G4LZ05_SCHMA Loading...

30S ribosomal protein S20

AlphaFold DB , UniProt , Accession G4LZ05, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 109 aa.

						>G4LZ05_SCHMA|G4LZ05
MGTLEKILKRKKKKIAISNSRARAEKVNSQAEHTKANKKVTMGIRIDDQKYVEELATTVEKAAREENMKQLYDTTKKLAGRDQSLTKKERKSRRFKNGGNDGQNTSRNC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.6	Low	90.5	Very high	219 Å²	219	124.8 Å²	124.8	100%	1.079	61%	0.605	S	S	*	*				0	-8.1	0	-63.4	-50.3	-166.9	0	0	115.9
2	G	83.5	Confident	91	Very high	31 Å²	31	127.5 Å²	127.5	32%	0.32	61%	0.611	S	S	.	*	H	α-helix	trans	-92.4	-12	-165	0	0	0	0	0	119.9	K6	G2-K6 WeakPolarHBondContact O-CD 3.48Å; G2-K6 WeakPolarHBondContact O-CG 3.41Å; G2-K6 PolarHBondContact O-N 3.22Å
3	T	92.3	Very high	91.4	Very high	106 Å²	106	127.7 Å²	127.7	65%	0.65	61%	0.608	S	S	*	*	H	α-helix	trans	-78.3	-46.3	-169.7	-51.6	0	0	0	0	113.2	K6 I7	T3-K6 PolarHBondContact O-N 2.96Å; T3-I7 HydrophobicContact CG2-CD1 4.27Å; T3-I7 WeakPolarHBondContact O-CG1 3.43Å; T3-I7 PolarHBondContact O-N 3.13Å; T3-I7 VanDerWaalsContact O-N 3.13Å
4	L	93.8	Very high	91.8	Very high	124 Å²	124	130.1 Å²	130.1	65%	0.649	62%	0.615	S	S	*	*	H	α-helix	trans	-64.3	-42.5	-179.3	-173	63.7	0	0	0	111.8	K6 I7 L8	L4-K6 PolarHBondContact O-N 3.45Å; L4-I7 WeakPolarHBondContact O-CB 3.33Å; L4-I7 PolarHBondContact O-N 3.42Å; L4-I7 VanDerWaalsContact O-N 3.16Å; L4-L8 WeakPolarHBondContact O-CG 3.16Å; L4-L8 PolarHBondContact O-N 2.95Å
5	E	92.8	Very high	92.1	Very high	133 Å²	133	128.1 Å²	128.1	62%	0.621	61%	0.607	S	S	*	*	H	α-helix	trans	-58.9	-44	174.9	-68.1	178.2	-178.1	0	0	112.4	I7 L8 K9	E5-I7 VanDerWaalsContact C-N 3.31Å; E5-I7 PolarHBondContact O-N 3.16Å; E5-L8 PolarHBondContact O-N 3.47Å; E5-K9 WeakPolarHBondContact O-CB 3.49Å; E5-K9 PolarHBondContact O-N 3.04Å
6	K	94	Very high	92.5	Very high	135 Å²	135	123.6 Å²	123.6	59%	0.587	60%	0.599	S	S	*	*	H	α-helix	trans	-60.6	-40	175.7	-74.7	170.7	-172.6	-179.8	0	111.5	G2 T3 L4 K9 R10	G2-K6 WeakPolarHBondContact O-CD 3.48Å; G2-K6 WeakPolarHBondContact O-CG 3.41Å; G2-K6 PolarHBondContact O-N 3.22Å; T3-K6 PolarHBondContact O-N 2.96Å; L4-K6 PolarHBondContact O-N 3.45Å; K6-K9 PolarHBondContact O-N 3.38Å; K6-R10 WeakPolarHBondContact O-CG 3.41Å; K6-R10 PolarHBondContact O-N 3.43Å
7	I	94.7	Very high	92.7	Very high	75 Å²	75	122.6 Å²	122.6	39%	0.385	60%	0.596	S	S	.	*	H	α-helix	trans	-65.1	-48.1	176.8	-66.5	166.5	0	0	0	110.6	T3 L4 E5 K9 R10 K11	T3-I7 HydrophobicContact CG2-CD1 4.27Å; T3-I7 WeakPolarHBondContact O-CG1 3.43Å; T3-I7 PolarHBondContact O-N 3.13Å; T3-I7 VanDerWaalsContact O-N 3.13Å; L4-I7 WeakPolarHBondContact O-CB 3.33Å; L4-I7 PolarHBondContact O-N 3.42Å; L4-I7 VanDerWaalsContact O-N 3.16Å; E5-I7 VanDerWaalsContact C-N 3.31Å; E5-I7 PolarHBondContact O-N 3.16Å; I7-K9 VanDerWaalsContact C-N 3.33Å; I7-K9 PolarHBondContact O-N 3.31Å; I7-R10 PolarHBondContact O-N 2.97Å; I7-K11 HydrophobicContact CG2-CD 4.47Å; I7-K11 PolarHBondContact O-N 3.31Å
8	L	95.1	Very high	93	Very high	90 Å²	90	119.6 Å²	119.6	47%	0.471	59%	0.589	S	S	.	*	H	α-helix	trans	-61.2	-41	177.3	-68.8	175.9	0	0	0	111.8	L4 E5 R10 K11 K12	L4-L8 WeakPolarHBondContact O-CG 3.16Å; L4-L8 PolarHBondContact O-N 2.95Å; E5-L8 PolarHBondContact O-N 3.47Å; L8-R10 PolarHBondContact O-N 3.49Å; L8-K11 PolarHBondContact O-N 2.87Å; L8-K12 WeakPolarHBondContact O-CG 3.35Å; L8-K12 PolarHBondContact O-N 3.32Å
9	K	95.5	Very high	93.2	Very high	136 Å²	136	117.7 Å²	117.7	59%	0.591	58%	0.582	S	S	*	*	H	α-helix	trans	-60.7	-42.6	175.5	-169.7	173.8	-174.4	173.6	0	111.9	E5 K6 I7 K13	E5-K9 WeakPolarHBondContact O-CB 3.49Å; E5-K9 PolarHBondContact O-N 3.04Å; K6-K9 PolarHBondContact O-N 3.38Å; I7-K9 VanDerWaalsContact C-N 3.33Å; I7-K9 PolarHBondContact O-N 3.31Å; K9-K13 WeakPolarHBondContact O-CG 3.33Å; K9-K13 PolarHBondContact O-N 3.23Å; K9-K13 VanDerWaalsContact O-N 3.09Å
10	R	96.4	Very high	93.3	Very high	193 Å²	193	114.9 Å²	114.9	73%	0.728	57%	0.574	S	S	*	*	H	α-helix	trans	-65.4	-43.7	175.8	-72.9	175.2	-178.5	-173.5	0.4	112	K6 I7 L8 K13 K14	K6-R10 WeakPolarHBondContact O-CG 3.41Å; K6-R10 PolarHBondContact O-N 3.43Å; I7-R10 PolarHBondContact O-N 2.97Å; L8-R10 PolarHBondContact O-N 3.49Å; R10-K13 PolarHBondContact O-N 3.08Å; R10-K14 PolarHBondContact O-N 3.45Å
11	K	96.6	Very high	93.5	Very high	131 Å²	131	117 Å²	117	57%	0.57	58%	0.575	S	S	*	*	H	α-helix	trans	-59.5	-48.3	176.4	-74.1	-174.1	176.6	-174	0	111.8	I7 L8 K13 K14 I15	I7-K11 HydrophobicContact CG2-CD 4.47Å; I7-K11 PolarHBondContact O-N 3.31Å; L8-K11 PolarHBondContact O-N 2.87Å; K11-K13 PolarHBondContact O-N 2.96Å; K11-K14 PolarHBondContact O-N 3.34Å; K11-I15 WeakPolarHBondContact O-CG1 3.42Å; K11-I15 PolarHBondContact O-N 3.09Å; K11-I15 VanDerWaalsContact O-N 3.08Å
12	K	96.4	Very high	95.3	Very high	157 Å²	157	109 Å²	109	68%	0.683	54%	0.544	S	S	*	.	H	α-helix	trans	-58.7	-45.1	176.5	-72.2	-179.5	179.2	-177.1	0	112.2	L8 K14 I15 A16	L8-K12 WeakPolarHBondContact O-CG 3.35Å; L8-K12 PolarHBondContact O-N 3.32Å; K12-K14 PolarHBondContact O-N 3.48Å; K12-I15 PolarHBondContact O-N 3.01Å; K12-A16 PolarHBondContact O-N 3.35Å
13	K	96.6	Very high	96	Very high	130 Å²	130	115.1 Å²	115.1	57%	0.565	56%	0.558	S	S	*	*	H	α-helix	trans	-61.1	-42.5	176	-75.8	-175.3	175.6	-165	0	112.5	K9 R10 K11 I15 A16 I17	K9-K13 WeakPolarHBondContact O-CG 3.33Å; K9-K13 PolarHBondContact O-N 3.23Å; K9-K13 VanDerWaalsContact O-N 3.09Å; R10-K13 PolarHBondContact O-N 3.08Å; K11-K13 PolarHBondContact O-N 2.96Å; K13-I15 PolarHBondContact O-N 2.85Å; K13-A16 PolarHBondContact O-N 3.48Å; K13-I17 WeakPolarHBondContact O-CG1 3.39Å; K13-I17 PolarHBondContact O-N 3.44Å
14	K	96.9	Very high	96.2	Very high	162 Å²	162	112.4 Å²	112.4	70%	0.704	55%	0.546	S	S	*	.	H	α-helix	trans	-60.6	-44.1	177.6	-173.4	176.3	-179.5	179.5	0	111.7	R10 K11 K12 I17 S18	R10-K14 PolarHBondContact O-N 3.45Å; K11-K14 PolarHBondContact O-N 3.34Å; K12-K14 PolarHBondContact O-N 3.48Å; K14-I17 PolarHBondContact O-N 3.02Å; K14-S18 WeakPolarHBondContact O-CB 3.44Å; K14-S18 PolarHBondContact O-N 3.49Å
