G4LYZ2_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession G4LYZ2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 73 aa.

						>G4LYZ2_SCHMA|G4LYZ2
MRTADRIMERCPPTGSCTIKHIQKEPTKDPVIKRLIVSVKPLTGAVARMQMGHRNIRRSPERPRFTSQMYRQH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.7	Low	69	Low	214 Å²	214	142.3 Å²	142.3	100%	1.054	69%	0.686	S	S	*	*				0	118.1	0	-127.1	-176.5	66.9	0	0	107.9
2	R	74.1	Confident	68.6	Low	213 Å²	213	138.7 Å²	138.7	80%	0.804	68%	0.683	S	S	*	*			trans	-77.9	138.7	-163.3	-79	176.6	-175.7	158.2	1.6	110.9	A4 D5	R2-A4 PolarHBondContact O-N 2.85Å; R2-D5 PolarHBondContact O-N 2.85Å
3	T	74.3	Confident	68.5	Low	100 Å²	100	137.7 Å²	137.7	61%	0.613	69%	0.693	S	S	*	*	T	Hydrogen-bonded Turn	trans	-49.1	-21.1	-180	-41.3	0	0	0	0	115	D5 R6	T3-D5 PolarHBondContact O-N 2.93Å; T3-R6 PolarHBondContact O-N 2.85Å
4	A	74.4	Confident	68.1	Low	57 Å²	57	137.4 Å²	137.4	47%	0.471	70%	0.702	S	S	.	*	H	α-helix	trans	-60.3	-40.1	178.7	0	0	0	0	0	113.7	R2 R6 I7	R2-A4 PolarHBondContact O-N 2.85Å; A4-R6 VanDerWaalsContact C-N 3.25Å; A4-R6 PolarHBondContact O-N 3.15Å; A4-I7 PolarHBondContact O-N 2.87Å; A4-I7 VanDerWaalsContact O-N 3.16Å
5	D	73.9	Confident	67.6	Low	83 Å²	83	132.3 Å²	132.3	44%	0.444	70%	0.698	S	S	.	*	H	α-helix	trans	-64.5	-35	-175.6	-56.2	-32.1	0	0	0	111.1	R2 T3 I7 E9	R2-D5 PolarHBondContact O-N 2.85Å; T3-D5 PolarHBondContact O-N 2.93Å; D5-I7 VanDerWaalsContact C-N 3.33Å; D5-I7 PolarHBondContact O-N 3.04Å; D5-E9 PolarHBondContact O-N 3.46Å
6	R	69.9	Low	67.5	Low	161 Å²	161	130.8 Å²	130.8	61%	0.608	70%	0.701	S	S	*	*	H	α-helix	trans	-70.5	-24.3	179.1	-71	175.3	61.6	-150.7	-1.7	114	T3 A4	T3-R6 PolarHBondContact O-N 2.85Å; A4-R6 VanDerWaalsContact C-N 3.25Å; A4-R6 PolarHBondContact O-N 3.15Å
7	I	69.4	Low	67.7	Low	122 Å²	122	129.5 Å²	129.5	63%	0.626	70%	0.703	S	S	*	*	H	α-helix	trans	-78.3	-38.5	-178.4	-64.7	172.3	0	0	0	110	A4 D5	A4-I7 PolarHBondContact O-N 2.87Å; A4-I7 VanDerWaalsContact O-N 3.16Å; D5-I7 VanDerWaalsContact C-N 3.33Å; D5-I7 PolarHBondContact O-N 3.04Å
8	M	68.9	Low	68	Low	152 Å²	152	128.5 Å²	128.5	75%	0.749	70%	0.702	S	S	*	*	H	α-helix	trans	-72.9	-28.6	179.4	-64.8	-171.5	-66.9	0	0	112.9
9	E	69.4	Low	68.5	Low	164 Å²	164	129.5 Å²	129.5	77%	0.766	71%	0.705	S	S	*	*	H	α-helix	trans	-75.1	-26.6	-175.9	-163.1	-175.7	176.6	0	0	113.8	D5	D5-E9 PolarHBondContact O-N 3.46Å
10	R	65.4	Low	69	Low	203 Å²	203	131.7 Å²	131.7	77%	0.766	71%	0.707	S	S	*	*	S	Bend	trans	-105.5	2.4	-165.7	-88	-172	172.4	-174.6	-2.4	117.1	P12	R10-P12 WeakPolarHBondContact O-CD 3.3Å
11	C	64.2	Low	69.6	Low	96 Å²	96	132.9 Å²	132.9	65%	0.649	71%	0.708	S	S	*	*			trans	-100	95.9	172.5	-75.1	0	0	0	0	109.4
12	P	64.8	Low	70.8	Confident	99 Å²	99	129.2 Å²	129.2	64%	0.643	69%	0.691	S	S	*	*			trans	-55.5	132.3	165.4	20.9	-27.3	0	0	0	106.9	R10 T14	R10-P12 WeakPolarHBondContact O-CD 3.3Å; P12-T14 VanDerWaalsContact C-N 3.29Å; P12-T14 WeakPolarHBondContact O-CA 3.48Å; P12-T14 PolarHBondContact O-N 3.3Å; P12-T14 PolarHBondContact O-OG1 3.46Å
