHBondContact CD-OG 3.42Å; A32-S59 WeakPolarHBondContact CB-O 3.2Å; K57-S59 PolarHBondContact O-N 3.48Å
60	D	97.9	Very high	95	Very high	52 Å²	52	50.7 Å²	50.7	28%	0.278	27%	0.27	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.4	125.4	-177.6	-62.1	-29.8	0	0	0	111.1	S25 Q56 K57 G58 I62	S25-D60 WeakPolarHBondContact CA-OD1 3.35Å; S25-D60 VanDerWaalsContact CB-OD1 3.26Å; S25-D60 WeakPolarHBondContact CB-OD1 3.43Å; S25-D60 PolarHBondContact OG-OD1 3.22Å; Q56-D60 WeakPolarHBondContact CA-O 3.26Å; K57-D60 PolarHBondContact N-O 2.78Å; K57-D60 PolarHBondContact O-N 3.12Å; G58-D60 VanDerWaalsContact C-N 3.33Å; D60-I62 HydrophobicContact CB-CG1 4.41Å
61	L	97.6	Very high	94.8	Very high	0 Å²	0	57 Å²	57	0%	0	31%	0.308	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92	124	165.7	-177.9	72.6	0	0	0	109	S23 V24 F26 A35 M36 L39 L54 W88 V92	S23-L61 CarbonylContact C-O 3.58Å; S23-L61 WeakPolarHBondContact CA-O 3.38Å; V24-L61 PolarHBondContact N-O 2.72Å; V24-L61 PolarHBondContact O-N 2.97Å; F26-L61 HydrophobicContact CD2-CB 4.23Å; F26-L61 HydrophobicContact CE2-CB 3.72Å; F26-L61 HydrophobicContact CE2-CD2 4.05Å; F26-L61 HydrophobicContact CZ-CD2 4.48Å; A35-L61 HydrophobicContact CB-CD2 4.1Å; M36-L61 HydrophobicContact CB-CD1 3.71Å; M36-L61 HydrophobicContact CG-CD1 4.25Å; L39-L61 HydrophobicContact CD1-CD2 3.72Å; L54-L61 HydrophobicContact CD1-CD1 3.75Å; L54-L61 HydrophobicContact CD1-CD2 4.4Å; L54-L61 HydrophobicContact CD1-CG 4.04Å; L54-L61 HydrophobicContact CD2-CD1 4.37Å; L54-L61 HydrophobicContact CG-CD1 4.04Å; L61-W88 HydrophobicContact CD2-CH2 4.47Å; L61-W88 HydrophobicContact CD2-CZ2 3.85Å; L61-W88 HydrophobicContact CG-CZ2 4.21Å; L61-V92 HydrophobicContact CD2-CG2 4.25Å
62	I	97.8	Very high	94.7	Very high	38 Å²	38	55 Å²	55	20%	0.195	31%	0.313	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.8	125.2	-174.4	-57	166.2	0	0	0	108.8	V22 L54 D55 K57 D60	V22-I62 CarbonylContact O-C 3.57Å; V22-I62 WeakPolarHBondContact O-CA 3.42Å; L54-I62 CarbonylContact C-O 3.59Å; L54-I62 WeakPolarHBondContact CA-O 3.35Å; D55-I62 PolarHBondContact N-O 2.91Å; D55-I62 PolarHBondContact O-N 3.27Å; K57-I62 HydrophobicContact CB-CD1 4.03Å; D60-I62 HydrophobicContact CB-CG1 4.41Å
63	C	96.5	Very high	94.6	Very high	1 Å²	1	52.9 Å²	52.9	1%	0.007	31%	0.305	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.1	123.4	170.1	-170.8	0	0	0	0	110.6	S21 V22 Q53 L54 F65 W88	S21-C63 WeakPolarHBondContact CA-O 3.42Å; V22-C63 PolarHBondContact N-O 3.2Å; V22-C63 PolarHBondContact O-N 3.38Å; Q53-C63 WeakPolarHBondContact O-CA 3.49Å; L54-C63 HydrophobicContact CD1-CB 3.91Å; C63-F65 HydrophobicContact CB-CE2 3.77Å; C63-F65 HydrophobicContact CB-CZ 4.03Å; C63-F65 VanDerWaalsContact SG-CE2 3.54Å; C63-F65 WeakPolarHBondContact SG-CZ 3.29Å; C63-W88 HydrophobicContact CB-CD2 3.95Å; C63-W88 HydrophobicContact CB-CE3 4.42Å; C63-W88 HydrophobicContact CB-CH2 3.9Å; C63-W88 HydrophobicContact CB-CZ2 3.35Å; C63-W88 HydrophobicContact CB-CZ3 4.4Å
64	T	96.6	Very high	94.4	Very high	26 Å²	26	52.1 Å²	52.1	16%	0.16	30%	0.296	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.2	122.5	175.1	-61.7	0	0	0	0	109.9	Q19 S21 Q53	Q19-T64 HydrophobicContact CG-CG2 4.15Å; S21-T64 PolarHBondContact OG-OG1 3.36Å; Q53-T64 PolarHBondContact N-O 2.83Å; Q53-T64 PolarHBondContact O-N 2.93Å
65	F	95.6	Very high	94.3	Very high	0 Å²	0	56.3 Å²	56.3	0%	0	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106	132.2	-179.8	-57.7	-98.5	0	0	0	109.7	Q19 L20 V22 V50 K51 E52 C63 L81 A84 V85 W88	Q19-F65 VanDerWaalsContact CA-O 3.28Å; Q19-F65 WeakPolarHBondContact CA-O 3.19Å; L20-F65 PolarHBondContact N-O 3.42Å; L20-F65 WeakPolarHBondContact O-CD2 3.35Å; L20-F65 PolarHBondContact O-N 3.36Å; V22-F65 HydrophobicContact CG2-CE2 4.09Å; V50-F65 HydrophobicContact CG1-CB 4.09Å; V50-F65 HydrophobicContact CG1-CD1 4.17Å; K51-F65 CarbonylContact O-C 3.56Å; K51-F65 VanDerWaalsContact O-CA 3.26Å; K51-F65 