15	I	96.8	Very high	96.4	Very high	99 Å²	99	112 Å²	112	51%	0.508	54%	0.541	S	S	.	.	H	α-helix	trans	-63.6	-44.6	177	-64.8	164.8	0	0	0	110.7	K11 K12 K13 I17 S18 N19	K11-I15 WeakPolarHBondContact O-CG1 3.42Å; K11-I15 PolarHBondContact O-N 3.09Å; K11-I15 VanDerWaalsContact O-N 3.08Å; K12-I15 PolarHBondContact O-N 3.01Å; K13-I15 PolarHBondContact O-N 2.85Å; I15-I17 PolarHBondContact O-N 3.3Å; I15-S18 PolarHBondContact O-N 3.46Å; I15-N19 WeakPolarHBondContact O-CB 3.42Å; I15-N19 VanDerWaalsContact O-CG 3.23Å; I15-N19 PolarHBondContact O-N 2.97Å; I15-N19 PolarHBondContact O-OD1 3.46Å
16	A	97.3	Very high	96.6	Very high	57 Å²	57	113 Å²	113	47%	0.471	54%	0.544	S	S	.	.	H	α-helix	trans	-59.8	-43.8	178.3	0	0	0	0	0	112.5	K12 K13 N19 S20	K12-A16 PolarHBondContact O-N 3.35Å; K13-A16 PolarHBondContact O-N 3.48Å; A16-N19 PolarHBondContact O-N 2.96Å; A16-S20 WeakPolarHBondContact O-CB 3.34Å; A16-S20 PolarHBondContact O-N 3.42Å
17	I	97	Very high	96.7	Very high	107 Å²	107	110.9 Å²	110.9	55%	0.549	54%	0.541	S	S	.	.	H	α-helix	trans	-63.7	-45.9	175.9	-66.6	165.1	0	0	0	110.6	K13 K14 I15 N19 S20 R21	K13-I17 WeakPolarHBondContact O-CG1 3.39Å; K13-I17 PolarHBondContact O-N 3.44Å; K14-I17 PolarHBondContact O-N 3.02Å; I15-I17 PolarHBondContact O-N 3.3Å; I17-N19 PolarHBondContact O-N 3.48Å; I17-S20 PolarHBondContact O-N 3.23Å; I17-R21 PolarHBondContact O-N 2.94Å
18	S	97.1	Very high	96.8	Very high	68 Å²	68	112.2 Å²	112.2	48%	0.476	55%	0.549	S	S	.	.	H	α-helix	trans	-59.2	-46.1	178.1	-166.5	0	0	0	0	111.9	K14 I15 S20 R21 A22	K14-S18 WeakPolarHBondContact O-CB 3.44Å; K14-S18 PolarHBondContact O-N 3.49Å; I15-S18 PolarHBondContact O-N 3.46Å; S18-S20 VanDerWaalsContact C-N 3.33Å; S18-S20 PolarHBondContact O-N 3.48Å; S18-R21 PolarHBondContact O-N 2.97Å; S18-A22 PolarHBondContact O-N 3.02Å
19	N	97	Very high	96.9	Very high	84 Å²	84	110.4 Å²	110.4	45%	0.449	54%	0.544	S	S	.	.	H	α-helix	trans	-64.9	-38.7	178	-69.8	-7.6	0	0	0	111.6	I15 A16 I17 R21 A22 R23	I15-N19 WeakPolarHBondContact O-CB 3.42Å; I15-N19 VanDerWaalsContact O-CG 3.23Å; I15-N19 PolarHBondContact O-N 2.97Å; I15-N19 PolarHBondContact O-OD1 3.46Å; A16-N19 PolarHBondContact O-N 2.96Å; I17-N19 PolarHBondContact O-N 3.48Å; N19-R21 VanDerWaalsContact C-N 3.35Å; N19-A22 PolarHBondContact O-N 3.06Å; N19-R23 WeakPolarHBondContact O-CG 3.36Å; N19-R23 PolarHBondContact O-N 3.07Å
20	S	96.2	Very high	97	Very high	61 Å²	61	109.7 Å²	109.7	43%	0.427	54%	0.543	S	S	.	.	H	α-helix	trans	-64.7	-40.1	176	-161.2	0	0	0	0	112.1	A16 I17 S18 R23 A24	A16-S20 WeakPolarHBondContact O-CB 3.34Å; A16-S20 PolarHBondContact O-N 3.42Å; I17-S20 PolarHBondContact O-N 3.23Å; S18-S20 VanDerWaalsContact C-N 3.33Å; S18-S20 PolarHBondContact O-N 3.48Å; S20-R23 PolarHBondContact O-N 3.3Å; S20-A24 PolarHBondContact O-N 3.27Å
21	R	97.5	Very high	97.1	Very high	159 Å²	159	102.4 Å²	102.4	60%	0.6	52%	0.524	S	S	*	.	H	α-helix	trans	-63.4	-49.4	174.9	-174.2	-177.9	-65.4	164.3	-3.2	111.5	I17 S18 N19 R23 A24 E25	I17-R21 PolarHBondContact O-N 2.94Å; S18-R21 PolarHBondContact O-N 2.97Å; N19-R21 VanDerWaalsContact C-N 3.35Å; R21-R23 VanDerWaalsContact C-N 3.27Å; R21-R23 PolarHBondContact O-N 3.24Å; R21-A24 PolarHBondContact O-N 3.06Å; R21-A24 VanDerWaalsContact O-N 3.07Å; R21-E25 WeakPolarHBondContact CG-OE1 3.38Å; R21-E25 WeakPolarHBondContact O-CG 3.5Å; R21-E25 PolarHBondContact O-N 3.48Å
22	A	97.3	Very high	97.1	Very high	52 Å²	52	102.8 Å²	102.8	43%	0.43	53%	0.528	S	S	.	.	H	α-helix	trans	-59.5	-37.6	178.6	0	0	0	0	0	112.5	S18 N19 K26	S18-A22 PolarHBondContact O-N 3.02Å; N19-A22 PolarHBondContact O-N 3.06Å; A22-K26 WeakPolarHBondContact O-CB 3.46Å; A22-K26 PolarHBondContact O-N 2.92Å
23	R	97.8	Very high	97.1	Very high	158 Å²	158	101.6 Å²	101.6	60%	0.596	52%	0.524	S	S	*	.	H	α-helix	trans	-65.5	-44.1	173.3	-74.4	-171.4	-55.5	-121.6	1.3	112.4	N19 S20 R21 K26 V27	N19-R23 WeakPolarHBondContact O-CG 3.36Å; N19-R23 PolarHBondContact O-N 3.07Å; S20-R23 PolarHBondContact O-N 3.3Å; R21-R23 VanDerWaalsContact C-N 3.27Å; R21-R23 PolarHBondContact O-N 3.24Å; R23-K26 PolarHBondContact O-N 2.95Å; R23-V27 WeakPolarHBondContact O-CG2 3.36Å; R23-V27 PolarHBondContact O-N 2.9Å
24	A	97.1	Very high	97.2	Very high	50 Å²	50	98.8 Å²	98.8	41%	0.413	52%	0.518	S	S	.	.	H	α-helix	trans	-63.4	-43.2	178.7	0	0	0	0	0	111.6	S20 R21 K26 V27 N28	S20-A24 PolarHBondContact O-N 3.27Å; R21-A24 PolarHBondContact O-N 3.06Å; R21-A24 VanDerWaalsContact O-N 3.07Å; A24-K26 VanDerWaalsContact C-N 3.35Å; A24-K26 PolarHBondContact O-N 3.46Å; A24-V27 PolarHBondContact O-N 3.3Å; A24-N28 PolarHBondContact O-N 3.46Å
25	E	97.3	Very high	97.2	Very high	116 Å²	116	97.8 Å²	97.8	54%	0.542	51%	0.514	S	S	.	.	H	α-helix	trans	-59.8	-43.9	174.9	-73.4	170.6	-170.2	0	0	111.7	R21 V27 N28 S29	R21-E25 WeakPolarHBondContact CG-OE1 3.38Å; R21-E25 WeakPolarHBondContact O-CG 3.5Å; R21-E25 PolarHBondContact O-N 3.48Å; E25-V27 PolarHBondContact O-N 2.92Å; E25-N28 PolarHBondContact O-N 3.26Å; E25-S29 WeakPolarHBondContact O-CB 3.42Å; E25-S29 PolarHBondContact O-N 3.01Å
26	K	97.4	Very high	97.2	Very high	154 Å²	154	95.4 Å²	95.4	67%	0.67	51%	0.509	S	S	*	.	H	α-helix	trans	-61	-43.4	175.6	-174	176.5	-179.2	178.3	0	112.4	A22 R23 A24 Q30	A22-K26 WeakPolarHBondContact O-CB 3.46Å; A22-K26 PolarHBondContact O-N 2.92Å; R23-K26 PolarHBondContact O-N 2.95Å; A24-K26 VanDerWaalsContact C-N 3.35Å; A24-K26 PolarHBondContact O-N 3.46Å; K26-Q30 WeakPolarHBondContact O-CB 3.37Å; K26-Q30 PolarHBondContact O-N 3.34Å
27	V	96.8	Very high	97.2	Very high	89 Å²	89	97.6 Å²	97.6	54%	0.539	51%	0.513	S	S	.	.	H	α-helix	trans	-65	-41.7	177.7	170.7	0	0	0	0	111	R23 A24 E25 Q30 A31	R23-V27 WeakPolarHBondContact O-CG2 3.36Å; R23-V27 PolarHBondContact O-N 2.9Å; A24-V27 PolarHBondContact O-N 3.3Å; E25-V27 PolarHBondContact O-N 2.92Å; V27-Q30 PolarHBondContact O-N 3.27Å; V27-A31 WeakPolarHBondContact O-CB 3.45Å; V27-A31 PolarHBondContact O-N 2.9Å
28	N	97.4	Very high	97.2	Very high	103 Å²	103	99.4 Å²	99.4	55%	0.551	52%	0.517	S	S	*	.	H	α-helix	trans	-63.8	-48.1	177.2	-72.7	-14.8	0	0	0	111.5	A24 E25 Q30 A31 E32	A24-N28 PolarHBondContact O-N 3.46Å; E25-N28 PolarHBondContact O-N 3.26Å; N28-Q30 VanDerWaalsContact C-N 3.31Å; N28-Q30 PolarHBondContact O-N 3.43Å; N28-A31 WeakPolarHBondContact O-CB 3.49Å; N28-A31 PolarHBondContact O-N 3.39Å; N28-A31 VanDerWaalsContact O-N 3.11Å; N28-E32 WeakPolarHBondContact O-CG 3.45Å; N28-E32 PolarHBondContact O-N 3.48Å