13	P	67.2	Low	71.1	Confident	126 Å²	126	126.8 Å²	126.8	82%	0.818	69%	0.689	S	S	*	*			trans	-53.5	102.8	-178.2	21	-31.1	0	0	0	106.2	G15	P13-G15 WeakPolarHBondContact O-CA 3.35Å; P13-G15 PolarHBondContact O-N 3.27Å
14	T	62.8	Low	71.2	Confident	133 Å²	133	131.1 Å²	131.1	82%	0.816	70%	0.7	S	S	*	*			trans	-61.5	115.2	-167.3	-45	0	0	0	0	104.2	P12 S16	P12-T14 VanDerWaalsContact C-N 3.29Å; P12-T14 WeakPolarHBondContact O-CA 3.48Å; P12-T14 PolarHBondContact O-N 3.3Å; P12-T14 PolarHBondContact O-OG1 3.46Å; T14-S16 PolarHBondContact O-N 3.48Å
15	G	61.3	Low	71.4	Confident	62 Å²	62	136.3 Å²	136.3	64%	0.639	71%	0.714	S	S	*	*			trans	-42.8	134.6	-156.2	0	0	0	0	0	111.2	P13 C17	P13-G15 WeakPolarHBondContact O-CA 3.35Å; P13-G15 PolarHBondContact O-N 3.27Å; G15-C17 VanDerWaalsContact C-N 3.34Å; G15-C17 PolarHBondContact O-N 3.39Å
16	S	65.5	Low	71.4	Confident	108 Å²	108	137.2 Å²	137.2	76%	0.755	73%	0.725	S	S	*	*			trans	-37.6	99.9	-178.3	55.8	0	0	0	0	109.3	T14 T18	T14-S16 PolarHBondContact O-N 3.48Å; S16-T18 PolarHBondContact O-N 3.38Å; S16-T18 PolarHBondContact O-OG1 3.1Å
17	C	71.1	Confident	71.6	Confident	109 Å²	109	133.9 Å²	133.9	74%	0.736	72%	0.722	S	S	*	*			trans	-72.8	87.9	180	-175	0	0	0	0	104.5	G15 I19	G15-C17 VanDerWaalsContact C-N 3.34Å; G15-C17 PolarHBondContact O-N 3.39Å; C17-I19 PolarHBondContact O-N 3.25Å
18	T	73.1	Confident	72.2	Confident	111 Å²	111	137.8 Å²	137.8	68%	0.681	74%	0.735	S	S	*	*			trans	-71.9	90.5	174.9	-22.5	0	0	0	0	105.1	S16 K20	S16-T18 PolarHBondContact O-N 3.38Å; S16-T18 PolarHBondContact O-OG1 3.1Å; T18-K20 VanDerWaalsContact C-N 3.26Å; T18-K20 PolarHBondContact O-N 3.44Å
19	I	77.2	Confident	73.2	Confident	147 Å²	147	133.7 Å²	133.7	75%	0.754	72%	0.716	S	S	*	*			trans	-66.3	96.1	171.8	-60.8	174.9	0	0	0	105.5	C17 H21	C17-I19 PolarHBondContact O-N 3.25Å; I19-H21 PolarHBondContact O-N 3.33Å; I19-H21 VanDerWaalsContact O-N 3.16Å
20	K	79.3	Confident	74.3	Confident	173 Å²	173	130.1 Å²	130.1	75%	0.752	71%	0.707	S	S	*	*			trans	-65.6	117.2	176.5	-67.2	-176.1	-178.3	-179.5	0	107.6	T18 I22	T18-K20 VanDerWaalsContact C-N 3.26Å; T18-K20 PolarHBondContact O-N 3.44Å; K20-I22 HydrophobicContact CB-CG1 4.44Å; K20-I22 PolarHBondContact O-N 3.3Å
21	H	79.9	Confident	75.7	Confident	157 Å²	157	125.3 Å²	125.3	73%	0.727	70%	0.7	S	S	*	*			trans	-73.8	93.1	170.7	-176	70.6	0	0	0	108.8	I19 Q23	I19-H21 PolarHBondContact O-N 3.33Å; I19-H21 VanDerWaalsContact O-N 3.16Å; H21-Q23 WeakPolarHBondContact NE2-CG 3.41Å; H21-Q23 PolarHBondContact O-N 2.88Å
22	I	81.2	Confident	77	Confident	137 Å²	137	123.7 Å²	123.7	70%	0.703	68%	0.684	S	S	*	*			trans	-85.2	103.9	171.7	-57.5	174.4	0	0	0	107	K20 K24	K20-I22 HydrophobicContact CB-CG1 4.44Å; K20-I22 PolarHBondContact O-N 3.3Å; I22-K24 PolarHBondContact O-N 3.45Å; I22-K24 VanDerWaalsContact O-N 3.17Å
23	Q	79.7	Confident	78.3	Confident	163 Å²	163	126.2 Å²	126.2	76%	0.762	69%	0.685	S	S	*	*			trans	-66	112.8	166.8	-68.1	-173.1	78.7	0	0	107.4	H21	H21-Q23 WeakPolarHBondContact NE2-CG 3.41Å; H21-Q23 PolarHBondContact O-N 2.88Å