WeakPolarHBondContact O-CA 3.26Å; E52-F65 HydrophobicContact CG-CD1 3.66Å; E52-F65 HydrophobicContact CG-CE1 3.72Å; C63-F65 HydrophobicContact CB-CE2 3.77Å; C63-F65 HydrophobicContact CB-CZ 4.03Å; C63-F65 VanDerWaalsContact SG-CE2 3.54Å; C63-F65 WeakPolarHBondContact SG-CZ 3.29Å; F65-L81 HydrophobicContact CB-CD1 3.38Å; F65-L81 HydrophobicContact CG-CD1 4.27Å; F65-A84 HydrophobicContact CD1-CB 4.19Å; F65-A84 HydrophobicContact CE1-CB 4.35Å; F65-V85 HydrophobicContact CB-CG2 4.39Å; F65-V85 HydrophobicContact CD1-CG2 3.86Å; F65-V85 HydrophobicContact CD2-CG2 3.77Å; F65-V85 HydrophobicContact CE1-CG2 4.03Å; F65-V85 HydrophobicContact CE2-CG2 3.93Å; F65-V85 HydrophobicContact CG-CG2 3.75Å; F65-V85 HydrophobicContact CZ-CB 4.43Å; F65-V85 HydrophobicContact CZ-CG2 4.06Å; F65-W88 HydrophobicContact CE1-CB 4Å; F65-W88 HydrophobicContact CE1-CG 4.35Å; F65-W88 HydrophobicContact CE2-CE3 4.43Å; F65-W88 HydrophobicContact CZ-CB 3.65Å; F65-W88 AromaticContact CZ-CD2 3.89Å; F65-W88 HydrophobicContact CZ-CD2 3.89Å; F65-W88 HydrophobicContact CZ-CE3 4.1Å; F65-W88 AromaticContact CZ-CG 3.69Å; F65-W88 HydrophobicContact CZ-CG 3.69Å
66	S	94.5	Very high	94.2	Very high	17 Å²	17	57.2 Å²	57.2	12%	0.119	32%	0.32	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.5	124.3	175.7	-72.4	0	0	0	0	110.7	E17 H18 V50 K51	E17-S66 VanDerWaalsContact OE1-CB 3.31Å; E17-S66 WeakPolarHBondContact OE1-CB 3.27Å; E17-S66 PolarHBondContact OE1-OG 2.91Å; H18-S66 WeakPolarHBondContact O-CA 3.44Å; V50-S66 CarbonylContact C-O 3.59Å; V50-S66 WeakPolarHBondContact CA-O 3.47Å; K51-S66 PolarHBondContact N-O 3.28Å; K51-S66 PolarHBondContact O-N 2.98Å
67	A	94.1	Very high	94.1	Very high	0 Å²	0	55.4 Å²	55.4	0%	0	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.7	115.5	177.5	0	0	0	0	0	110.3	E17 H18 V50 V69 Q77 L81	E17-A67 CarbonylContact C-O 3.55Å; E17-A67 VanDerWaalsContact CA-O 3.26Å; E17-A67 WeakPolarHBondContact CA-O 3.5Å; E17-A67 WeakPolarHBondContact CB-O 3.44Å; H18-A67 HydrophobicContact CB-CB 4.38Å; H18-A67 PolarHBondContact N-O 3.46Å; H18-A67 PolarHBondContact O-N 3.19Å; V50-A67 HydrophobicContact CG2-CB 4.12Å; A67-V69 WeakPolarHBondContact O-CG2 3.3Å; A67-V69 PolarHBondContact O-N 3.06Å; A67-Q77 HydrophobicContact CB-CB 4.26Å; A67-L81 HydrophobicContact CB-CB 4.26Å
68	P	92.6	Very high	94	Very high	58 Å²	58	51.7 Å²	51.7	38%	0.377	30%	0.298	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.3	130.2	-174.9	28.6	-33.5	0	0	0	111.2	T49 Q77	T49-P68 WeakPolarHBondContact O-CD 3.31Å; P68-Q77 WeakPolarHBondContact O-CG 3.32Å; P68-Q77 PolarHBondContact O-NE2 2.94Å
69	V	92.4	Very high	93.9	Very high	14 Å²	14	57.4 Å²	57.4	9%	0.085	31%	0.306	C	S	.	.			trans	-112.8	141.6	-172.5	176.7	0	0	0	0	111.7	D16 H18 A67 N73 R74 Q77	D16-V69 WeakPolarHBondContact O-CA 3.28Å; D16-V69 WeakPolarHBondContact O-CB 3.31Å; D16-V69 PolarHBondContact O-N 3.45Å; H18-V69 HydrophobicContact CB-CG2 4.47Å; H18-V69 WeakPolarHBondContact CD2-CG2 3.48Å; H18-V69 WeakPolarHBondContact NE2-CG2 3.43Å; A67-V69 WeakPolarHBondContact O-CG2 3.3Å; A67-V69 PolarHBondContact O-N 3.06Å; V69-N73 WeakPolarHBondContact CA-OD1 3.38Å; V69-R74 HydrophobicContact CG1-CB 4.22Å; V69-R74 HydrophobicContact CG1-CG 3.21Å; V69-Q77 HydrophobicContact CG2-CB 4.13Å; V69-Q77 HydrophobicContact CG2-CG 4.46Å
70	T	90.2	Very high	93.7	Very high	69 Å²	69	58.3 Å²	58.3	42%	0.423	31%	0.305	S	S	.	.			trans	-124.3	162.6	162	68.4	0	0	0	0	108.7	S72 N73 R74	T70-S72 PolarHBondContact O-N 3.35Å; T70-S72 VanDerWaalsContact O-N 3.07Å; T70-S72 PolarHBondContact OG1-OG 2.94Å; T70-N73 PolarHBondContact N-OD1 3.44Å; T70-N73 PolarHBondContact O-N 2.92Å; T70-N73 VanDerWaalsContact O-N 3.07Å; T70-N73 PolarHBondContact O-OD1 2.98Å; T70-N73 PolarHBondContact OG1-N 3.2Å; T70-N73 PolarHBondContact OG1-ND2 3.29Å; T70-N73 PolarHBondContact OG1-OD1 2.95Å; T70-R74 PolarHBondContact O-N 3.2Å