29	S	97	Very high	97.2	Very high	52 Å²	52	104 Å²	104	36%	0.364	53%	0.528	S	S	.	.	H	α-helix	trans	-58.1	-43.9	175.4	171.8	0	0	0	0	111.4	E25 A31 E32 H33	E25-S29 WeakPolarHBondContact O-CB 3.42Å; E25-S29 PolarHBondContact O-N 3.01Å; S29-A31 VanDerWaalsContact C-N 3.34Å; S29-A31 PolarHBondContact O-N 3.06Å; S29-E32 PolarHBondContact O-N 3.39Å; S29-H33 PolarHBondContact O-CD2 2.83Å; S29-H33 PolarHBondContact O-N 3.37Å; S29-H33 PolarHBondContact OG-CD2 2.92Å
30	Q	97.8	Very high	97.2	Very high	122 Å²	122	104.1 Å²	104.1	57%	0.57	53%	0.531	S	S	*	.	H	α-helix	trans	-61.6	-41.5	175.2	-172.1	172.8	11.9	0	0	112.1	K26 V27 N28 H33 T34	K26-Q30 WeakPolarHBondContact O-CB 3.37Å; K26-Q30 PolarHBondContact O-N 3.34Å; V27-Q30 PolarHBondContact O-N 3.27Å; N28-Q30 VanDerWaalsContact C-N 3.31Å; N28-Q30 PolarHBondContact O-N 3.43Å; Q30-H33 PolarHBondContact O-N 3.2Å; Q30-T34 WeakPolarHBondContact O-CG2 3.35Å; Q30-T34 PolarHBondContact O-N 3.11Å; Q30-T34 PolarHBondContact O-OG1 2.89Å
31	A	97.4	Very high	97.2	Very high	40 Å²	40	103.9 Å²	103.9	33%	0.331	53%	0.528	S	S	.	.	H	α-helix	trans	-64.3	-40	176.5	0	0	0	0	0	112.2	V27 N28 S29 T34 K35	V27-A31 WeakPolarHBondContact O-CB 3.45Å; V27-A31 PolarHBondContact O-N 2.9Å; N28-A31 WeakPolarHBondContact O-CB 3.49Å; N28-A31 PolarHBondContact O-N 3.39Å; N28-A31 VanDerWaalsContact O-N 3.11Å; S29-A31 VanDerWaalsContact C-N 3.34Å; S29-A31 PolarHBondContact O-N 3.06Å; A31-T34 PolarHBondContact O-N 2.98Å; A31-T34 PolarHBondContact O-OG1 2.9Å; A31-K35 WeakPolarHBondContact O-CG 3.46Å; A31-K35 PolarHBondContact O-N 3.4Å; A31-K35 VanDerWaalsContact O-N 3.11Å
32	E	96.8	Very high	97.2	Very high	139 Å²	139	101 Å²	101	65%	0.65	52%	0.522	S	S	*	.	H	α-helix	trans	-65	-45	174.5	-71	-173.9	151.1	0	0	111.9	N28 S29 T34 K35 A36	N28-E32 WeakPolarHBondContact O-CG 3.45Å; N28-E32 PolarHBondContact O-N 3.48Å; S29-E32 PolarHBondContact O-N 3.39Å; E32-T34 VanDerWaalsContact C-N 3.34Å; E32-T34 PolarHBondContact O-N 3.49Å; E32-K35 PolarHBondContact O-N 3.39Å; E32-A36 WeakPolarHBondContact O-CB 3.46Å; E32-A36 PolarHBondContact O-N 2.88Å
33	H	97.3	Very high	97.2	Very high	131 Å²	131	99.8 Å²	99.8	61%	0.606	52%	0.515	S	S	*	.	H	α-helix	trans	-59.2	-42.5	175.7	-78.2	-61.5	0	0	0	112.3	S29 Q30 K35 A36 N37	S29-H33 PolarHBondContact O-CD2 2.83Å; S29-H33 PolarHBondContact O-N 3.37Å; S29-H33 PolarHBondContact OG-CD2 2.92Å; Q30-H33 PolarHBondContact O-N 3.2Å; H33-K35 PolarHBondContact O-N 3.4Å; H33-A36 PolarHBondContact O-N 3.11Å; H33-N37 WeakPolarHBondContact O-CB 3.34Å; H33-N37 PolarHBondContact O-N 3.12Å
34	T	97.2	Very high	97.1	Very high	71 Å²	71	96.5 Å²	96.5	44%	0.436	51%	0.508	S	S	.	.	H	α-helix	trans	-65.7	-38.2	177	59.2	0	0	0	0	112.6	Q30 A31 E32 K38	Q30-T34 WeakPolarHBondContact O-CG2 3.35Å; Q30-T34 PolarHBondContact O-N 3.11Å; Q30-T34 PolarHBondContact O-OG1 2.89Å; A31-T34 PolarHBondContact O-N 2.98Å; A31-T34 PolarHBondContact O-OG1 2.9Å; E32-T34 VanDerWaalsContact C-N 3.34Å; E32-T34 PolarHBondContact O-N 3.49Å; T34-K38 WeakPolarHBondContact O-CB 3.38Å; T34-K38 VanDerWaalsContact O-CG 3.28Å; T34-K38 WeakPolarHBondContact O-CG 3.28Å; T34-K38 PolarHBondContact O-N 3.47Å
35	K	97.7	Very high	97.2	Very high	141 Å²	141	101.5 Å²	101.5	61%	0.613	52%	0.516	S	S	*	.	H	α-helix	trans	-66.3	-43.4	175	-72.9	175.2	-177.9	177.4	0	111.8	A31 E32 H33 K38 K39	A31-K35 WeakPolarHBondContact O-CG 3.46Å; A31-K35 PolarHBondContact O-N 3.4Å; A31-K35 VanDerWaalsContact O-N 3.11Å; E32-K35 PolarHBondContact O-N 3.39Å; H33-K35 PolarHBondContact O-N 3.4Å; K35-K38 PolarHBondContact O-N 3.04Å; K35-K39 WeakPolarHBondContact O-CG 3.5Å; K35-K39 PolarHBondContact O-N 3Å; K35-K39 VanDerWaalsContact O-N 3.11Å
36	A	97.1	Very high	97.2	Very high	49 Å²	49	99.7 Å²	99.7	41%	0.405	51%	0.509	S	S	.	.	H	α-helix	trans	-62.9	-46.9	177.1	0	0	0	0	0	111.3	E32 H33 K38 K39 V40	E32-A36 WeakPolarHBondContact O-CB 3.46Å; E32-A36 PolarHBondContact O-N 2.88Å; H33-A36 PolarHBondContact O-N 3.11Å; A36-K38 VanDerWaalsContact C-N 3.33Å; A36-K38 PolarHBondContact O-N 3.49Å; A36-K39 WeakPolarHBondContact O-CB 3.48Å; A36-K39 PolarHBondContact O-N 3.26Å; A36-K39 VanDerWaalsContact O-N 3.12Å; A36-V40 WeakPolarHBondContact O-CG2 3.4Å; A36-V40 PolarHBondContact O-N 2.93Å
37	N	96.8	Very high	97.2	Very high	104 Å²	104	96.8 Å²	96.8	56%	0.556	50%	0.501	S	S	*	.	H	α-helix	trans	-60.1	-42.9	177.5	-167.9	37.8	0	0	0	111.9	H33 K39 V40 T41	H33-N37 WeakPolarHBondContact O-CB 3.34Å; H33-N37 PolarHBondContact O-N 3.12Å; N37-K39 VanDerWaalsContact C-N 3.34Å; N37-K39 PolarHBondContact O-N 3.11Å; N37-V40 PolarHBondContact O-N 2.97Å; N37-T41 WeakPolarHBondContact O-CG2 3.3Å; N37-T41 PolarHBondContact O-N 3.4Å; N37-T41 PolarHBondContact O-OG1 2.95Å
38	K	96.4	Very high	97.2	Very high	145 Å²	145	97 Å²	97	63%	0.63	50%	0.5	S	S	*	.	H	α-helix	trans	-56.4	-46.7	173.6	-76.9	176.7	-179.2	-174.3	0	111.8	T34 K35 A36 V40 T41 M42	T34-K38 WeakPolarHBondContact O-CB 3.38Å; T34-K38 VanDerWaalsContact O-CG 3.28Å; T34-K38 WeakPolarHBondContact O-CG 3.28Å; T34-K38 PolarHBondContact O-N 3.47Å; K35-K38 PolarHBondContact O-N 3.04Å; A36-K38 VanDerWaalsContact C-N 3.33Å; A36-K38 PolarHBondContact O-N 3.49Å; K38-V40 PolarHBondContact O-N 3.12Å; K38-T41 PolarHBondContact O-N 3.04Å; K38-T41 PolarHBondContact O-OG1 3.36Å; K38-M42 VanDerWaalsContact O-CG 3.3Å; K38-M42 WeakPolarHBondContact O-CG 3.49Å; K38-M42 PolarHBondContact O-N 3.39Å
39	K	97.6	Very high	97.2	Very high	165 Å²	165	98.6 Å²	98.6	72%	0.717	50%	0.504	S	S	*	.	H	α-helix	trans	-61.2	-44.2	178	-71.3	-179.2	178.3	-173.6	0	112.4	K35 A36 N37 M42 G43	K35-K39 WeakPolarHBondContact O-CG 3.5Å; K35-K39 PolarHBondContact O-N 3Å; K35-K39 VanDerWaalsContact O-N 3.11Å; A36-K39 WeakPolarHBondContact O-CB 3.48Å; A36-K39 PolarHBondContact O-N 3.26Å; A36-K39 VanDerWaalsContact O-N 3.12Å; N37-K39 VanDerWaalsContact C-N 3.34Å; N37-K39 PolarHBondContact O-N 3.11Å; K39-M42 PolarHBondContact O-N 3.43Å; K39-G43 PolarHBondContact O-N 3.43Å
40	V	96.8	Very high	97.2	Very high	85 Å²	85	101.2 Å²	101.2	52%	0.515	51%	0.509	S	S	.	.	H	α-helix	trans	-61.7	-49.5	177.8	173	0	0	0	0	111	A36 N37 K38 M42 G43 I44	A36-V40 WeakPolarHBondContact O-CG2 3.4Å; A36-V40 PolarHBondContact O-N 2.93Å; N37-V40 PolarHBondContact O-N 2.97Å; K38-V40 PolarHBondContact O-N 3.12Å; V40-M42 VanDerWaalsContact C-N 3.27Å; V40-M42 PolarHBondContact O-N 3.29Å; V40-G43 PolarHBondContact O-N 2.87Å; V40-G43 VanDerWaalsContact O-N 3.12Å; V40-I44 HydrophobicContact CG1-CD1 3.86Å; V40-I44 HydrophobicContact CG1-CG1 4.47Å; V40-I44 WeakPolarHBondContact O-CG1 3.37Å; V40-I44 PolarHBondContact O-N 3.19Å