24	K	76.3	Confident	79.6	Confident	191 Å²	191	129.4 Å²	129.4	83%	0.83	68%	0.681	S	S	*	*	P	Polyproline II helix	trans	-68.1	149.9	169.2	-66.6	-165.5	174.7	-174.2	0	108.7	I22	I22-K24 PolarHBondContact O-N 3.45Å; I22-K24 VanDerWaalsContact O-N 3.17Å
25	E	78.9	Confident	81.1	Confident	166 Å²	166	128.2 Å²	128.2	78%	0.776	67%	0.668	S	S	*	*	P	Polyproline II helix	trans	-47.7	138.1	175.3	-79.7	-65.7	128.8	0	0	110.9	T27	E25-T27 PolarHBondContact O-N 2.95Å
26	P	74.4	Confident	82.7	Confident	102 Å²	102	129.2 Å²	129.2	66%	0.662	66%	0.658	S	S	*	*	P	Polyproline II helix	trans	-54.6	128	-179.2	22.2	-32.8	0	0	0	109.8	K28	P26-K28 PolarHBondContact O-N 2.93Å
27	T	74	Confident	84	Confident	90 Å²	90	128.4 Å²	128.4	55%	0.552	65%	0.648	S	S	*	*	P	Polyproline II helix	trans	-64.6	123.2	-173.9	-36.8	0	0	0	0	109.9	E25 D29 I32	E25-T27 PolarHBondContact O-N 2.95Å; T27-D29 HydrophobicContact CG2-CB 3.62Å; T27-D29 PolarHBondContact O-N 3.34Å; T27-I32 HydrophobicContact CG2-CD1 3.62Å
28	K	82.2	Confident	85.2	Confident	205 Å²	205	127.4 Å²	127.4	89%	0.891	64%	0.643	S	S	*	*			trans	-77.1	10.9	174.2	-61.8	-179.1	-177	176.8	0	112.8	P26	P26-K28 PolarHBondContact O-N 2.93Å
29	D	88.9	Confident	86.3	Confident	65 Å²	65	125.1 Å²	125.1	35%	0.348	63%	0.629	S	S	.	*			trans	-68.2	124.4	-176.7	-174.4	-40.9	0	0	0	109.7	T27 V31 I32 K33	T27-D29 HydrophobicContact CG2-CB 3.62Å; T27-D29 PolarHBondContact O-N 3.34Å; D29-V31 PolarHBondContact O-N 3.07Å; D29-V31 WeakPolarHBondContact OD1-CA 3.45Å; D29-V31 WeakPolarHBondContact OD1-CB 3.39Å; D29-V31 PolarHBondContact OD1-N 3.42Å; D29-I32 HydrophobicContact CB-CB 4.12Å; D29-I32 HydrophobicContact CB-CD1 3.94Å; D29-I32 HydrophobicContact CB-CG1 4Å; D29-I32 PolarHBondContact O-N 3Å; D29-K33 PolarHBondContact O-N 3.46Å
30	P	92.9	Very high	87.2	Confident	89 Å²	89	124.6 Å²	124.6	58%	0.578	62%	0.621	S	S	*	*	H	α-helix	trans	-60.6	-30.9	179.8	25	-34.2	0	0	0	113.2	R34	P30-R34 WeakPolarHBondContact O-CG 3.48Å; P30-R34 PolarHBondContact O-N 3.09Å
31	V	94	Very high	88	Confident	103 Å²	103	120.6 Å²	120.6	62%	0.624	61%	0.612	S	S	*	*	H	α-helix	trans	-68	-46.3	176.4	-177.8	0	0	0	0	110	D29 K33 R34 L35	D29-V31 PolarHBondContact O-N 3.07Å; D29-V31 WeakPolarHBondContact OD1-CA 3.45Å; D29-V31 WeakPolarHBondContact OD1-CB 3.39Å; D29-V31 PolarHBondContact OD1-N 3.42Å; V31-K33 VanDerWaalsContact C-N 3.31Å; V31-K33 PolarHBondContact O-N 2.9Å; V31-R34 PolarHBondContact O-N 2.91Å; V31-L35 WeakPolarHBondContact O-CB 3.34Å; V31-L35 PolarHBondContact O-N 3.02Å
32	I	91.9	Very high	88.7	Confident	61 Å²	61	118.3 Å²	118.3	31%	0.313	61%	0.605	S	S	.	*	H	α-helix	trans	-63.9	-40.9	177.4	-65.7	177	0	0	0	110.3	T27 D29 R34 L35 I36	T27-I32 HydrophobicContact CG2-CD1 3.62Å; D29-I32 HydrophobicContact CB-CB 4.12Å; D29-I32 HydrophobicContact CB-CD1 3.94Å; D29-I32 HydrophobicContact CB-CG1 4Å; D29-I32 PolarHBondContact O-N 3Å; I32-R34 PolarHBondContact O-N 3.28Å; I32-L35 PolarHBondContact O-N 3.14Å; I32-I36 HydrophobicContact CG2-CD1 3.79Å; I32-I36 HydrophobicContact CG2-CG1 4.3Å; I32-I36 WeakPolarHBondContact O-CB 3.25Å; I32-I36 VanDerWaalsContact O-CG1 3.3Å; I32-I36 WeakPolarHBondContact O-CG1 3.33Å; I32-I36 PolarHBondContact O-N 3.33Å