71	V	87.8	Confident	93.6	Very high	136 Å²	136	56.5 Å²	56.5	82%	0.824	30%	0.296	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53	-33.6	177.1	-178.6	0	0	0	0	112
72	S	90.8	Very high	93.5	Very high	116 Å²	116	63.6 Å²	63.6	81%	0.811	32%	0.323	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.4	-17.3	-177.9	55.2	0	0	0	0	115.1	T70	T70-S72 PolarHBondContact O-N 3.35Å; T70-S72 VanDerWaalsContact O-N 3.07Å; T70-S72 PolarHBondContact OG1-OG 2.94Å
73	N	91.2	Very high	93.4	Very high	28 Å²	28	66.1 Å²	66.1	15%	0.15	34%	0.336	C	S	.	.	T	Hydrogen-bonded Turn	trans	-122.3	2.8	-171	77.5	10.9	0	0	0	115	V69 T70 N75 Q76 Q77	V69-N73 WeakPolarHBondContact CA-OD1 3.38Å; T70-N73 PolarHBondContact N-OD1 3.44Å; T70-N73 PolarHBondContact O-N 2.92Å; T70-N73 VanDerWaalsContact O-N 3.07Å; T70-N73 PolarHBondContact O-OD1 2.98Å; T70-N73 PolarHBondContact OG1-N 3.2Å; T70-N73 PolarHBondContact OG1-ND2 3.29Å; T70-N73 PolarHBondContact OG1-OD1 2.95Å; N73-N75 PolarHBondContact O-N 3.5Å; N73-Q76 WeakPolarHBondContact O-CA 3.32Å; N73-Q76 WeakPolarHBondContact O-CB 3.37Å; N73-Q76 PolarHBondContact O-N 2.98Å; N73-Q77 HydrophobicContact CB-CG 4.29Å; N73-Q77 PolarHBondContact ND2-NE2 3.09Å; N73-Q77 WeakPolarHBondContact O-CG 3.46Å; N73-Q77 PolarHBondContact O-N 2.95Å; N73-Q77 WeakPolarHBondContact OD1-CG 3.47Å
74	R	90	Very high	93.2	Very high	118 Å²	118	66.5 Å²	66.5	45%	0.445	34%	0.339	S	S	.	.	H	α-helix	trans	-37.5	-61.1	-179.8	-84.8	174.4	172.7	-155	-5.5	114.1	D16 V69 T70 Q76 Q77 L78	D16-R74 IonicContact OD2-CZ 3.73Å; D16-R74 IonicContact OD2-NH2 2.78Å; D16-R74 PolarHBondContact OD2-NH2 2.84Å; V69-R74 HydrophobicContact CG1-CB 4.22Å; V69-R74 HydrophobicContact CG1-CG 3.21Å; T70-R74 PolarHBondContact O-N 3.2Å; R74-Q76 VanDerWaalsContact C-N 3.33Å; R74-Q76 PolarHBondContact O-N 2.77Å; R74-Q77 PolarHBondContact O-N 2.78Å; R74-L78 PolarHBondContact O-N 3.46Å
75	N	93.3	Very high	93.2	Very high	134 Å²	134	65.9 Å²	65.9	72%	0.717	34%	0.335	S	S	*	.	H	α-helix	trans	-65.5	-35	-178.1	-67.7	-31.6	0	0	0	113.1	N73 R79	N73-N75 PolarHBondContact O-N 3.5Å; N75-R79 PolarHBondContact O-N 3.29Å
76	Q	93.9	Very high	93.2	Very high	113 Å²	113	69.9 Å²	69.9	53%	0.528	36%	0.356	S	S	.	.	H	α-helix	trans	-66.2	-40.9	176.6	-174.5	-175.4	3.7	0	0	110.9	N73 R74 R79 K80	N73-Q76 WeakPolarHBondContact O-CA 3.32Å; N73-Q76 WeakPolarHBondContact O-CB 3.37Å; N73-Q76 PolarHBondContact O-N 2.98Å; R74-Q76 VanDerWaalsContact C-N 3.33Å; R74-Q76 PolarHBondContact O-N 2.77Å; Q76-R79 PolarHBondContact O-N 2.96Å; Q76-K80 WeakPolarHBondContact O-CG 3.5Å; Q76-K80 PolarHBondContact O-N 2.81Å
77	Q	93.6	Very high	93.2	Very high	8 Å²	8	71.6 Å²	71.6	4%	0.037	37%	0.368	C	S	.	.	H	α-helix	trans	-69.8	-39.5	179.1	-64.3	-66.8	-6.4	0	0	111.9	T49 A67 P68 V69 N73 R74 R79 K80 L81	T49-Q77 PolarHBondContact OG1-NE2 3.03Å; T49-Q77 PolarHBondContact OG1-OE1 2.83Å; A67-Q77 HydrophobicContact CB-CB 4.26Å; P68-Q77 WeakPolarHBondContact O-CG 3.32Å; P68-Q77 PolarHBondContact O-NE2 2.94Å; V69-Q77 HydrophobicContact CG2-CB 4.13Å; V69-Q77 HydrophobicContact CG2-CG 4.46Å; N73-Q77 HydrophobicContact CB-CG 4.29Å; N73-Q77 PolarHBondContact ND2-NE2 3.09Å; N73-Q77 WeakPolarHBondContact O-CG 3.46Å; N73-Q77 PolarHBondContact O-N 2.95Å; N73-Q77 WeakPolarHBondContact OD1-CG 3.47Å; R74-Q77 PolarHBondContact O-N 2.78Å; Q77-R79 VanDerWaalsContact C-N 3.32Å; Q77-R79 PolarHBondContact O-N 3.46Å; Q77-K80 PolarHBondContact O-N 3.47Å; Q77-L81 WeakPolarHBondContact O-CB 3.46Å; Q77-L81 PolarHBondContact O-N 2.88Å
78	L	93.9	Very high	93.2	Very high	77 Å²	77	72 Å²	72	40%	0.403	37%	0.37	S	S	.	.	H	α-helix	trans	-58.7	-42.9	170.3	-74.5	173.1	0	0	0	112.2	H18 R74 K80 L81 R82	H18-L78 HydrophobicContact CB-CD2 4.17Å; H18-L78 VanDerWaalsContact CD2-CD2 3.43Å; H18-L78 WeakPolarHBondContact CD2-CD2 3.06Å; H18-L78 VanDerWaalsContact CD2-CG 3.49Å; H18-L78 WeakPolarHBondContact CD2-CG 3.41Å; H18-L78 WeakPolarHBondContact NE2-CG 3.36Å; R74-L78 PolarHBondContact O-N 3.46Å; L78-K80 VanDerWaalsContact C-N 3.33Å; L78-K80 PolarHBondContact O-N 3.2Å; L78-L81 PolarHBondContact O-N 2.92Å; L78-R82 WeakPolarHBondContact O-CB 3.38Å; L78-R82 PolarHBondContact O-N 3.13Å