41	T	96.7	Very high	97.2	Very high	56 Å²	56	102.2 Å²	102.2	34%	0.344	51%	0.508	S	S	.	.	H	α-helix	trans	-62.2	-33.5	179.4	57.6	0	0	0	0	113.2	N37 K38 R45	N37-T41 WeakPolarHBondContact O-CG2 3.3Å; N37-T41 PolarHBondContact O-N 3.4Å; N37-T41 PolarHBondContact O-OG1 2.95Å; K38-T41 PolarHBondContact O-N 3.04Å; K38-T41 PolarHBondContact O-OG1 3.36Å; T41-R45 WeakPolarHBondContact O-CG 3.38Å; T41-R45 PolarHBondContact O-N 3.04Å
42	M	97.4	Very high	97.1	Very high	98 Å²	98	104.8 Å²	104.8	48%	0.483	52%	0.52	S	S	.	.	H	α-helix	trans	-72	-38.8	174.3	-70.6	-61	-62.8	0	0	112.2	K38 K39 V40 R45 I46	K38-M42 VanDerWaalsContact O-CG 3.3Å; K38-M42 WeakPolarHBondContact O-CG 3.49Å; K38-M42 PolarHBondContact O-N 3.39Å; K39-M42 PolarHBondContact O-N 3.43Å; V40-M42 VanDerWaalsContact C-N 3.27Å; V40-M42 PolarHBondContact O-N 3.29Å; M42-R45 PolarHBondContact O-N 2.94Å; M42-I46 WeakPolarHBondContact O-CG1 3.39Å; M42-I46 PolarHBondContact O-N 2.87Å; M42-I46 VanDerWaalsContact O-N 3.16Å
43	G	96.6	Very high	97.2	Very high	27 Å²	27	104.3 Å²	104.3	28%	0.278	52%	0.517	S	S	.	.	H	α-helix	trans	-59.8	-50	174.1	0	0	0	0	0	112	K39 V40 R45 I46 D47	K39-G43 PolarHBondContact O-N 3.43Å; V40-G43 PolarHBondContact O-N 2.87Å; V40-G43 VanDerWaalsContact O-N 3.12Å; G43-R45 VanDerWaalsContact C-N 3.28Å; G43-R45 PolarHBondContact O-N 3.16Å; G43-I46 PolarHBondContact O-N 3.28Å; G43-D47 PolarHBondContact O-N 3.38Å
44	I	97.2	Very high	97.2	Very high	89 Å²	89	104 Å²	104	46%	0.456	52%	0.516	S	S	.	.	H	α-helix	trans	-54.8	-45.3	177.8	-66.7	166.9	0	0	0	111	V40 I46 D47 D48	V40-I44 HydrophobicContact CG1-CD1 3.86Å; V40-I44 HydrophobicContact CG1-CG1 4.47Å; V40-I44 WeakPolarHBondContact O-CG1 3.37Å; V40-I44 PolarHBondContact O-N 3.19Å; I44-I46 VanDerWaalsContact C-N 3.33Å; I44-I46 PolarHBondContact O-N 3.28Å; I44-D47 PolarHBondContact O-N 3.4Å; I44-D48 WeakPolarHBondContact O-CB 3.39Å; I44-D48 PolarHBondContact O-N 3.29Å
45	R	97.5	Very high	97.2	Very high	155 Å²	155	104.6 Å²	104.6	59%	0.585	52%	0.516	S	S	*	.	H	α-helix	trans	-61.8	-38.8	178.3	-73.2	171.5	177.2	179	-2.4	113.3	T41 M42 G43 Q49	T41-R45 WeakPolarHBondContact O-CG 3.38Å; T41-R45 PolarHBondContact O-N 3.04Å; M42-R45 PolarHBondContact O-N 2.94Å; G43-R45 VanDerWaalsContact C-N 3.28Å; G43-R45 PolarHBondContact O-N 3.16Å; R45-Q49 VanDerWaalsContact O-CG 3.28Å; R45-Q49 WeakPolarHBondContact O-CG 3.32Å; R45-Q49 PolarHBondContact O-N 3.3Å; R45-Q49 VanDerWaalsContact O-N 3.14Å
46	I	97.9	Very high	97.2	Very high	78 Å²	78	100 Å²	100	40%	0.4	51%	0.505	S	S	.	.	H	α-helix	trans	-68.9	-43.2	178.5	-69.6	166.2	0	0	0	110	M42 G43 I44 Q49 K50	M42-I46 WeakPolarHBondContact O-CG1 3.39Å; M42-I46 PolarHBondContact O-N 2.87Å; M42-I46 VanDerWaalsContact O-N 3.16Å; G43-I46 PolarHBondContact O-N 3.28Å; I44-I46 VanDerWaalsContact C-N 3.33Å; I44-I46 PolarHBondContact O-N 3.28Å; I46-Q49 PolarHBondContact O-N 3.4Å; I46-K50 HydrophobicContact CG2-CD 4.39Å; I46-K50 WeakPolarHBondContact O-CG 3.47Å; I46-K50 PolarHBondContact O-N 3.04Å
47	D	97	Very high	97.2	Very high	93 Å²	93	100.1 Å²	100.1	50%	0.497	50%	0.501	S	S	.	.	H	α-helix	trans	-68.6	-39.5	-179.4	-66.1	-22.9	0	0	0	111.4	G43 I44 Q49 K50 Y51	G43-D47 PolarHBondContact O-N 3.38Å; I44-D47 PolarHBondContact O-N 3.4Å; D47-Q49 VanDerWaalsContact C-N 3.33Å; D47-Q49 PolarHBondContact O-N 3.44Å; D47-K50 PolarHBondContact O-N 3.47Å; D47-K50 IonicContact OD1-NZ 2.71Å; D47-Y51 WeakPolarHBondContact O-CB 3.28Å; D47-Y51 PolarHBondContact O-N 2.93Å
48	D	97.2	Very high	97.2	Very high	95 Å²	95	99.3 Å²	99.3	51%	0.508	50%	0.499	S	S	.	.	H	α-helix	trans	-60.4	-41.3	172.9	-71.5	-16.6	0	0	0	111.7	I44 Y51 V52	I44-D48 WeakPolarHBondContact O-CB 3.39Å; I44-D48 PolarHBondContact O-N 3.29Å; D48-Y51 PolarHBondContact O-N 3.43Å; D48-V52 WeakPolarHBondContact O-CG2 3.41Å; D48-V52 PolarHBondContact O-N 3.14Å
49	Q	97.5	Very high	97.2	Very high	136 Å²	136	97.3 Å²	97.3	64%	0.636	50%	0.499	S	S	*	.	H	α-helix	trans	-64.1	-45.3	176.3	-78.3	175.7	-19.3	0	0	112.1	R45 I46 D47 Y51 V52 E53	R45-Q49 VanDerWaalsContact O-CG 3.28Å; R45-Q49 WeakPolarHBondContact O-CG 3.32Å; R45-Q49 PolarHBondContact O-N 3.3Å; R45-Q49 VanDerWaalsContact O-N 3.14Å; I46-Q49 PolarHBondContact O-N 3.4Å; D47-Q49 VanDerWaalsContact C-N 3.33Å; D47-Q49 PolarHBondContact O-N 3.44Å; Q49-Y51 VanDerWaalsContact C-N 3.31Å; Q49-Y51 PolarHBondContact O-N 3.34Å; Q49-V52 PolarHBondContact O-N 3.3Å; Q49-E53 WeakPolarHBondContact O-CB 3.37Å; Q49-E53 PolarHBondContact O-N 3.24Å
50	K	97.6	Very high	97.2	Very high	107 Å²	107	94.8 Å²	94.8	47%	0.465	49%	0.49	S	S	.	.	H	α-helix	trans	-59.7	-43.3	175.6	-72.4	172.7	-174.9	166.8	0	111.4	I46 D47 V52 E53 E54	I46-K50 HydrophobicContact CG2-CD 4.39Å; I46-K50 WeakPolarHBondContact O-CG 3.47Å; I46-K50 PolarHBondContact O-N 3.04Å; D47-K50 PolarHBondContact O-N 3.47Å; D47-K50 IonicContact OD1-NZ 2.71Å; K50-V52 PolarHBondContact O-N 3.02Å; K50-E53 PolarHBondContact O-N 3.48Å; K50-E54 WeakPolarHBondContact O-CB 3.48Å; K50-E54 WeakPolarHBondContact O-CG 3.46Å; K50-E54 PolarHBondContact O-N 3.02Å
51	Y	96.8	Very high	97.2	Very high	142 Å²	142	96.2 Å²	96.2	56%	0.557	49%	0.489	S	S	*	.	H	α-helix	trans	-61.3	-44.4	178.2	179.8	-107.5	0	0	0	112	D47 D48 Q49 E53 E54 L55	D47-Y51 WeakPolarHBondContact O-CB 3.28Å; D47-Y51 PolarHBondContact O-N 2.93Å; D48-Y51 PolarHBondContact O-N 3.43Å; Q49-Y51 VanDerWaalsContact C-N 3.31Å; Q49-Y51 PolarHBondContact O-N 3.34Å; Y51-E53 PolarHBondContact O-N 3.02Å; Y51-E54 PolarHBondContact O-N 3.43Å; Y51-L55 HydrophobicContact CD1-CD1 3.99Å; Y51-L55 HydrophobicContact CE1-CD1 3.43Å; Y51-L55 VanDerWaalsContact CE1-CD1 3.43Å; Y51-L55 HydrophobicContact CE1-CG 4.24Å; Y51-L55 HydrophobicContact CE2-CD1 4.42Å; Y51-L55 HydrophobicContact CE2-CG 4.42Å; Y51-L55 WeakPolarHBondContact O-CG 3.4Å; Y51-L55 PolarHBondContact O-N 2.88Å
52	V	96.9	Very high	97.2	Very high	95 Å²	95	96.1 Å²	96.1	58%	0.576	49%	0.494	S	S	*	.	H	α-helix	trans	-64.6	-39.3	176.2	172.4	0	0	0	0	111.8	D48 Q49 K50 L55 A56	D48-V52 WeakPolarHBondContact O-CG2 3.41Å; D48-V52 PolarHBondContact O-N 3.14Å; Q49-V52 PolarHBondContact O-N 3.3Å; K50-V52 PolarHBondContact O-N 3.02Å; V52-L55 PolarHBondContact O-N 3.49Å; V52-A56 WeakPolarHBondContact O-CB 3.36Å; V52-A56 PolarHBondContact O-N 2.99Å