33	K	92.6	Very high	89.3	Confident	152 Å²	152	116.2 Å²	116.2	66%	0.661	60%	0.599	S	S	*	*	H	α-helix	trans	-60.3	-44.9	175.6	-170.7	175	-178.5	179.1	0	111.8	D29 V31 I36 V37	D29-K33 PolarHBondContact O-N 3.46Å; V31-K33 VanDerWaalsContact C-N 3.31Å; V31-K33 PolarHBondContact O-N 2.9Å; K33-I36 PolarHBondContact O-N 3.27Å; K33-V37 WeakPolarHBondContact O-CG2 3.3Å; K33-V37 PolarHBondContact O-N 3.1Å; K33-V37 VanDerWaalsContact O-N 3.1Å
34	R	94.6	Very high	90	Very high	194 Å²	194	109.9 Å²	109.9	73%	0.732	58%	0.577	S	S	*	*	H	α-helix	trans	-62.5	-44.7	175.5	-76.1	178	178.9	-131.1	1.5	111.4	P30 V31 I32 I36 V37 S38	P30-R34 WeakPolarHBondContact O-CG 3.48Å; P30-R34 PolarHBondContact O-N 3.09Å; V31-R34 PolarHBondContact O-N 2.91Å; I32-R34 PolarHBondContact O-N 3.28Å; R34-I36 PolarHBondContact O-N 3.46Å; R34-V37 PolarHBondContact O-N 2.94Å; R34-S38 PolarHBondContact O-N 3.42Å; R34-S38 PolarHBondContact O-OG 3.32Å; R34-S38 VanDerWaalsContact O-OG 3.1Å
35	L	94.9	Very high	90.8	Very high	107 Å²	107	102.5 Å²	102.5	56%	0.56	55%	0.552	S	S	*	*	H	α-helix	trans	-60.9	-46.7	178.4	-177.6	60.9	0	0	0	111.8	V31 I32 V37 S38 V39	V31-L35 WeakPolarHBondContact O-CB 3.34Å; V31-L35 PolarHBondContact O-N 3.02Å; I32-L35 PolarHBondContact O-N 3.14Å; L35-V37 VanDerWaalsContact C-N 3.29Å; L35-V37 PolarHBondContact O-N 3.48Å; L35-S38 WeakPolarHBondContact O-CB 3.44Å; L35-S38 PolarHBondContact O-N 2.97Å; L35-S38 VanDerWaalsContact O-N 3.09Å; L35-V39 HydrophobicContact CD1-CG1 4.1Å; L35-V39 WeakPolarHBondContact O-CG1 3.49Å; L35-V39 WeakPolarHBondContact O-CG2 3.35Å; L35-V39 PolarHBondContact O-N 3.03Å
36	I	93.2	Very high	91.4	Very high	84 Å²	84	97 Å²	97	43%	0.431	53%	0.529	S	S	.	.	H	α-helix	trans	-57	-44.5	176.3	-71.5	169.1	0	0	0	110.7	I32 K33 R34 S38 V39 K40	I32-I36 HydrophobicContact CG2-CD1 3.79Å; I32-I36 HydrophobicContact CG2-CG1 4.3Å; I32-I36 WeakPolarHBondContact O-CB 3.25Å; I32-I36 VanDerWaalsContact O-CG1 3.3Å; I32-I36 WeakPolarHBondContact O-CG1 3.33Å; I32-I36 PolarHBondContact O-N 3.33Å; K33-I36 PolarHBondContact O-N 3.27Å; R34-I36 PolarHBondContact O-N 3.46Å; I36-S38 VanDerWaalsContact C-N 3.34Å; I36-V39 WeakPolarHBondContact O-CG2 3.33Å; I36-V39 PolarHBondContact O-N 3.41Å; I36-K40 HydrophobicContact CG2-CD 4.33Å; I36-K40 HydrophobicContact CG2-CG 4.46Å; I36-K40 VanDerWaalsContact O-CG 3.3Å; I36-K40 WeakPolarHBondContact O-CG 3.49Å; I36-K40 PolarHBondContact O-N 3.39Å; I36-K40 VanDerWaalsContact O-N 3.09Å
37	V	94.6	Very high	92.3	Very high	90 Å²	90	94.8 Å²	94.8	55%	0.545	52%	0.52	S	S	.	.	H	α-helix	trans	-62.4	-42.7	176.8	171.8	0	0	0	0	110.9	K33 R34 L35 V39 P41	K33-V37 WeakPolarHBondContact O-CG2 3.3Å; K33-V37 PolarHBondContact O-N 3.1Å; K33-V37 VanDerWaalsContact O-N 3.1Å; R34-V37 PolarHBondContact O-N 2.94Å; L35-V37 VanDerWaalsContact C-N 3.29Å; L35-V37 PolarHBondContact O-N 3.48Å; V37-V39 PolarHBondContact O-N 3.24Å; V37-P41 VanDerWaalsContact O-CD 3.25Å; V37-P41 WeakPolarHBondContact O-CD 3.34Å