79	R	94.7	Very high	93.4	Very high	166 Å²	166	72 Å²	72	63%	0.626	37%	0.366	S	S	*	.	H	α-helix	trans	-61.3	-43.3	176.4	178.7	177.8	174.9	176.5	0.2	111.4	N75 Q76 Q77 I83	N75-R79 PolarHBondContact O-N 3.29Å; Q76-R79 PolarHBondContact O-N 2.96Å; Q77-R79 VanDerWaalsContact C-N 3.32Å; Q77-R79 PolarHBondContact O-N 3.46Å; R79-I83 HydrophobicContact CG-CD1 4.06Å; R79-I83 WeakPolarHBondContact O-CD1 3.47Å; R79-I83 VanDerWaalsContact O-CG1 3.27Å; R79-I83 WeakPolarHBondContact O-CG1 3.38Å; R79-I83 PolarHBondContact O-N 2.91Å; R79-I83 VanDerWaalsContact O-N 3.12Å
80	K	94	Very high	93.6	Very high	53 Å²	53	76.3 Å²	76.3	23%	0.23	39%	0.389	C	S	.	.	H	α-helix	trans	-66	-44	177.5	-71.6	-176.3	178.7	-165.1	0	111.8	T49 V50 Q76 Q77 L78 R82 I83 A84	T49-K80 WeakPolarHBondContact OG1-CD 3.42Å; T49-K80 PolarHBondContact OG1-NZ 2.68Å; V50-K80 HydrophobicContact CG2-CB 3.83Å; Q76-K80 WeakPolarHBondContact O-CG 3.5Å; Q76-K80 PolarHBondContact O-N 2.81Å; Q77-K80 PolarHBondContact O-N 3.47Å; L78-K80 VanDerWaalsContact C-N 3.33Å; L78-K80 PolarHBondContact O-N 3.2Å; K80-R82 VanDerWaalsContact C-N 3.34Å; K80-R82 PolarHBondContact O-N 3.39Å; K80-I83 PolarHBondContact O-N 2.96Å; K80-I83 VanDerWaalsContact O-N 3.14Å; K80-A84 PolarHBondContact O-N 3.45Å
81	L	94.8	Very high	93.8	Very high	14 Å²	14	77.2 Å²	77.2	7%	0.073	39%	0.388	C	S	.	.	H	α-helix	trans	-55.5	-49.7	175.3	-178.9	64	0	0	0	110.8	H18 L20 V50 F65 A67 Q77 L78 I83 A84 V85	H18-L81 HydrophobicContact CB-CD2 3.73Å; L20-L81 HydrophobicContact CB-CD2 4.4Å; V50-L81 HydrophobicContact CG1-CD1 3.95Å; F65-L81 HydrophobicContact CB-CD1 3.38Å; F65-L81 HydrophobicContact CG-CD1 4.27Å; A67-L81 HydrophobicContact CB-CB 4.26Å; Q77-L81 WeakPolarHBondContact O-CB 3.46Å; Q77-L81 PolarHBondContact O-N 2.88Å; L78-L81 PolarHBondContact O-N 2.92Å; L81-I83 VanDerWaalsContact C-N 3.31Å; L81-I83 PolarHBondContact O-N 2.71Å; L81-A84 PolarHBondContact O-N 2.92Å; L81-V85 HydrophobicContact CD1-CG2 4.2Å; L81-V85 HydrophobicContact CG-CG2 4.4Å; L81-V85 WeakPolarHBondContact O-CG2 3.38Å; L81-V85 PolarHBondContact O-N 3.36Å
82	R	95.9	Very high	94.2	Very high	150 Å²	150	71 Å²	71	57%	0.566	35%	0.35	S	S	*	.	H	α-helix	trans	-56.8	-43.1	175.9	-176	-169.5	68.4	-178.4	4	112.7	L78 K80 N86	L78-R82 WeakPolarHBondContact O-CB 3.38Å; L78-R82 PolarHBondContact O-N 3.13Å; K80-R82 VanDerWaalsContact C-N 3.34Å; K80-R82 PolarHBondContact O-N 3.39Å; R82-N86 WeakPolarHBondContact O-CB 3.44Å; R82-N86 VanDerWaalsContact O-CG 3.28Å; R82-N86 PolarHBondContact O-N 2.88Å
83	I	94.9	Very high	94.5	Very high	91 Å²	91	69.6 Å²	69.6	47%	0.467	33%	0.333	S	S	.	.	H	α-helix	trans	-64.4	-45.9	179	-69.1	163.7	0	0	0	110.7	R79 K80 L81 N86 S87	R79-I83 HydrophobicContact CG-CD1 4.06Å; R79-I83 WeakPolarHBondContact O-CD1 3.47Å; R79-I83 VanDerWaalsContact O-CG1 3.27Å; R79-I83 WeakPolarHBondContact O-CG1 3.38Å; R79-I83 PolarHBondContact O-N 2.91Å; R79-I83 VanDerWaalsContact O-N 3.12Å; K80-I83 PolarHBondContact O-N 2.96Å; K80-I83 VanDerWaalsContact O-N 3.14Å; L81-I83 VanDerWaalsContact C-N 3.31Å; L81-I83 PolarHBondContact O-N 2.71Å; I83-N86 PolarHBondContact O-N 3.33Å; I83-S87 WeakPolarHBondContact O-CB 3.33Å; I83-S87 PolarHBondContact O-N 2.88Å
84	A	93.5	Very high	94.8	Very high	9 Å²	9	73 Å²	73	7%	0.074	35%	0.351	C	S	.	.	H	α-helix	trans	-61.9	-47.2	179.3	0	0	0	0	0	111.6	V50 F65 K80 L81 N86 S87 W88	V50-A84 HydrophobicContact CB-CB 4.04Å; V50-A84 HydrophobicContact CG1-CB 3.89Å; V50-A84 HydrophobicContact CG2-CB 4.18Å; F65-A84 HydrophobicContact CD1-CB 4.19Å; F65-A84 HydrophobicContact CE1-CB 4.35Å; K80-A84 PolarHBondContact O-N 3.45Å; L81-A84 PolarHBondContact O-N 2.92Å; A84-N86 PolarHBondContact O-N 3.4Å; A84-S87 PolarHBondContact O-N 2.85Å; A84-W88 WeakPolarHBondContact O-CB 3.38Å; A84-W88 PolarHBondContact O-N 3.24Å