53	E	97.5	Very high	97.1	Very high	128 Å²	128	93.5 Å²	93.5	60%	0.598	49%	0.488	S	S	*	.	H	α-helix	trans	-65.9	-42.5	177	-171.5	176.4	-177.2	0	0	112	Q49 K50 Y51 L55 A56 T57	Q49-E53 WeakPolarHBondContact O-CB 3.37Å; Q49-E53 PolarHBondContact O-N 3.24Å; K50-E53 PolarHBondContact O-N 3.48Å; Y51-E53 PolarHBondContact O-N 3.02Å; E53-L55 VanDerWaalsContact C-N 3.33Å; E53-L55 PolarHBondContact O-N 3.25Å; E53-A56 PolarHBondContact O-N 3.46Å; E53-T57 WeakPolarHBondContact O-CB 3.25Å; E53-T57 VanDerWaalsContact O-CG2 3.25Å; E53-T57 WeakPolarHBondContact O-CG2 3.25Å; E53-T57 PolarHBondContact O-N 3.39Å; E53-T57 PolarHBondContact O-OG1 3.48Å
54	E	97.3	Very high	97.1	Very high	124 Å²	124	99 Å²	99	58%	0.579	50%	0.501	S	S	*	.	H	α-helix	trans	-61.5	-41	174	-75	177.8	-174.1	0	0	112	K50 Y51 T57 T58	K50-E54 WeakPolarHBondContact O-CB 3.48Å; K50-E54 WeakPolarHBondContact O-CG 3.46Å; K50-E54 PolarHBondContact O-N 3.02Å; Y51-E54 PolarHBondContact O-N 3.43Å; E54-T57 WeakPolarHBondContact CA-OG1 3.41Å; E54-T57 PolarHBondContact O-OG1 2.77Å; E54-T58 WeakPolarHBondContact O-CB 3.45Å; E54-T58 PolarHBondContact O-N 3.1Å; E54-T58 VanDerWaalsContact O-N 3.1Å; E54-T58 PolarHBondContact O-OG1 2.89Å
55	L	97.7	Very high	97.1	Very high	84 Å²	84	101.3 Å²	101.3	44%	0.44	51%	0.509	S	S	.	.	H	α-helix	trans	-64	-48.1	173.9	-73.3	178.6	0	0	0	111.8	Y51 V52 E53 T57 T58 V59	Y51-L55 HydrophobicContact CD1-CD1 3.99Å; Y51-L55 HydrophobicContact CE1-CD1 3.43Å; Y51-L55 VanDerWaalsContact CE1-CD1 3.43Å; Y51-L55 HydrophobicContact CE1-CG 4.24Å; Y51-L55 HydrophobicContact CE2-CD1 4.42Å; Y51-L55 HydrophobicContact CE2-CG 4.42Å; Y51-L55 WeakPolarHBondContact O-CG 3.4Å; Y51-L55 PolarHBondContact O-N 2.88Å; V52-L55 PolarHBondContact O-N 3.49Å; E53-L55 VanDerWaalsContact C-N 3.33Å; E53-L55 PolarHBondContact O-N 3.25Å; L55-T57 PolarHBondContact O-N 2.95Å; L55-T58 PolarHBondContact O-N 2.9Å; L55-V59 WeakPolarHBondContact O-CG2 3.45Å; L55-V59 PolarHBondContact O-N 3.21Å
56	A	96.9	Very high	97	Very high	46 Å²	46	99.4 Å²	99.4	38%	0.38	51%	0.507	S	S	.	.	H	α-helix	trans	-59.9	-47.7	179.8	0	0	0	0	0	111.5	V52 E53 T58 V59 E60	V52-A56 WeakPolarHBondContact O-CB 3.36Å; V52-A56 PolarHBondContact O-N 2.99Å; E53-A56 PolarHBondContact O-N 3.46Å; A56-T58 VanDerWaalsContact C-N 3.27Å; A56-T58 PolarHBondContact O-N 3.31Å; A56-V59 PolarHBondContact O-N 3.31Å; A56-E60 WeakPolarHBondContact O-CG 3.4Å; A56-E60 PolarHBondContact O-N 2.93Å
57	T	97.3	Very high	96.9	Very high	51 Å²	51	99.8 Å²	99.8	31%	0.313	51%	0.51	S	S	.	.	H	α-helix	trans	-63.4	-32.6	178.8	56.1	0	0	0	0	112.7	E53 E54 L55 K61	E53-T57 WeakPolarHBondContact O-CB 3.25Å; E53-T57 VanDerWaalsContact O-CG2 3.25Å; E53-T57 WeakPolarHBondContact O-CG2 3.25Å; E53-T57 PolarHBondContact O-N 3.39Å; E53-T57 PolarHBondContact O-OG1 3.48Å; E54-T57 WeakPolarHBondContact CA-OG1 3.41Å; E54-T57 PolarHBondContact O-OG1 2.77Å; L55-T57 PolarHBondContact O-N 2.95Å; T57-K61 WeakPolarHBondContact O-CB 3.49Å; T57-K61 VanDerWaalsContact O-CG 3.25Å; T57-K61 WeakPolarHBondContact O-CG 3.46Å; T57-K61 PolarHBondContact O-N 3.26Å
58	T	97.2	Very high	96.8	Very high	86 Å²	86	102 Å²	102	53%	0.528	52%	0.519	S	S	.	.	H	α-helix	trans	-69.4	-44.7	175.4	-59.4	0	0	0	0	111.4	E54 L55 A56 E60 K61 A62	E54-T58 WeakPolarHBondContact O-CB 3.45Å; E54-T58 PolarHBondContact O-N 3.1Å; E54-T58 VanDerWaalsContact O-N 3.1Å; E54-T58 PolarHBondContact O-OG1 2.89Å; L55-T58 PolarHBondContact O-N 2.9Å; A56-T58 VanDerWaalsContact C-N 3.27Å; A56-T58 PolarHBondContact O-N 3.31Å; T58-E60 VanDerWaalsContact C-N 3.34Å; T58-E60 PolarHBondContact O-N 2.96Å; T58-K61 PolarHBondContact O-N 3Å; T58-A62 PolarHBondContact O-N 3.02Å
59	V	96.6	Very high	96.7	Very high	103 Å²	103	104.4 Å²	104.4	62%	0.624	53%	0.525	S	S	*	.	H	α-helix	trans	-61.6	-43.2	175.7	172.9	0	0	0	0	110.9	L55 A56 K61 A62 A63	L55-V59 WeakPolarHBondContact O-CG2 3.45Å; L55-V59 PolarHBondContact O-N 3.21Å; A56-V59 PolarHBondContact O-N 3.31Å; V59-K61 VanDerWaalsContact C-N 3.35Å; V59-K61 PolarHBondContact O-N 2.93Å; V59-A62 PolarHBondContact O-N 3.27Å; V59-A63 WeakPolarHBondContact O-CB 3.38Å; V59-A63 PolarHBondContact O-N 2.92Å
60	E	97.2	Very high	96.7	Very high	113 Å²	113	102.5 Å²	102.5	53%	0.528	52%	0.516	S	S	.	.	H	α-helix	trans	-63.3	-38.3	176.3	-73.8	178.5	-179.4	0	0	113	A56 T58 R64	A56-E60 WeakPolarHBondContact O-CG 3.4Å; A56-E60 PolarHBondContact O-N 2.93Å; T58-E60 VanDerWaalsContact C-N 3.34Å; T58-E60 PolarHBondContact O-N 2.96Å; E60-R64 WeakPolarHBondContact O-CB 3.46Å; E60-R64 VanDerWaalsContact O-CG 3.32Å; E60-R64 WeakPolarHBondContact O-CG 3.45Å; E60-R64 PolarHBondContact O-N 3.01Å; E60-R64 PolarHBondContact O-NE 3.32Å
61	K	97.2	Very high	96.6	Very high	114 Å²	114	103 Å²	103	50%	0.496	52%	0.523	S	S	.	.	H	α-helix	trans	-63.3	-48.7	174	-76.9	171.2	-176.8	175.1	0	111.1	T57 T58 V59 A63 R64 E65	T57-K61 WeakPolarHBondContact O-CB 3.49Å; T57-K61 VanDerWaalsContact O-CG 3.25Å; T57-K61 WeakPolarHBondContact O-CG 3.46Å; T57-K61 PolarHBondContact O-N 3.26Å; T58-K61 PolarHBondContact O-N 3Å; V59-K61 VanDerWaalsContact C-N 3.35Å; V59-K61 PolarHBondContact O-N 2.93Å; K61-A63 VanDerWaalsContact C-N 3.35Å; K61-A63 PolarHBondContact O-N 3.16Å; K61-R64 PolarHBondContact O-N 3.42Å; K61-R64 VanDerWaalsContact O-N 3.16Å; K61-E65 WeakPolarHBondContact O-CG 3.33Å; K61-E65 PolarHBondContact O-N 3.45Å
62	A	96	Very high	96.6	Very high	55 Å²	55	103.6 Å²	103.6	46%	0.455	53%	0.525	S	S	.	.	H	α-helix	trans	-59.5	-44.4	178.2	0	0	0	0	0	112	T58 V59 R64 E65 E66	T58-A62 PolarHBondContact O-N 3.02Å; V59-A62 PolarHBondContact O-N 3.27Å; A62-R64 VanDerWaalsContact C-N 3.35Å; A62-R64 PolarHBondContact O-N 2.96Å; A62-E65 PolarHBondContact O-N 3.13Å; A62-E66 WeakPolarHBondContact O-CB 3.44Å; A62-E66 PolarHBondContact O-N 2.92Å
63	A	96.4	Very high	96.5	Very high	42 Å²	42	102.9 Å²	102.9	35%	0.347	52%	0.518	S	S	.	.	H	α-helix	trans	-62.8	-39.4	176.4	0	0	0	0	0	112.3	V59 K61 N67	V59-A63 WeakPolarHBondContact O-CB 3.38Å; V59-A63 PolarHBondContact O-N 2.92Å; K61-A63 VanDerWaalsContact C-N 3.35Å; K61-A63 PolarHBondContact O-N 3.16Å; A63-N67 WeakPolarHBondContact O-CB 3.32Å; A63-N67 PolarHBondContact O-N 3.32Å; A63-N67 PolarHBondContact O-ND2 3.44Å; A63-N67 VanDerWaalsContact O-ND2 3.13Å