38	S	95	Very high	93	Very high	89 Å²	89	98.9 Å²	98.9	62%	0.622	53%	0.525	S	S	*	.	H	α-helix	trans	-66	-34.6	178.8	-60.9	0	0	0	0	113.7	R34 L35 I36	R34-S38 PolarHBondContact O-N 3.42Å; R34-S38 PolarHBondContact O-OG 3.32Å; R34-S38 VanDerWaalsContact O-OG 3.1Å; L35-S38 WeakPolarHBondContact O-CB 3.44Å; L35-S38 PolarHBondContact O-N 2.97Å; L35-S38 VanDerWaalsContact O-N 3.09Å; I36-S38 VanDerWaalsContact C-N 3.34Å
39	V	95.8	Very high	93.4	Very high	62 Å²	62	95.3 Å²	95.3	38%	0.376	51%	0.513	S	S	.	.	H	α-helix	trans	-87.1	-21.6	-177.9	-59	0	0	0	0	114	L35 I36 V37 L42 T43	L35-V39 HydrophobicContact CD1-CG1 4.1Å; L35-V39 WeakPolarHBondContact O-CG1 3.49Å; L35-V39 WeakPolarHBondContact O-CG2 3.35Å; L35-V39 PolarHBondContact O-N 3.03Å; I36-V39 WeakPolarHBondContact O-CG2 3.33Å; I36-V39 PolarHBondContact O-N 3.41Å; V37-V39 PolarHBondContact O-N 3.24Å; V39-L42 WeakPolarHBondContact O-CA 3.3Å; V39-L42 WeakPolarHBondContact O-CB 3.5Å; V39-L42 PolarHBondContact O-N 3.09Å; V39-T43 PolarHBondContact O-N 3.24Å; V39-T43 PolarHBondContact O-OG1 2.84Å
40	K	96.3	Very high	93.3	Very high	136 Å²	136	97.2 Å²	97.2	59%	0.591	52%	0.52	S	S	*	.	H	α-helix	trans	-52.2	-47.2	179.5	-90.2	174.8	178.2	-175.1	0	113.9	I36 L42 T43 G44	I36-K40 HydrophobicContact CG2-CD 4.33Å; I36-K40 HydrophobicContact CG2-CG 4.46Å; I36-K40 VanDerWaalsContact O-CG 3.3Å; I36-K40 WeakPolarHBondContact O-CG 3.49Å; I36-K40 PolarHBondContact O-N 3.39Å; I36-K40 VanDerWaalsContact O-N 3.09Å; K40-L42 VanDerWaalsContact C-N 3.3Å; K40-L42 PolarHBondContact O-N 2.94Å; K40-T43 PolarHBondContact O-N 3.1Å; K40-G44 PolarHBondContact O-N 3.09Å; K40-G44 VanDerWaalsContact O-N 3.1Å
41	P	95.7	Very high	92.9	Very high	89 Å²	89	98.4 Å²	98.4	58%	0.578	52%	0.519	S	S	*	.	H	α-helix	trans	-61.2	-37.7	176.1	-23.6	33.8	0	0	0	113	V37 G44 A45	V37-P41 VanDerWaalsContact O-CD 3.25Å; V37-P41 WeakPolarHBondContact O-CD 3.34Å; P41-G44 PolarHBondContact O-N 3.46Å; P41-A45 PolarHBondContact O-N 3.34Å
42	L	94.9	Very high	92	Very high	109 Å²	109	95.2 Å²	95.2	57%	0.571	51%	0.508	S	S	*	.	H	α-helix	trans	-64.3	-45.9	176.9	175.7	63.8	0	0	0	110.9	V39 K40 G44 A45 V46	V39-L42 WeakPolarHBondContact O-CA 3.3Å; V39-L42 WeakPolarHBondContact O-CB 3.5Å; V39-L42 PolarHBondContact O-N 3.09Å; K40-L42 VanDerWaalsContact C-N 3.3Å; K40-L42 PolarHBondContact O-N 2.94Å; L42-G44 VanDerWaalsContact C-N 3.26Å; L42-G44 PolarHBondContact O-N 3.37Å; L42-A45 PolarHBondContact O-N 3Å; L42-A45 VanDerWaalsContact O-N 3.09Å; L42-V46 HydrophobicContact CD1-CG2 4.02Å; L42-V46 HydrophobicContact CG-CG2 4.34Å; L42-V46 WeakPolarHBondContact O-CG2 3.42Å; L42-V46 PolarHBondContact O-N 3.49Å
43	T	94.6	Very high	90.8	Very high	94 Å²	94	97.2 Å²	97.2	58%	0.577	52%	0.515	S	S	*	.	H	α-helix	trans	-56.7	-43.4	175	-51.9	0	0	0	0	111.1	V39 K40 V46 A47	V39-T43 PolarHBondContact O-N 3.24Å; V39-T43 PolarHBondContact O-OG1 2.84Å; K40-T43 PolarHBondContact O-N 3.1Å; T43-V46 PolarHBondContact O-N 3.45Å; T43-A47 WeakPolarHBondContact O-CB 3.45Å; T43-A47 PolarHBondContact O-N 3.24Å