85	V	95.5	Very high	95.1	Very high	13 Å²	13	68.3 Å²	68.3	8%	0.079	34%	0.335	C	S	.	.	H	α-helix	trans	-61.3	-45.1	179.1	173.8	0	0	0	0	111.4	L20 V22 F65 L81 W88 L89	L20-V85 HydrophobicContact CD2-CB 4.38Å; L20-V85 HydrophobicContact CD2-CG1 3.95Å; L20-V85 HydrophobicContact CD2-CG2 3.63Å; V22-V85 HydrophobicContact CG2-CG1 4.27Å; F65-V85 HydrophobicContact CB-CG2 4.39Å; F65-V85 HydrophobicContact CD1-CG2 3.86Å; F65-V85 HydrophobicContact CD2-CG2 3.77Å; F65-V85 HydrophobicContact CE1-CG2 4.03Å; F65-V85 HydrophobicContact CE2-CG2 3.93Å; F65-V85 HydrophobicContact CG-CG2 3.75Å; F65-V85 HydrophobicContact CZ-CB 4.43Å; F65-V85 HydrophobicContact CZ-CG2 4.06Å; L81-V85 HydrophobicContact CD1-CG2 4.2Å; L81-V85 HydrophobicContact CG-CG2 4.4Å; L81-V85 WeakPolarHBondContact O-CG2 3.38Å; L81-V85 PolarHBondContact O-N 3.36Å; V85-W88 PolarHBondContact O-N 3.26Å; V85-L89 HydrophobicContact CG1-CD1 4.11Å; V85-L89 WeakPolarHBondContact O-CG 3.36Å; V85-L89 PolarHBondContact O-N 3.41Å
86	N	96.1	Very high	95.2	Very high	83 Å²	83	63.9 Å²	63.9	44%	0.444	32%	0.315	S	S	.	.	H	α-helix	trans	-63.4	-45.4	177.4	-74.8	1.3	0	0	0	111.6	R82 I83 A84 W88 L89 D90	R82-N86 WeakPolarHBondContact O-CB 3.44Å; R82-N86 VanDerWaalsContact O-CG 3.28Å; R82-N86 PolarHBondContact O-N 2.88Å; I83-N86 PolarHBondContact O-N 3.33Å; A84-N86 PolarHBondContact O-N 3.4Å; N86-W88 VanDerWaalsContact C-N 3.28Å; N86-W88 PolarHBondContact O-N 2.89Å; N86-L89 PolarHBondContact O-N 2.9Å; N86-D90 VanDerWaalsContact O-CG 3.26Å; N86-D90 PolarHBondContact O-N 2.9Å
87	S	93.4	Very high	95.3	Very high	53 Å²	53	64.1 Å²	64.1	37%	0.371	32%	0.316	S	S	.	.	H	α-helix	trans	-60	-39.9	177.6	-171.3	0	0	0	0	112	I83 A84 H91	I83-S87 WeakPolarHBondContact O-CB 3.33Å; I83-S87 PolarHBondContact O-N 2.88Å; A84-S87 PolarHBondContact O-N 2.85Å; S87-H91 PolarHBondContact O-N 3.35Å; S87-H91 PolarHBondContact O-ND1 2.63Å
88	W	94.9	Very high	95.5	Very high	9 Å²	9	67 Å²	67	3%	0.034	33%	0.334	C	S	.	.	H	α-helix	trans	-66.4	-43.4	176.1	179.9	85.9	0	0	0	111.8	V22 V24 L54 L61 C63 F65 A84 V85 N86 D90 H91 V92	V22-W88 HydrophobicContact CB-CH2 4.42Å; V22-W88 HydrophobicContact CB-CZ3 3.89Å; V22-W88 HydrophobicContact CG1-CH2 4.34Å; V22-W88 HydrophobicContact CG1-CZ3 3.68Å; V24-W88 HydrophobicContact CG2-CH2 3.98Å; V24-W88 HydrophobicContact CG2-CZ3 4.17Å; L54-W88 HydrophobicContact CD1-CZ2 4.04Å; L61-W88 HydrophobicContact CD2-CH2 4.47Å; L61-W88 HydrophobicContact CD2-CZ2 3.85Å; L61-W88 HydrophobicContact CG-CZ2 4.21Å; C63-W88 HydrophobicContact CB-CD2 3.95Å; C63-W88 HydrophobicContact CB-CE3 4.42Å; C63-W88 HydrophobicContact CB-CH2 3.9Å; C63-W88 HydrophobicContact CB-CZ2 3.35Å; C63-W88 HydrophobicContact CB-CZ3 4.4Å; F65-W88 HydrophobicContact CE1-CB 4Å; F65-W88 HydrophobicContact CE1-CG 4.35Å; F65-W88 HydrophobicContact CE2-CE3 4.43Å; F65-W88 HydrophobicContact CZ-CB 3.65Å; F65-W88 AromaticContact CZ-CD2 3.89Å; F65-W88 HydrophobicContact CZ-CD2 3.89Å; F65-W88 HydrophobicContact CZ-CE3 4.1Å; F65-W88 AromaticContact CZ-CG 3.69Å; F65-W88 HydrophobicContact CZ-CG 3.69Å; A84-W88 WeakPolarHBondContact O-CB 3.38Å; A84-W88 PolarHBondContact O-N 3.24Å; V85-W88 PolarHBondContact O-N 3.26Å; N86-W88 VanDerWaalsContact C-N 3.28Å; N86-W88 PolarHBondContact O-N 2.89Å; W88-D90 VanDerWaalsContact C-N 3.35Å; W88-D90 PolarHBondContact O-N 3.07Å; W88-H91 PolarHBondContact O-N 2.72Å; W88-V92 HydrophobicContact CD2-CG2 3.82Å; W88-V92 HydrophobicContact CE3-CG2 3.94Å; W88-V92 HydrophobicContact CH2-CG2 3.72Å; W88-V92 HydrophobicContact CZ2-CG2 3.57Å; W88-V92 HydrophobicContact CZ3-CG2 3.89Å; W88-V92 WeakPolarHBondContact O-CG2 3.43Å; W88-V92 PolarHBondContact O-N 2.94Å