64	R	96.6	Very high	96.4	Very high	144 Å²	144	100.3 Å²	100.3	54%	0.543	51%	0.511	S	S	.	.	H	α-helix	trans	-65.3	-44	175.2	-78.2	-174.8	-66.2	-164.6	-3.9	112.4	E60 K61 A62 N67 M68	E60-R64 WeakPolarHBondContact O-CB 3.46Å; E60-R64 VanDerWaalsContact O-CG 3.32Å; E60-R64 WeakPolarHBondContact O-CG 3.45Å; E60-R64 PolarHBondContact O-N 3.01Å; E60-R64 PolarHBondContact O-NE 3.32Å; K61-R64 PolarHBondContact O-N 3.42Å; K61-R64 VanDerWaalsContact O-N 3.16Å; A62-R64 VanDerWaalsContact C-N 3.35Å; A62-R64 PolarHBondContact O-N 2.96Å; R64-N67 PolarHBondContact O-N 3.36Å; R64-M68 WeakPolarHBondContact O-CG 3.44Å; R64-M68 PolarHBondContact O-N 3.11Å
65	E	96.1	Very high	96.4	Very high	137 Å²	137	98.6 Å²	98.6	64%	0.64	51%	0.51	S	S	*	.	H	α-helix	trans	-62.8	-43.2	177	-73.6	176.5	-168.6	0	0	111.7	K61 A62 M68 K69	K61-E65 WeakPolarHBondContact O-CG 3.33Å; K61-E65 PolarHBondContact O-N 3.45Å; A62-E65 PolarHBondContact O-N 3.13Å; E65-M68 PolarHBondContact O-N 3.44Å; E65-K69 PolarHBondContact O-N 3.02Å
66	E	96	Very high	96.3	Very high	114 Å²	114	101 Å²	101	53%	0.533	52%	0.517	S	S	.	.	H	α-helix	trans	-61.5	-48.1	175.3	-173.1	-178	175.9	0	0	111.4	A62 M68 K69 Q70	A62-E66 WeakPolarHBondContact O-CB 3.44Å; A62-E66 PolarHBondContact O-N 2.92Å; E66-M68 VanDerWaalsContact C-N 3.29Å; E66-M68 PolarHBondContact O-N 3.35Å; E66-K69 WeakPolarHBondContact O-CB 3.37Å; E66-K69 PolarHBondContact O-N 2.97Å; E66-K69 VanDerWaalsContact O-N 3.11Å; E66-Q70 WeakPolarHBondContact O-CG 3.32Å; E66-Q70 PolarHBondContact O-N 2.99Å; E66-Q70 PolarHBondContact OE1-NE2 3.35Å
67	N	95.5	Very high	96.2	Very high	87 Å²	87	107 Å²	107	47%	0.465	53%	0.534	S	S	.	.	H	α-helix	trans	-58.7	-41.1	177.7	-74.5	-25.6	0	0	0	111.7	A63 R64 Q70 L71	A63-N67 WeakPolarHBondContact O-CB 3.32Å; A63-N67 PolarHBondContact O-N 3.32Å; A63-N67 PolarHBondContact O-ND2 3.44Å; A63-N67 VanDerWaalsContact O-ND2 3.13Å; R64-N67 PolarHBondContact O-N 3.36Å; N67-Q70 PolarHBondContact O-N 3.39Å; N67-L71 WeakPolarHBondContact O-CG 3.44Å; N67-L71 PolarHBondContact O-N 2.95Å
68	M	95.5	Very high	96.1	Very high	138 Å²	138	109.4 Å²	109.4	68%	0.68	54%	0.544	S	S	*	.	H	α-helix	trans	-62.5	-42.5	175.2	-77.3	-176.1	155	0	0	112.4	R64 E65 E66 L71 Y72	R64-M68 WeakPolarHBondContact O-CG 3.44Å; R64-M68 PolarHBondContact O-N 3.11Å; E65-M68 PolarHBondContact O-N 3.44Å; E66-M68 VanDerWaalsContact C-N 3.29Å; E66-M68 PolarHBondContact O-N 3.35Å; M68-L71 PolarHBondContact O-N 2.99Å; M68-Y72 PolarHBondContact O-N 3.21Å; M68-Y72 VanDerWaalsContact O-N 3.07Å
69	K	95.5	Very high	96	Very high	146 Å²	146	108.1 Å²	108.1	64%	0.635	54%	0.542	S	S	*	.	H	α-helix	trans	-62.1	-44.1	176.5	-172.4	-176	174.9	-162.1	0	111.4	E65 E66 L71 Y72 D73	E65-K69 PolarHBondContact O-N 3.02Å; E66-K69 WeakPolarHBondContact O-CB 3.37Å; E66-K69 PolarHBondContact O-N 2.97Å; E66-K69 VanDerWaalsContact O-N 3.11Å; K69-L71 VanDerWaalsContact C-N 3.35Å; K69-L71 PolarHBondContact O-N 3.49Å; K69-Y72 PolarHBondContact O-N 3.45Å; K69-D73 PolarHBondContact O-N 2.92Å
70	Q	96.4	Very high	95.9	Very high	97 Å²	97	105 Å²	105	45%	0.453	53%	0.531	S	S	.	.	H	α-helix	trans	-62.1	-40	176.1	-67.6	-178	8.5	0	0	112.1	E66 N67 Y72 D73 T74	E66-Q70 WeakPolarHBondContact O-CG 3.32Å; E66-Q70 PolarHBondContact O-N 2.99Å; E66-Q70 PolarHBondContact OE1-NE2 3.35Å; N67-Q70 PolarHBondContact O-N 3.39Å; Q70-Y72 VanDerWaalsContact C-N 3.33Å; Q70-Y72 PolarHBondContact O-N 3.07Å; Q70-D73 PolarHBondContact O-N 2.96Å; Q70-T74 WeakPolarHBondContact O-CB 3.26Å; Q70-T74 VanDerWaalsContact O-CG2 3.26Å; Q70-T74 WeakPolarHBondContact O-CG2 3.46Å; Q70-T74 PolarHBondContact O-N 3.05Å; Q70-T74 PolarHBondContact O-OG1 2.9Å
71	L	96.4	Very high	95.6	Very high	116 Å²	116	107.5 Å²	107.5	61%	0.607	54%	0.535	S	S	*	.	H	α-helix	trans	-62.2	-37.7	174.7	-72.6	172.5	0	0	0	112.6	N67 M68 K69 T74 T75	N67-L71 WeakPolarHBondContact O-CG 3.44Å; N67-L71 PolarHBondContact O-N 2.95Å; M68-L71 PolarHBondContact O-N 2.99Å; K69-L71 VanDerWaalsContact C-N 3.35Å; K69-L71 PolarHBondContact O-N 3.49Å; L71-T74 WeakPolarHBondContact CA-OG1 3.4Å; L71-T74 PolarHBondContact O-OG1 3.01Å; L71-T75 WeakPolarHBondContact O-CB 3.41Å; L71-T75 PolarHBondContact O-N 3.38Å; L71-T75 VanDerWaalsContact O-N 3.15Å; L71-T75 PolarHBondContact O-OG1 2.76Å
72	Y	95.9	Very high	95.3	Very high	156 Å²	156	106.4 Å²	106.4	61%	0.612	54%	0.535	S	S	*	.	H	α-helix	trans	-67.8	-46.9	175.4	179.5	-95.6	0	0	0	111.9	M68 K69 Q70 T74 T75 K76	M68-Y72 PolarHBondContact O-N 3.21Å; M68-Y72 VanDerWaalsContact O-N 3.07Å; K69-Y72 PolarHBondContact O-N 3.45Å; Q70-Y72 VanDerWaalsContact C-N 3.33Å; Q70-Y72 PolarHBondContact O-N 3.07Å; Y72-T74 PolarHBondContact O-N 3.45Å; Y72-T75 PolarHBondContact O-N 3.3Å; Y72-K76 HydrophobicContact CE1-CD 4.17Å; Y72-K76 WeakPolarHBondContact O-CB 3.41Å; Y72-K76 PolarHBondContact O-N 3.26Å
73	D	95.4	Very high	95.1	Very high	79 Å²	79	110.7 Å²	110.7	42%	0.422	55%	0.545	S	S	.	.	H	α-helix	trans	-63.7	-40	-179	-73.6	-25.8	0	0	0	112.1	K69 Q70 K76 K77	K69-D73 PolarHBondContact O-N 2.92Å; Q70-D73 PolarHBondContact O-N 2.96Å; D73-K76 PolarHBondContact O-N 3.39Å; D73-K77 WeakPolarHBondContact O-CB 3.38Å; D73-K77 PolarHBondContact O-N 3.28Å
74	T	96.3	Very high	94.9	Very high	75 Å²	75	111.8 Å²	111.8	46%	0.46	55%	0.551	S	S	.	*	H	α-helix	trans	-64	-44.2	174.9	51.2	0	0	0	0	111.7	Q70 L71 Y72 K77 L78	Q70-T74 WeakPolarHBondContact O-CB 3.26Å; Q70-T74 VanDerWaalsContact O-CG2 3.26Å; Q70-T74 WeakPolarHBondContact O-CG2 3.46Å; Q70-T74 PolarHBondContact O-N 3.05Å; Q70-T74 PolarHBondContact O-OG1 2.9Å; L71-T74 WeakPolarHBondContact CA-OG1 3.4Å; L71-T74 PolarHBondContact O-OG1 3.01Å; Y72-T74 PolarHBondContact O-N 3.45Å; T74-K77 WeakPolarHBondContact O-CB 3.46Å; T74-K77 PolarHBondContact O-N 3.15Å; T74-L78 WeakPolarHBondContact O-CG 3.48Å; T74-L78 PolarHBondContact O-N 3.05Å
75	T	95.9	Very high	94.6	Very high	88 Å²	88	109.1 Å²	109.1	54%	0.54	55%	0.547	S	S	.	.	H	α-helix	trans	-62.5	-45.3	176.8	-57.3	0	0	0	0	111.7	L71 Y72 K77 L78 A79	L71-T75 WeakPolarHBondContact O-CB 3.41Å; L71-T75 PolarHBondContact O-N 3.38Å; L71-T75 VanDerWaalsContact O-N 3.15Å; L71-T75 PolarHBondContact O-OG1 2.76Å; Y72-T75 PolarHBondContact O-N 3.3Å; T75-K77 VanDerWaalsContact C-N 3.3Å; T75-K77 PolarHBondContact O-N 2.9Å; T75-L78 PolarHBondContact O-N 2.98Å; T75-A79 PolarHBondContact O-N 3.2Å