44	G	93.3	Very high	89.4	Confident	29 Å²	29	97.7 Å²	97.7	30%	0.299	51%	0.513	S	S	.	.	H	α-helix	trans	-61.9	-43.9	174.3	0	0	0	0	0	112.9	K40 P41 L42 A47 R48	K40-G44 PolarHBondContact O-N 3.09Å; K40-G44 VanDerWaalsContact O-N 3.1Å; P41-G44 PolarHBondContact O-N 3.46Å; L42-G44 VanDerWaalsContact C-N 3.26Å; L42-G44 PolarHBondContact O-N 3.37Å; G44-A47 PolarHBondContact O-N 3.49Å; G44-R48 WeakPolarHBondContact O-CG 3.21Å; G44-R48 PolarHBondContact O-N 3.1Å; G44-R48 VanDerWaalsContact O-N 3.07Å
45	A	94.4	Very high	87.9	Confident	36 Å²	36	93.2 Å²	93.2	30%	0.298	50%	0.504	S	S	.	.	H	α-helix	trans	-63.2	-44.6	177.3	0	0	0	0	0	112.3	P41 L42 R48 M49	P41-A45 PolarHBondContact O-N 3.34Å; L42-A45 PolarHBondContact O-N 3Å; L42-A45 VanDerWaalsContact O-N 3.09Å; A45-R48 PolarHBondContact O-N 3.26Å; A45-M49 WeakPolarHBondContact O-CB 3.41Å; A45-M49 PolarHBondContact O-N 2.87Å
46	V	91.9	Very high	86.1	Confident	50 Å²	50	94.5 Å²	94.5	30%	0.303	51%	0.51	S	S	.	.	H	α-helix	trans	-63.5	-43.3	177.5	171.5	0	0	0	0	111	L42 T43 R48 M49 Q50	L42-V46 HydrophobicContact CD1-CG2 4.02Å; L42-V46 HydrophobicContact CG-CG2 4.34Å; L42-V46 WeakPolarHBondContact O-CG2 3.42Å; L42-V46 PolarHBondContact O-N 3.49Å; T43-V46 PolarHBondContact O-N 3.45Å; V46-R48 PolarHBondContact O-N 2.96Å; V46-M49 PolarHBondContact O-N 3.21Å; V46-Q50 HydrophobicContact CG1-CG 4.39Å; V46-Q50 VanDerWaalsContact CG1-NE2 3.31Å; V46-Q50 WeakPolarHBondContact O-CG 3.46Å; V46-Q50 PolarHBondContact O-N 3.22Å
47	A	91.9	Very high	84.6	Confident	57 Å²	57	100.2 Å²	100.2	47%	0.471	53%	0.526	S	S	.	.	H	α-helix	trans	-60.2	-44.6	176.5	0	0	0	0	0	111.9	T43 G44 Q50 M51	T43-A47 WeakPolarHBondContact O-CB 3.45Å; T43-A47 PolarHBondContact O-N 3.24Å; G44-A47 PolarHBondContact O-N 3.49Å; A47-Q50 PolarHBondContact O-N 3.17Å; A47-M51 PolarHBondContact O-N 2.87Å
48	R	90.4	Very high	82.8	Confident	176 Å²	176	105.2 Å²	105.2	66%	0.664	54%	0.535	S	S	*	.	H	α-helix	trans	-62	-44.4	175.3	-69.4	-170.7	-49.5	-98	4.3	112	G44 A45 V46 M51 G52	G44-R48 WeakPolarHBondContact O-CG 3.21Å; G44-R48 PolarHBondContact O-N 3.1Å; G44-R48 VanDerWaalsContact O-N 3.07Å; A45-R48 PolarHBondContact O-N 3.26Å; V46-R48 PolarHBondContact O-N 2.96Å; R48-M51 PolarHBondContact O-N 2.73Å; R48-G52 PolarHBondContact O-N 3.29Å
49	M	89.2	Confident	81.3	Confident	130 Å²	130	105.4 Å²	105.4	64%	0.64	54%	0.536	S	S	*	.	H	α-helix	trans	-60.8	-45.3	178.2	-177.1	-178.5	69.6	0	0	111.7	A45 V46 M51 G52 H53	A45-M49 WeakPolarHBondContact O-CB 3.41Å; A45-M49 PolarHBondContact O-N 2.87Å; V46-M49 PolarHBondContact O-N 3.21Å; M49-M51 VanDerWaalsContact C-N 3.34Å; M49-M51 PolarHBondContact O-N 3.44Å; M49-G52 PolarHBondContact O-N 3.18Å; M49-H53 PolarHBondContact O-N 3.17Å
50	Q	88	Confident	79.9	Confident	105 Å²	105	107.7 Å²	107.7	49%	0.491	55%	0.553	S	S	.	*	H	α-helix	trans	-63.6	-39.6	177.2	-71.7	-177.2	28.7	0	0	112	V46 A47 H53 R54	V46-Q50 HydrophobicContact CG1-CG 4.39Å; V46-Q50 VanDerWaalsContact CG1-NE2 3.31Å; V46-Q50 WeakPolarHBondContact O-CG 3.46Å; V46-Q50 PolarHBondContact O-N 3.22Å; A47-Q50 PolarHBondContact O-N 3.17Å; Q50-H53 PolarHBondContact O-N 3.26Å; Q50-R54 WeakPolarHBondContact O-CG 3.25Å; Q50-R54 PolarHBondContact O-N 2.72Å; Q50-R54 VanDerWaalsContact O-N 3.14Å