89	L	96.9	Very high	95.6	Very high	58 Å²	58	64.3 Å²	64.3	30%	0.304	32%	0.32	S	S	.	.	H	α-helix	trans	-61.7	-40.7	175.9	-74.9	171.4	0	0	0	112.3	V22 V85 N86 H91 V92 I93	V22-L89 HydrophobicContact CG1-CD2 4.3Å; V85-L89 HydrophobicContact CG1-CD1 4.11Å; V85-L89 WeakPolarHBondContact O-CG 3.36Å; V85-L89 PolarHBondContact O-N 3.41Å; N86-L89 PolarHBondContact O-N 2.9Å; L89-H91 VanDerWaalsContact C-N 3.27Å; L89-H91 PolarHBondContact O-N 2.91Å; L89-V92 PolarHBondContact O-N 2.84Å; L89-I93 VanDerWaalsContact O-CG1 3.3Å; L89-I93 WeakPolarHBondContact O-CG1 3.2Å; L89-I93 PolarHBondContact O-N 2.87Å
90	D	96.7	Very high	95.5	Very high	105 Å²	105	61.5 Å²	61.5	56%	0.561	33%	0.325	S	S	*	.	H	α-helix	trans	-58.5	-41	175.5	-67.2	-27.6	0	0	0	111	N86 W88 L94	N86-D90 VanDerWaalsContact O-CG 3.26Å; N86-D90 PolarHBondContact O-N 2.9Å; W88-D90 VanDerWaalsContact C-N 3.35Å; W88-D90 PolarHBondContact O-N 3.07Å; D90-L94 PolarHBondContact O-N 2.86Å; D90-L94 VanDerWaalsContact O-N 3.13Å
91	H	95.1	Very high	95.4	Very high	88 Å²	88	62.2 Å²	62.2	41%	0.407	34%	0.341	S	S	.	.	H	α-helix	trans	-70.8	-38.7	175.6	-59.9	158.9	0	0	0	113	L39 S87 W88 L89 I93 L94 V95	L39-H91 HydrophobicContact CD2-CB 3.43Å; L39-H91 VanDerWaalsContact CD2-CB 3.43Å; S87-H91 PolarHBondContact O-N 3.35Å; S87-H91 PolarHBondContact O-ND1 2.63Å; W88-H91 PolarHBondContact O-N 2.72Å; L89-H91 VanDerWaalsContact C-N 3.27Å; L89-H91 PolarHBondContact O-N 2.91Å; H91-I93 VanDerWaalsContact C-N 3.3Å; H91-I93 PolarHBondContact O-N 3.45Å; H91-L94 PolarHBondContact O-N 2.98Å; H91-V95 WeakPolarHBondContact O-CG2 3.06Å; H91-V95 PolarHBondContact O-N 2.94Å
92	V	96.4	Very high	95.4	Very high	5 Å²	5	69.2 Å²	69.2	3%	0.03	37%	0.371	C	S	.	.	H	α-helix	trans	-61.1	-42	175	171.5	0	0	0	0	110.6	V24 L39 L61 W88 L89 V95 S96	V24-V92 HydrophobicContact CB-CG1 4.37Å; V24-V92 HydrophobicContact CG1-CG1 3.98Å; V24-V92 HydrophobicContact CG2-CG1 4.2Å; L39-V92 HydrophobicContact CD1-CG2 3.59Å; L61-V92 HydrophobicContact CD2-CG2 4.25Å; W88-V92 HydrophobicContact CD2-CG2 3.82Å; W88-V92 HydrophobicContact CE3-CG2 3.94Å; W88-V92 HydrophobicContact CH2-CG2 3.72Å; W88-V92 HydrophobicContact CZ2-CG2 3.57Å; W88-V92 HydrophobicContact CZ3-CG2 3.89Å; W88-V92 WeakPolarHBondContact O-CG2 3.43Å; W88-V92 PolarHBondContact O-N 2.94Å; L89-V92 PolarHBondContact O-N 2.84Å; V92-V95 PolarHBondContact O-N 3.23Å; V92-S96 VanDerWaalsContact O-CB 3.32Å; V92-S96 WeakPolarHBondContact O-CB 3.37Å; V92-S96 PolarHBondContact O-N 2.85Å; V92-S96 PolarHBondContact O-OG 3.4Å
93	I	97	Very high	94.9	Very high	87 Å²	87	63.7 Å²	63.7	45%	0.446	36%	0.361	S	S	.	.	H	α-helix	trans	-58.7	-50.9	174.9	-69.4	164.7	0	0	0	110.1	L89 H91 V95 S96 E97	L89-I93 VanDerWaalsContact O-CG1 3.3Å; L89-I93 WeakPolarHBondContact O-CG1 3.2Å; L89-I93 PolarHBondContact O-N 2.87Å; H91-I93 VanDerWaalsContact C-N 3.3Å; H91-I93 PolarHBondContact O-N 3.45Å; I93-V95 VanDerWaalsContact C-N 3.33Å; I93-V95 PolarHBondContact O-N 3.34Å; I93-S96 WeakPolarHBondContact O-CB 3.46Å; I93-S96 PolarHBondContact O-N 2.86Å; I93-S96 VanDerWaalsContact O-N 3.07Å; I93-E97 HydrophobicContact CG2-CG 4.33Å; I93-E97 WeakPolarHBondContact O-CG 3.31Å; I93-E97 PolarHBondContact O-N 2.89Å
94	L	96.7	Very high	94.1	Very high	100 Å²	100	64.4 Å²	64.4	52%	0.524	37%	0.37	S	S	.	.	H	α-helix	trans	-56.5	-45.4	178.5	176.2	64.4	0	0	0	112.7	D90 H91 S96 E97 T98	D90-L94 PolarHBondContact O-N 2.86Å; D90-L94 VanDerWaalsContact O-N 3.13Å; H91-L94 PolarHBondContact O-N 2.98Å; L94-S96 VanDerWaalsContact C-N 3.32Å; L94-E97 PolarHBondContact O-N 3.21Å; L94-T98 WeakPolarHBondContact O-CB 3.4Å; L94-T98 PolarHBondContact O-N 3.27Å; L94-T98 PolarHBondContact O-OG1 3.29Å
95	V	96	Very high	92.7	Very high	19 Å²	19	69.4 Å²	69.4	12%	0.115	39%	0.394	C	S	.	.	H	α-helix	trans	-64.1	-41	177.2	169.3	0	0	0	0	110.8	A35 L39 H91 V92 I93 T98 I99	A35-V95 HydrophobicContact CB-CG1 3.66Å; L39-V95 HydrophobicContact CD2-CG2 4.01Å; L39-V95 HydrophobicContact CG-CG2 4.29Å; H91-V95 WeakPolarHBondContact O-CG2 3.06Å; H91-V95 PolarHBondContact O-N 2.94Å; V92-V95 PolarHBondContact O-N 3.23Å; I93-V95 VanDerWaalsContact C-N 3.33Å; I93-V95 PolarHBondContact O-N 3.34Å; V95-T98 WeakPolarHBondContact O-CB 3.16Å; V95-T98 PolarHBondContact O-N 3.49Å; V95-I99 HydrophobicContact CG1-CD1 3.85Å; V95-I99 HydrophobicContact CG1-CG1 4.45Å; V95-I99 WeakPolarHBondContact O-CG1 3.4Å; V95-I99 PolarHBondContact O-N 2.87Å