76	K	95.8	Very high	94.3	Very high	135 Å²	135	106 Å²	106	59%	0.587	54%	0.537	S	S	*	.	H	α-helix	trans	-60.1	-40	176.5	-176.3	176.5	179.3	179.7	0	111.8	Y72 D73 G80	Y72-K76 HydrophobicContact CE1-CD 4.17Å; Y72-K76 WeakPolarHBondContact O-CB 3.41Å; Y72-K76 PolarHBondContact O-N 3.26Å; D73-K76 PolarHBondContact O-N 3.39Å; K76-G80 PolarHBondContact O-N 3.44Å
77	K	95.6	Very high	94.1	Very high	171 Å²	171	106.9 Å²	106.9	74%	0.743	54%	0.539	S	S	*	.	H	α-helix	trans	-64.5	-40.9	176.1	-172.4	177.9	-178.3	179.4	0	112.1	D73 T74 T75 R81	D73-K77 WeakPolarHBondContact O-CB 3.38Å; D73-K77 PolarHBondContact O-N 3.28Å; T74-K77 WeakPolarHBondContact O-CB 3.46Å; T74-K77 PolarHBondContact O-N 3.15Å; T75-K77 VanDerWaalsContact C-N 3.3Å; T75-K77 PolarHBondContact O-N 2.9Å; K77-R81 PolarHBondContact O-N 3.09Å; K77-R81 VanDerWaalsContact O-N 3.09Å
78	L	95.3	Very high	93.9	Very high	102 Å²	102	110.3 Å²	110.3	53%	0.534	55%	0.55	S	S	.	.	H	α-helix	trans	-64.9	-49.3	176.1	-69.8	174.2	0	0	0	111.7	T74 T75 G80 R81 D82	T74-L78 WeakPolarHBondContact O-CG 3.48Å; T74-L78 PolarHBondContact O-N 3.05Å; T75-L78 PolarHBondContact O-N 2.98Å; L78-G80 VanDerWaalsContact C-N 3.3Å; L78-G80 PolarHBondContact O-N 3.43Å; L78-R81 WeakPolarHBondContact O-CA 3.46Å; L78-R81 WeakPolarHBondContact O-CB 3.47Å; L78-R81 PolarHBondContact O-N 2.63Å; L78-D82 PolarHBondContact O-N 3.03Å
79	A	94.2	Very high	93.7	Very high	58 Å²	58	108.5 Å²	108.5	48%	0.479	54%	0.54	S	S	.	.	H	α-helix	trans	-58	-41.2	177.7	0	0	0	0	0	112.5	T75 D82 Q83	T75-A79 PolarHBondContact O-N 3.2Å; A79-D82 PolarHBondContact O-N 3.3Å; A79-Q83 WeakPolarHBondContact O-CB 3.41Å; A79-Q83 PolarHBondContact O-N 2.98Å
80	G	94	Very high	93.4	Very high	37 Å²	37	110 Å²	110	38%	0.381	54%	0.541	S	S	.	.	H	α-helix	trans	-63.6	-39.2	174.7	0	0	0	0	0	113	K76 L78 S84	K76-G80 PolarHBondContact O-N 3.44Å; L78-G80 VanDerWaalsContact C-N 3.3Å; L78-G80 PolarHBondContact O-N 3.43Å; G80-S84 WeakPolarHBondContact O-CB 3.5Å; G80-S84 PolarHBondContact O-N 3.46Å
81	R	93	Very high	93.1	Very high	166 Å²	166	111.9 Å²	111.9	63%	0.626	55%	0.548	S	S	*	.	H	α-helix	trans	-64.8	-46.7	175.5	-173.6	-179.9	178.7	-174.6	-1.2	111.1	K77 L78 Q83 S84 L85	K77-R81 PolarHBondContact O-N 3.09Å; K77-R81 VanDerWaalsContact O-N 3.09Å; L78-R81 WeakPolarHBondContact O-CA 3.46Å; L78-R81 WeakPolarHBondContact O-CB 3.47Å; L78-R81 PolarHBondContact O-N 2.63Å; R81-Q83 PolarHBondContact O-N 3.39Å; R81-S84 WeakPolarHBondContact O-CB 3.32Å; R81-S84 PolarHBondContact O-N 2.96Å; R81-S84 VanDerWaalsContact O-N 3.1Å; R81-S84 PolarHBondContact O-OG 2.95Å; R81-L85 HydrophobicContact CG-CD1 4.36Å; R81-L85 WeakPolarHBondContact O-CG 3.41Å; R81-L85 PolarHBondContact O-N 3.1Å
82	D	90.1	Very high	92.6	Very high	92 Å²	92	109.1 Å²	109.1	49%	0.492	54%	0.539	S	S	.	.	H	α-helix	trans	-64.6	-40.4	-179.9	-64.8	-24.9	0	0	0	111.8	L78 A79 S84 L85 T86	L78-D82 PolarHBondContact O-N 3.03Å; A79-D82 PolarHBondContact O-N 3.3Å; D82-S84 VanDerWaalsContact C-N 3.29Å; D82-S84 PolarHBondContact O-N 3.03Å; D82-L85 PolarHBondContact O-N 3.17Å; D82-T86 VanDerWaalsContact O-CG2 3.32Å; D82-T86 WeakPolarHBondContact O-CG2 3.4Å; D82-T86 PolarHBondContact O-N 3.04Å; D82-T86 PolarHBondContact O-OG1 2.94Å; D82-T86 VanDerWaalsContact O-OG1 3.08Å
83	Q	91.5	Very high	92.2	Very high	144 Å²	144	108 Å²	108	67%	0.673	53%	0.533	S	S	*	.	H	α-helix	trans	-61.4	-38.2	172.7	-166.9	-176.4	30.6	0	0	112	A79 R81 T86 K87	A79-Q83 WeakPolarHBondContact O-CB 3.41Å; A79-Q83 PolarHBondContact O-N 2.98Å; R81-Q83 PolarHBondContact O-N 3.39Å; Q83-T86 WeakPolarHBondContact CA-OG1 3.32Å; Q83-T86 PolarHBondContact O-OG1 2.93Å; Q83-K87 WeakPolarHBondContact O-CB 3.41Å; Q83-K87 PolarHBondContact O-N 3.27Å
84	S	92.1	Very high	91.7	Very high	65 Å²	65	113.8 Å²	113.8	46%	0.455	55%	0.549	S	S	.	.	H	α-helix	trans	-68	-39.6	177.2	80	0	0	0	0	112.3	G80 R81 D82 K87 K88	G80-S84 WeakPolarHBondContact O-CB 3.5Å; G80-S84 PolarHBondContact O-N 3.46Å; R81-S84 WeakPolarHBondContact O-CB 3.32Å; R81-S84 PolarHBondContact O-N 2.96Å; R81-S84 VanDerWaalsContact O-N 3.1Å; R81-S84 PolarHBondContact O-OG 2.95Å; D82-S84 VanDerWaalsContact C-N 3.29Å; D82-S84 PolarHBondContact O-N 3.03Å; S84-K87 PolarHBondContact O-N 2.91Å; S84-K88 WeakPolarHBondContact O-CB 3.38Å; S84-K88 PolarHBondContact O-N 2.86Å
85	L	91	Very high	91	Very high	89 Å²	89	119 Å²	119	47%	0.466	57%	0.566	S	S	.	*	H	α-helix	trans	-65.8	-48.8	177.8	-70.7	174.5	0	0	0	110.8	R81 D82 K87 K88 E89	R81-L85 HydrophobicContact CG-CD1 4.36Å; R81-L85 WeakPolarHBondContact O-CG 3.41Å; R81-L85 PolarHBondContact O-N 3.1Å; D82-L85 PolarHBondContact O-N 3.17Å; L85-K87 VanDerWaalsContact C-N 3.33Å; L85-K87 PolarHBondContact O-N 3.08Å; L85-K88 PolarHBondContact O-N 3.24Å; L85-K88 VanDerWaalsContact O-N 3.17Å; L85-E89 WeakPolarHBondContact O-CB 3.42Å; L85-E89 PolarHBondContact O-N 3.47Å
86	T	89.8	Confident	90.4	Very high	70 Å²	70	122.5 Å²	122.5	43%	0.429	57%	0.573	S	S	.	*	H	α-helix	trans	-60.9	-40.6	176.9	55.9	0	0	0	0	111.9	D82 Q83 E89 R90	D82-T86 VanDerWaalsContact O-CG2 3.32Å; D82-T86 WeakPolarHBondContact O-CG2 3.4Å; D82-T86 PolarHBondContact O-N 3.04Å; D82-T86 PolarHBondContact O-OG1 2.94Å; D82-T86 VanDerWaalsContact O-OG1 3.08Å; Q83-T86 WeakPolarHBondContact CA-OG1 3.32Å; Q83-T86 PolarHBondContact O-OG1 2.93Å; T86-E89 PolarHBondContact O-N 3.4Å; T86-R90 WeakPolarHBondContact O-CB 3.5Å; T86-R90 VanDerWaalsContact O-CG 3.27Å; T86-R90 WeakPolarHBondContact O-CG 3.27Å; T86-R90 PolarHBondContact O-N 3.39Å
87	K	92	Very high	89.6	Confident	134 Å²	134	122.5 Å²	122.5	58%	0.583	58%	0.58	S	S	*	*	H	α-helix	trans	-64.4	-41.7	175	-170.9	175.9	-175.4	175.9	0	112	Q83 S84 L85 K91	Q83-K87 WeakPolarHBondContact O-CB 3.41Å; Q83-K87 PolarHBondContact O-N 3.27Å; S84-K87 PolarHBondContact O-N 2.91Å; L85-K87 VanDerWaalsContact C-N 3.33Å; L85-K87 PolarHBondContact O-N 3.08Å; K87-K91 WeakPolarHBondContact O-CG 3.46Å; K87-K91 PolarHBondContact O-N 3.45Å
88	K	90.5	Very high	88.3	Confident	159 Å²	159	117.8 Å²	117.8	69%	0.691	58%	0.58	S	S	*	*	H	α-helix	trans	-64.6	-42	176.6	-170.8	175.2	-177.9	178	0	111.2	S84 L85 K91 S92	S84-K88 WeakPolarHBondContact O-CB 3.38Å; S84-K88 PolarHBondContact O-N 2.86Å; L85-K88 PolarHBondContact O-N 3.24Å; L85-K88 VanDerWaalsContact O-N 3.17Å; K88-K91 PolarHBondContact O-N 2.92Å; K88-S92 WeakPolarHBondContact O-CB 3.5Å; K88-S92 PolarHBondContact O-N 3.28Å