51	M	83.7	Confident	78.6	Confident	113 Å²	113	108.9 Å²	108.9	56%	0.557	56%	0.56	S	S	*	*	H	α-helix	trans	-66.9	-41.2	176.9	-151.7	73.3	178.8	0	0	111.8	A47 R48 M49 H53 R54	A47-M51 PolarHBondContact O-N 2.87Å; R48-M51 PolarHBondContact O-N 2.73Å; M49-M51 VanDerWaalsContact C-N 3.34Å; M49-M51 PolarHBondContact O-N 3.44Å; M51-H53 VanDerWaalsContact C-N 3.31Å; M51-H53 PolarHBondContact O-N 3.4Å; M51-R54 PolarHBondContact O-N 3.01Å
52	G	75.6	Confident	77	Confident	37 Å²	37	115.1 Å²	115.1	38%	0.381	57%	0.572	S	S	.	*	H	α-helix	trans	-59.8	-41	174	0	0	0	0	0	112.3	R48 M49 R54 N55 I56	R48-G52 PolarHBondContact O-N 3.29Å; M49-G52 PolarHBondContact O-N 3.18Å; G52-R54 PolarHBondContact O-N 3.16Å; G52-N55 PolarHBondContact O-N 2.85Å; G52-I56 PolarHBondContact O-N 2.86Å
53	H	66.5	Low	75.6	Confident	102 Å²	102	114.4 Å²	114.4	47%	0.472	57%	0.574	S	S	.	*	H	α-helix	trans	-68.2	-31.9	177.9	-171	-84.7	0	0	0	113.3	M49 Q50 M51 N55 I56	M49-H53 PolarHBondContact O-N 3.17Å; Q50-H53 PolarHBondContact O-N 3.26Å; M51-H53 VanDerWaalsContact C-N 3.31Å; M51-H53 PolarHBondContact O-N 3.4Å; H53-N55 PolarHBondContact O-N 2.74Å; H53-I56 PolarHBondContact O-N 3.3Å
54	R	63.4	Low	74.2	Confident	162 Å²	162	120 Å²	120	61%	0.611	58%	0.584	S	S	*	*	H	α-helix	trans	-62	-32	175.7	-73.9	177.3	-177.9	-174.1	0.3	112.3	Q50 M51 G52	Q50-R54 WeakPolarHBondContact O-CG 3.25Å; Q50-R54 PolarHBondContact O-N 2.72Å; Q50-R54 VanDerWaalsContact O-N 3.14Å; M51-R54 PolarHBondContact O-N 3.01Å; G52-R54 PolarHBondContact O-N 3.16Å
55	N	62.2	Low	72.5	Confident	101 Å²	101	127.7 Å²	127.7	54%	0.54	61%	0.61	S	S	.	*	H	α-helix	trans	-78.1	-29.6	178.7	-65.8	-27.7	0	0	0	112.7	G52 H53 R57 R58	G52-N55 PolarHBondContact O-N 2.85Å; H53-N55 PolarHBondContact O-N 2.74Å; N55-R57 VanDerWaalsContact C-N 3.28Å; N55-R57 PolarHBondContact O-N 3.39Å; N55-R58 PolarHBondContact O-N 2.91Å
56	I	58.3	Low	70.7	Confident	133 Å²	133	131.4 Å²	131.4	68%	0.682	63%	0.629	S	S	*	*	H	α-helix	trans	-67	-29.7	178	-65.6	171.3	0	0	0	111.8	G52 H53 R58	G52-I56 PolarHBondContact O-N 2.86Å; H53-I56 PolarHBondContact O-N 3.3Å; I56-R58 VanDerWaalsContact C-N 3.32Å; I56-R58 PolarHBondContact O-N 2.69Å
57	R	60.6	Low	69	Low	205 Å²	205	134.6 Å²	134.6	77%	0.774	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.6	-15.6	-179.6	-71.7	-151.3	166.5	-152.2	-0.7	114.8	N55 S59	N55-R57 VanDerWaalsContact C-N 3.28Å; N55-R57 PolarHBondContact O-N 3.39Å; R57-S59 VanDerWaalsContact C-N 3.3Å; R57-S59 PolarHBondContact O-N 3.41Å; R57-S59 VanDerWaalsContact O-N 3.1Å
58	R	57.2	Low	67.5	Low	194 Å²	194	140.4 Å²	140.4	73%	0.732	67%	0.671	S	S	*	*	S	Bend	trans	-80.1	92.7	163.9	-68	-172.5	-178.1	131.7	-2.8	105.7	N55 I56	N55-R58 PolarHBondContact O-N 2.91Å; I56-R58 VanDerWaalsContact C-N 3.32Å; I56-R58 PolarHBondContact O-N 2.69Å
59	S	63.9	Low	65.8	Low	93 Å²	93	139.7 Å²	139.7	65%	0.65	68%	0.678	S	S	*	*			trans	-43	129.6	162.9	-180	0	0	0	0	106.9	R57 E61	R57-S59 VanDerWaalsContact C-N 3.3Å; R57-S59 PolarHBondContact O-N 3.41Å; R57-S59 VanDerWaalsContact O-N 3.1Å; S59-E61 PolarHBondContact O-N 3.16Å