96	S	95.9	Very high	90.9	Very high	41 Å²	41	72.7 Å²	72.7	29%	0.287	41%	0.411	S	S	.	.	H	α-helix	trans	-65.6	-42	179.2	-56.1	0	0	0	0	111.5	V92 I93 L94 T98 I99 S100	V92-S96 VanDerWaalsContact O-CB 3.32Å; V92-S96 WeakPolarHBondContact O-CB 3.37Å; V92-S96 PolarHBondContact O-N 2.85Å; V92-S96 PolarHBondContact O-OG 3.4Å; I93-S96 WeakPolarHBondContact O-CB 3.46Å; I93-S96 PolarHBondContact O-N 2.86Å; I93-S96 VanDerWaalsContact O-N 3.07Å; L94-S96 VanDerWaalsContact C-N 3.32Å; S96-T98 VanDerWaalsContact C-N 3.34Å; S96-I99 PolarHBondContact O-N 3.05Å; S96-S100 WeakPolarHBondContact O-CB 3.29Å; S96-S100 PolarHBondContact O-N 3.33Å
97	E	96.7	Very high	89	Confident	118 Å²	118	73.8 Å²	73.8	55%	0.551	43%	0.425	S	S	*	.	H	α-helix	trans	-62.2	-40.8	172.5	-71.3	176.2	168	0	0	111.5	I93 L94 S100 A101	I93-E97 HydrophobicContact CG2-CG 4.33Å; I93-E97 WeakPolarHBondContact O-CG 3.31Å; I93-E97 PolarHBondContact O-N 2.89Å; L94-E97 PolarHBondContact O-N 3.21Å; E97-S100 PolarHBondContact O-N 2.93Å; E97-A101 WeakPolarHBondContact O-CB 3.26Å; E97-A101 PolarHBondContact O-N 2.99Å
98	T	96.6	Very high	87.1	Confident	69 Å²	69	75.7 Å²	75.7	42%	0.423	44%	0.439	S	S	.	.	H	α-helix	trans	-64.3	-44.5	176.8	-57.3	0	0	0	0	111.5	L94 V95 S96 S100 A101 F102	L94-T98 WeakPolarHBondContact O-CB 3.4Å; L94-T98 PolarHBondContact O-N 3.27Å; L94-T98 PolarHBondContact O-OG1 3.29Å; V95-T98 WeakPolarHBondContact O-CB 3.16Å; V95-T98 PolarHBondContact O-N 3.49Å; S96-T98 VanDerWaalsContact C-N 3.34Å; T98-S100 VanDerWaalsContact C-N 3.33Å; T98-A101 PolarHBondContact O-N 3.46Å; T98-F102 HydrophobicContact CG2-CD2 4.09Å; T98-F102 WeakPolarHBondContact O-CD2 3.49Å; T98-F102 PolarHBondContact O-N 3.37Å
99	I	95.3	Very high	85.2	Confident	20 Å²	20	82.1 Å²	82.1	10%	0.103	47%	0.467	C	S	.	.	H	α-helix	trans	-63.7	-39.9	174.3	-69.9	168.4	0	0	0	110.3	F26 F31 V34 V95 S96 A101 G103	F26-I99 HydrophobicContact CD1-CD1 4.14Å; F26-I99 HydrophobicContact CE1-CD1 3.89Å; F31-I99 HydrophobicContact CB-CD1 4.2Å; F31-I99 HydrophobicContact CB-CG2 4.27Å; F31-I99 HydrophobicContact CD1-CG2 3.87Å; F31-I99 HydrophobicContact CD2-CG2 3.48Å; F31-I99 VanDerWaalsContact CD2-CG2 3.48Å; F31-I99 HydrophobicContact CE1-CG2 3.98Å; F31-I99 HydrophobicContact CE2-CG2 3.61Å; F31-I99 HydrophobicContact CG-CG2 3.62Å; F31-I99 HydrophobicContact CZ-CG2 3.85Å; V34-I99 HydrophobicContact CG1-CD1 4.27Å; V34-I99 HydrophobicContact CG1-CG1 4.41Å; V95-I99 HydrophobicContact CG1-CD1 3.85Å; V95-I99 HydrophobicContact CG1-CG1 4.45Å; V95-I99 WeakPolarHBondContact O-CG1 3.4Å; V95-I99 PolarHBondContact O-N 2.87Å; S96-I99 PolarHBondContact O-N 3.05Å; I99-A101 VanDerWaalsContact C-N 3.34Å; I99-A101 PolarHBondContact O-N 3.07Å; I99-G103 WeakPolarHBondContact O-CA 3.36Å; I99-G103 PolarHBondContact O-N 2.83Å
100	S	92.5	Very high	83	Confident	106 Å²	106	84.7 Å²	84.7	74%	0.741	49%	0.485	S	S	*	.	H	α-helix	trans	-65.2	-37.9	176.9	-176.4	0	0	0	0	112.4	S96 E97 T98	S96-S100 WeakPolarHBondContact O-CB 3.29Å; S96-S100 PolarHBondContact O-N 3.33Å; E97-S100 PolarHBondContact O-N 2.93Å; T98-S100 VanDerWaalsContact C-N 3.33Å
101	A	93.7	Very high	81	Confident	68 Å²	68	83.6 Å²	83.6	56%	0.562	49%	0.486	S	S	*	.	H	α-helix	trans	-77.3	-35.3	-178.7	0	0	0	0	0	113.7	E97 T98 I99	E97-A101 WeakPolarHBondContact O-CB 3.26Å; E97-A101 PolarHBondContact O-N 2.99Å; T98-A101 PolarHBondContact O-N 3.46Å; I99-A101 VanDerWaalsContact C-N 3.34Å; I99-A101 PolarHBondContact O-N 3.07Å
102	F	93.6	Very high	79	Confident	162 Å²	162	86.8 Å²	86.8	71%	0.711	50%	0.501	S	S	*	.	H	α-helix	trans	-128.4	-6.9	-169.4	-56.9	-70.3	0	0	0	114.7	T98 T104	T98-F102 HydrophobicContact CG2-CD2 4.09Å; T98-F102 WeakPolarHBondContact O-CD2 3.49Å; T98-F102 PolarHBondContact O-N 3.37Å; F102-T104 VanDerWaalsContact C-N 3.31Å; F102-T104 PolarHBondContact O-N 3.2Å