89	E	90.6	Very high	86.8	Confident	99 Å²	99	115.4 Å²	115.4	46%	0.463	58%	0.58	S	S	.	*	H	α-helix	trans	-65.8	-43.8	177.5	-162.4	-160.8	133	0	0	112	L85 T86 K91 S92 R93	L85-E89 WeakPolarHBondContact O-CB 3.42Å; L85-E89 PolarHBondContact O-N 3.47Å; T86-E89 PolarHBondContact O-N 3.4Å; E89-K91 VanDerWaalsContact C-N 3.34Å; E89-K91 PolarHBondContact O-N 3.42Å; E89-S92 PolarHBondContact O-N 2.89Å; E89-R93 WeakPolarHBondContact O-CG 3.41Å; E89-R93 PolarHBondContact O-N 3.11Å; E89-R93 IonicContact OE1-CZ 3.71Å; E89-R93 IonicContact OE1-NE 3.99Å; E89-R93 PolarHBondContact OE1-NE 3.07Å; E89-R93 IonicContact OE1-NH2 3.28Å; E89-R93 PolarHBondContact OE1-NH2 3.06Å; E89-R93 IonicContact OE2-NH2 3.16Å
90	R	90.6	Very high	85.3	Confident	178 Å²	178	120.3 Å²	120.3	67%	0.672	60%	0.598	S	S	*	*	H	α-helix	trans	-61	-40.9	174.7	-73.2	178.5	105.1	103.4	1.8	112.3	T86 R94	T86-R90 WeakPolarHBondContact O-CB 3.5Å; T86-R90 VanDerWaalsContact O-CG 3.27Å; T86-R90 WeakPolarHBondContact O-CG 3.27Å; T86-R90 PolarHBondContact O-N 3.39Å; R90-R94 PolarHBondContact O-N 3.42Å
91	K	89.5	Confident	83.7	Confident	136 Å²	136	126.9 Å²	126.9	59%	0.591	63%	0.625	S	S	*	*	H	α-helix	trans	-64.8	-43.8	174.4	-74.9	-175.2	178.5	-168.8	0	111.9	K87 K88 E89 R94 F95	K87-K91 WeakPolarHBondContact O-CG 3.46Å; K87-K91 PolarHBondContact O-N 3.45Å; K88-K91 PolarHBondContact O-N 2.92Å; E89-K91 VanDerWaalsContact C-N 3.34Å; E89-K91 PolarHBondContact O-N 3.42Å; K91-R94 WeakPolarHBondContact O-CB 3.46Å; K91-R94 PolarHBondContact O-N 2.94Å; K91-F95 PolarHBondContact O-N 3.26Å; K91-F95 VanDerWaalsContact O-N 3.11Å
92	S	86.7	Confident	82.1	Confident	59 Å²	59	122.4 Å²	122.4	41%	0.413	63%	0.63	S	S	.	*	H	α-helix	trans	-60.1	-46	176.3	179.3	0	0	0	0	112	K88 E89 R94 F95 K96	K88-S92 WeakPolarHBondContact O-CB 3.5Å; K88-S92 PolarHBondContact O-N 3.28Å; E89-S92 PolarHBondContact O-N 2.89Å; S92-R94 VanDerWaalsContact C-N 3.33Å; S92-R94 PolarHBondContact O-N 2.71Å; S92-F95 PolarHBondContact O-N 3.19Å; S92-K96 PolarHBondContact O-N 3.27Å
93	R	86.4	Confident	80.8	Confident	131 Å²	131	127.1 Å²	127.1	49%	0.494	65%	0.649	S	S	.	*	H	α-helix	trans	-59.3	-41.6	174.2	-76.3	-171.4	-91.3	179.6	-11.4	112.5	E89 F95 K96 N97	E89-R93 WeakPolarHBondContact O-CG 3.41Å; E89-R93 PolarHBondContact O-N 3.11Å; E89-R93 IonicContact OE1-CZ 3.71Å; E89-R93 IonicContact OE1-NE 3.99Å; E89-R93 PolarHBondContact OE1-NE 3.07Å; E89-R93 IonicContact OE1-NH2 3.28Å; E89-R93 PolarHBondContact OE1-NH2 3.06Å; E89-R93 IonicContact OE2-NH2 3.16Å; R93-F95 PolarHBondContact O-N 3.44Å; R93-K96 PolarHBondContact O-N 3.14Å; R93-N97 PolarHBondContact O-N 3.48Å; R93-N97 VanDerWaalsContact O-N 3.14Å
94	R	85.4	Confident	79.5	Confident	201 Å²	201	127.9 Å²	127.9	76%	0.758	66%	0.658	S	S	*	*	H	α-helix	trans	-61.8	-40.5	177.4	-170.1	-175.1	-62.8	-169.4	-3.5	112.5	R90 K91 S92 G98	R90-R94 PolarHBondContact O-N 3.42Å; K91-R94 WeakPolarHBondContact O-CB 3.46Å; K91-R94 PolarHBondContact O-N 2.94Å; S92-R94 VanDerWaalsContact C-N 3.33Å; S92-R94 PolarHBondContact O-N 2.71Å; R94-G98 PolarHBondContact O-N 3.32Å
95	F	82.2	Confident	78.3	Confident	186 Å²	186	130.5 Å²	130.5	82%	0.816	67%	0.671	S	S	*	*	H	α-helix	trans	-65	-41.5	177.2	-179.7	-102	0	0	0	112	K91 S92 R93 N97 G98	K91-F95 PolarHBondContact O-N 3.26Å; K91-F95 VanDerWaalsContact O-N 3.11Å; S92-F95 PolarHBondContact O-N 3.19Å; R93-F95 PolarHBondContact O-N 3.44Å; F95-N97 PolarHBondContact O-N 3.48Å; F95-G98 PolarHBondContact O-N 3.46Å
96	K	81.3	Confident	77.4	Confident	160 Å²	160	130.7 Å²	130.7	70%	0.696	68%	0.68	S	S	*	*	H	α-helix	trans	-65.9	-35.3	179	-68.5	-175.7	178.8	-172.6	0	113.6	S92 R93 G98	S92-K96 PolarHBondContact O-N 3.27Å; R93-K96 PolarHBondContact O-N 3.14Å; K96-G98 VanDerWaalsContact C-N 3.32Å
97	N	79.1	Confident	76.6	Confident	136 Å²	136	138.9 Å²	138.9	73%	0.727	70%	0.703	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84	-4.2	-176.9	-64.8	-5	0	0	0	113.6	R93 F95 G99	R93-N97 PolarHBondContact O-N 3.48Å; R93-N97 VanDerWaalsContact O-N 3.14Å; F95-N97 PolarHBondContact O-N 3.48Å; N97-G99 PolarHBondContact O-N 3.49Å
98	G	69.9	Low	74.9	Confident	71 Å²	71	139.2 Å²	139.2	73%	0.732	71%	0.711	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.8	5.2	-172.4	0	0	0	0	0	116.3	R94 F95 K96	R94-G98 PolarHBondContact O-N 3.32Å; F95-G98 PolarHBondContact O-N 3.46Å; K96-G98 VanDerWaalsContact C-N 3.32Å
99	G	63.2	Low	73.8	Confident	53 Å²	53	141.4 Å²	141.4	55%	0.546	74%	0.744	S	S	.	*	S	Bend	trans	-148.4	95.1	-177.8	0	0	0	0	0	113	N97	N97-G99 PolarHBondContact O-N 3.49Å
100	N	62.2	Low	72.9	Confident	160 Å²	160	143.5 Å²	143.5	86%	0.856	76%	0.758	S	S	*	*			trans	176.8	54	145.2	-100.8	1.3	0	0	0	112.5
101	D	60.5	Low	72	Confident	176 Å²	176	141.7 Å²	141.7	94%	0.941	76%	0.763	S	S	*	*			trans	-127.8	81.3	171.5	-65.9	-39.7	0	0	0	109.3
102	G	59.1	Low	71	Confident	72 Å²	72	142 Å²	142	74%	0.742	77%	0.772	S	S	*	*			trans	-173.7	28.3	-176.4	0	0	0	0	0	117
103	Q	62.9	Low	70.1	Confident	190 Å²	190	146.9 Å²	146.9	89%	0.888	79%	0.794	S	S	*	*			trans	-138.9	77.5	162.7	-68.6	-165.7	1.1	0	0	109.8
104	N	63.7	Low	69.1	Low	160 Å²	160	147.9 Å²	147.9	86%	0.856	81%	0.812	S	S	*	*			trans	-119.5	75.9	151.4	-169.4	22.5	0	0	0	108	S106	N104-S106 PolarHBondContact O-N 3.2Å
105	T	67.1	Low	68	Low	120 Å²	120	144.3 Å²	144.3	74%	0.736	82%	0.816	S	S	*	*			trans	-73.4	105.1	168	51	0	0	0	0	107.6	R107	T105-R107 PolarHBondContact O-N 3.17Å; T105-R107 VanDerWaalsContact O-N 3.17Å
106	S	73.2	Confident	67	Low	93 Å²	93	141.4 Å²	141.4	65%	0.65	82%	0.816	S	S	*	*			trans	-41	117.8	163.2	176.9	0	0	0	0	110	N104 N108	N104-S106 PolarHBondContact O-N 3.2Å; S106-N108 PolarHBondContact O-N 3.23Å
107	R	72.6	Confident	65.9	Low	242 Å²	242	139.9 Å²	139.9	91%	0.913	83%	0.825	S	S	*	*			trans	-75	103.8	168.1	-74.9	-171.6	-159.8	111.3	4.3	107.5	T105	T105-R107 PolarHBondContact O-N 3.17Å; T105-R107 VanDerWaalsContact O-N 3.17Å
108	N	56.1	Low	64.8	Low	141 Å²	141	140.3 Å²	140.3	75%	0.754	83%	0.833	S	S	*	*			trans	-73.8	130.4	162.2	-77	12	0	0	0	109.4	S106	S106-N108 PolarHBondContact O-N 3.23Å
109	C	67.1	Low	64.3	Low	205 Å²	205	146.5 Å²	146.5	100%	1.385	84%	0.843	S	S	*	*			trans	-141.3	0	147	-76.6	0	0	0	0	107.2

Retrieved 109 of 109 residues in 37 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).