60	P	65.6	Low	64.1	Low	111 Å²	111	144.1 Å²	144.1	72%	0.721	69%	0.689	S	S	*	*			trans	-48.4	124.8	169.5	-21.5	30.5	0	0	0	106.2	R62	P60-R62 PolarHBondContact O-N 3.47Å
61	E	68.4	Low	62.4	Low	160 Å²	160	150.3 Å²	150.3	75%	0.748	71%	0.708	S	S	*	*			trans	-49.8	111.8	179.1	-174	170.9	-178.7	0	0	106.8	S59 P63	S59-E61 PolarHBondContact O-N 3.16Å; E61-P63 VanDerWaalsContact O-CD 3.3Å; E61-P63 WeakPolarHBondContact O-CD 3.41Å; E61-P63 VanDerWaalsContact O-N 3.1Å
62	R	62.8	Low	60.7	Low	220 Å²	220	152.6 Å²	152.6	83%	0.83	72%	0.717	S	S	*	*			trans	-61.4	120.8	-173.9	-157.8	177.4	-170.9	-179.8	2	105.3	P60 R64	P60-R62 PolarHBondContact O-N 3.47Å; R62-R64 PolarHBondContact O-N 3.21Å
63	P	65.3	Low	59.3	Low	95 Å²	95	163.3 Å²	163.3	62%	0.617	76%	0.756	S	S	*	*			trans	-52.9	117.5	179.3	-24.8	32.9	0	0	0	107.5	E61 F65	E61-P63 VanDerWaalsContact O-CD 3.3Å; E61-P63 WeakPolarHBondContact O-CD 3.41Å; E61-P63 VanDerWaalsContact O-N 3.1Å; P63-F65 WeakPolarHBondContact O-CD2 3.07Å; P63-F65 PolarHBondContact O-N 2.87Å
64	R	65.2	Low	58.9	Low	210 Å²	210	166.4 Å²	166.4	79%	0.792	77%	0.77	S	S	*	*			trans	-66.4	96.4	173.3	-66.9	-179.1	-174.1	157	4.3	105.2	R62 T66	R62-R64 PolarHBondContact O-N 3.21Å; R64-T66 PolarHBondContact O-N 3.29Å
65	F	57.5	Low	58.7	Low	191 Å²	191	166.6 Å²	166.6	84%	0.838	78%	0.779	S	S	*	*			trans	-61.9	94.5	164.1	-74.9	-84	0	0	0	106.3	P63 S67	P63-F65 WeakPolarHBondContact O-CD2 3.07Å; P63-F65 PolarHBondContact O-N 2.87Å; F65-S67 PolarHBondContact O-N 3.44Å; F65-S67 VanDerWaalsContact O-N 3.15Å
66	T	57.3	Low	58.5	Low	114 Å²	114	170.2 Å²	170.2	70%	0.699	79%	0.792	S	S	*	*			trans	-70.3	106.1	166	47.5	0	0	0	0	105.9	R64 Q68	R64-T66 PolarHBondContact O-N 3.29Å; T66-Q68 PolarHBondContact O-N 3.44Å
67	S	56.7	Low	58.5	Low	117 Å²	117	172.4 Å²	172.4	82%	0.818	80%	0.799	S	S	*	*			trans	-70.1	25.3	-176.2	57.5	0	0	0	0	114.1	F65	F65-S67 PolarHBondContact O-N 3.44Å; F65-S67 VanDerWaalsContact O-N 3.15Å
68	Q	59.2	Low	58.4	Low	180 Å²	180	170.4 Å²	170.4	84%	0.841	80%	0.8	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.5	8.3	-173.8	-140.6	172.1	8	0	0	113.9	T66	T66-Q68 PolarHBondContact O-N 3.44Å
69	M	54.9	Low	58.4	Low	161 Å²	161	168.8 Å²	168.8	79%	0.793	81%	0.805	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.1	12.1	-176.3	-101.4	-86	147.3	0	0	115.2
70	Y	53	Low	58.1	Low	223 Å²	223	174.2 Å²	174.2	88%	0.875	82%	0.816	S	S	*	*	S	Bend	trans	-121.2	40.9	176.7	-81.7	-81.5	0	0	0	113.5
71	R	53.8	Low	57.5	Low	235 Å²	235	179.1 Å²	179.1	89%	0.887	82%	0.823	S	S	*	*			trans	-137.7	47.1	166.8	-79	-148.3	-172.3	-147.8	5.9	112.6
72	Q	47.3	Very low	56.6	Low	160 Å²	160	180.7 Å²	180.7	75%	0.748	83%	0.829	S	S	*	*			trans	-135.1	130.2	162.2	-64.4	-171.6	-18.1	0	0	107.3
73	H	45.8	Very low	56	Low	262 Å²	262	177.1 Å²	177.1	100%	1.213	83%	0.829	S	S	*	*			trans	85.2	0	-167.2	-51.1	-70.3	0	0	0	115.3

Retrieved 73 of 73 residues in 13.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).