103	G	85.8	Confident	76.9	Confident	33 Å²	33	96.8 Å²	96.8	34%	0.34	54%	0.538	S	S	.	.			trans	-75.2	79.9	180	0	0	0	0	0	111.1	I99 I105	I99-G103 WeakPolarHBondContact O-CA 3.36Å; I99-G103 PolarHBondContact O-N 2.83Å; G103-I105 PolarHBondContact O-N 2.59Å
104	T	78	Confident	75	Confident	107 Å²	107	97.3 Å²	97.3	66%	0.656	56%	0.556	S	S	*	*			trans	-75.3	115.3	168.7	51.8	0	0	0	0	109.1	F102 D106	F102-T104 VanDerWaalsContact C-N 3.31Å; F102-T104 PolarHBondContact O-N 3.2Å; T104-D106 PolarHBondContact O-N 3.31Å; T104-D106 VanDerWaalsContact O-N 3.07Å
105	I	63.6	Low	73.3	Confident	114 Å²	114	98.5 Å²	98.5	59%	0.585	56%	0.561	S	S	*	*			trans	-79.9	78.3	160.3	-51.9	174.4	0	0	0	105.6	F31 G103 S107	F31-I105 HydrophobicContact CE1-CG1 4.32Å; F31-I105 HydrophobicContact CE2-CD1 4.15Å; F31-I105 HydrophobicContact CE2-CG1 4.26Å; F31-I105 HydrophobicContact CZ-CD1 4.03Å; F31-I105 HydrophobicContact CZ-CG1 3.62Å; G103-I105 PolarHBondContact O-N 2.59Å; I105-S107 PolarHBondContact O-N 3.17Å
106	D	57.9	Low	71.5	Confident	82 Å²	82	104 Å²	104	44%	0.439	59%	0.59	S	S	.	*			trans	-70.6	83.8	173.9	-87.4	-2	0	0	0	108.7	T104 S108 F109	T104-D106 PolarHBondContact O-N 3.31Å; T104-D106 VanDerWaalsContact O-N 3.07Å; D106-S108 PolarHBondContact O-N 3.49Å; D106-F109 HydrophobicContact CB-CB 3.92Å; D106-F109 PolarHBondContact O-N 3.22Å
107	S	55.9	Low	69.5	Low	106 Å²	106	105 Å²	105	74%	0.741	61%	0.606	S	S	*	*	G	3₁₀ helix	trans	-62.5	-18.7	160.2	53.9	0	0	0	0	111.2	I105	I105-S107 PolarHBondContact O-N 3.17Å
108	S	54	Low	67.4	Low	93 Å²	93	112.8 Å²	112.8	65%	0.65	64%	0.639	S	S	*	*	G	3₁₀ helix	trans	-91.1	-2.7	-179.1	56.4	0	0	0	0	115.3	D106 T110	D106-S108 PolarHBondContact O-N 3.49Å; S108-T110 PolarHBondContact O-N 3.46Å
109	F	56.1	Low	65.9	Low	144 Å²	144	115 Å²	115	63%	0.632	65%	0.649	S	S	*	*	G	3₁₀ helix	trans	-78.4	2	175.6	-143.7	-96.3	0	0	0	113.6	D106 S111	D106-F109 HydrophobicContact CB-CB 3.92Å; D106-F109 PolarHBondContact O-N 3.22Å; F109-S111 PolarHBondContact O-N 2.78Å
110	T	49.8	Very low	64.3	Low	111 Å²	111	119.9 Å²	119.9	68%	0.681	68%	0.678	S	S	*	*	S	Bend	trans	-93.2	102.9	-178.5	-43.5	0	0	0	0	110.1	S108	S108-T110 PolarHBondContact O-N 3.46Å
111	S	55.2	Low	62.8	Low	82 Å²	82	120.7 Å²	120.7	57%	0.573	68%	0.675	S	S	*	*	S	Bend	trans	97.4	-39	161.4	-41.3	0	0	0	0	119.6	F109 I115	F109-S111 PolarHBondContact O-N 2.78Å; S111-I115 WeakPolarHBondContact O-CD1 3.38Å; S111-I115 WeakPolarHBondContact O-CG1 2.98Å
112	E	53.1	Low	61	Low	155 Å²	155	123.8 Å²	123.8	72%	0.724	68%	0.681	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.9	-26.7	-167.7	-106.5	179.9	172.3	0	0	116.1
113	R	51.8	Low	58.9	Low	215 Å²	215	121.4 Å²	121.4	81%	0.811	68%	0.679	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.2	-13	176.9	-82.1	-173.7	171.1	179.9	-1.2	114.8	I115	R113-I115 VanDerWaalsContact C-N 3.31Å
114	A	57	Low	57.1	Low	99 Å²	99	127.3 Å²	127.3	82%	0.818	70%	0.702	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.5	-14.8	173.8	0	0	0	0	0	112.9
115	I	60.9	Low	55.6	Low	125 Å²	125	128.8 Å²	128.8	64%	0.641	71%	0.705	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101	-20.8	-175.5	-5.7	178.7	0	0	0	113.3	S111 R113	S111-I115 WeakPolarHBondContact O-CD1 3.38Å; S111-I115 WeakPolarHBondContact O-CG1 2.98Å; R113-I115 VanDerWaalsContact C-N 3.31Å
116	N	58.7	Low	55	Low	135 Å²	135	129.9 Å²	129.9	72%	0.722	71%	0.714	S	S	*	*			trans	-123	29.5	-172.8	-67.1	-27	0	0	0	114	F118	N116-F118 VanDerWaalsContact C-N 3.32Å; N116-F118 PolarHBondContact O-N 3.26Å
117	G	53.7	Low	54.8	Low	60 Å²	60	133.9 Å²	133.9	62%	0.619	74%	0.737	S	S	*	*			trans	-85	63	175.4	0	0	0	0	0	113.4
118	F	51.2	Low	54.7	Low	282 Å²	282	136.5 Å²	136.5	100%	1.237	74%	0.737	S	S	*	*			trans	-171	0	148.5	-92.3	-67.8	0	0	0	109	N116	N116-F118 VanDerWaalsContact C-N 3.32Å; N116-F118 PolarHBondContact O-N 3.26Å

Retrieved 118 of 118 residues in 22.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).