G4LZA2_SCHMA Loading...

Smp_204690

AlphaFold DB , UniProt , Accession G4LZA2, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 65 aa.

						>G4LZA2_SCHMA|G4LZA2
MKQLLRCLKLLIMCKKKANSLYNSVILQTVILNTKKLIILALKRVSKMNAISRLSRFFLVNPLKA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	64.6	Low	85	Confident	205 Å²	205	138.5 Å²	138.5	100%	1.01	67%	0.669	S	S	*	*				0	-3.8	0	-56.3	-154.5	-153.7	0	0	116.2	Q3	M1-Q3 VanDerWaalsContact C-N 3.28Å; M1-Q3 PolarHBondContact O-N 3.17Å
2	K	80	Confident	85.6	Confident	179 Å²	179	134.5 Å²	134.5	78%	0.778	65%	0.652	S	S	*	*	H	α-helix	trans	-66.3	-23.2	-177.9	-66.7	-178.9	179.7	176.7	0	114.8
3	Q	81.1	Confident	85.9	Confident	161 Å²	161	132.4 Å²	132.4	75%	0.752	64%	0.643	S	S	*	*	H	α-helix	trans	-74.1	-37.2	-177.5	-156.9	163.9	2.3	0	0	112.5	M1 L5 R6 C7	M1-Q3 VanDerWaalsContact C-N 3.28Å; M1-Q3 PolarHBondContact O-N 3.17Å; Q3-L5 VanDerWaalsContact C-N 3.33Å; Q3-L5 PolarHBondContact O-N 3.28Å; Q3-R6 PolarHBondContact O-N 3.28Å; Q3-C7 PolarHBondContact O-N 3.12Å; Q3-C7 PolarHBondContact O-SG 3.46Å
4	L	84.5	Confident	86.2	Confident	130 Å²	130	128.9 Å²	128.9	68%	0.681	64%	0.637	S	S	*	*	H	α-helix	trans	-59.3	-42.3	175.1	-73.4	169.2	0	0	0	111.9	R6 C7 L8	L4-R6 VanDerWaalsContact C-N 3.34Å; L4-R6 PolarHBondContact O-N 3.35Å; L4-C7 PolarHBondContact O-N 3.15Å; L4-L8 PolarHBondContact O-N 2.97Å; L4-L8 VanDerWaalsContact O-N 3.07Å
5	L	87.3	Confident	86.5	Confident	122 Å²	122	130.1 Å²	130.1	64%	0.639	64%	0.637	S	S	*	*	H	α-helix	trans	-64.8	-35	178.3	-68.7	172.8	0	0	0	112.8	Q3 K9	Q3-L5 VanDerWaalsContact C-N 3.33Å; Q3-L5 PolarHBondContact O-N 3.28Å; L5-K9 PolarHBondContact O-N 3Å
6	R	88.5	Confident	86.7	Confident	189 Å²	189	131.6 Å²	131.6	71%	0.713	64%	0.639	S	S	*	*	H	α-helix	trans	-66.4	-44	175.5	-70	-177.8	179.6	-179.7	-0.8	111.3	Q3 L4 L8 K9 L10	Q3-R6 PolarHBondContact O-N 3.28Å; L4-R6 VanDerWaalsContact C-N 3.34Å; L4-R6 PolarHBondContact O-N 3.35Å; R6-L8 PolarHBondContact O-N 3.33Å; R6-K9 PolarHBondContact O-N 2.91Å; R6-L10 WeakPolarHBondContact O-CG 3.39Å; R6-L10 PolarHBondContact O-N 3.22Å; R6-L10 VanDerWaalsContact O-N 3.15Å
7	C	88.2	Confident	86.8	Confident	69 Å²	69	132.4 Å²	132.4	47%	0.466	64%	0.639	S	S	.	*	H	α-helix	trans	-62.4	-41.8	177.7	-64.3	0	0	0	0	112.1	Q3 L4 K9 L10 L11	Q3-C7 PolarHBondContact O-N 3.12Å; Q3-C7 PolarHBondContact O-SG 3.46Å; L4-C7 PolarHBondContact O-N 3.15Å; C7-K9 VanDerWaalsContact C-N 3.35Å; C7-K9 PolarHBondContact O-N 3.07Å; C7-L10 PolarHBondContact O-N 2.9Å; C7-L11 WeakPolarHBondContact O-CG 3.4Å; C7-L11 PolarHBondContact O-N 3.44Å
8	L	91.1	Very high	86.8	Confident	100 Å²	100	127.4 Å²	127.4	52%	0.524	62%	0.623	S	S	.	*	H	α-helix	trans	-60.5	-43	177.4	-173.2	65.7	0	0	0	112.2	L4 R6 L10 L11 I12	L4-L8 PolarHBondContact O-N 2.97Å; L4-L8 VanDerWaalsContact O-N 3.07Å; R6-L8 PolarHBondContact O-N 3.33Å; L8-L10 VanDerWaalsContact C-N 3.33Å; L8-L10 PolarHBondContact O-N 3.42Å; L8-L11 PolarHBondContact O-N 3.23Å; L8-I12 HydrophobicContact CG-CD1 4.31Å; L8-I12 WeakPolarHBondContact O-CG1 3.43Å; L8-I12 PolarHBondContact O-N 2.95Å; L8-I12 VanDerWaalsContact O-N 3.1Å
9	K	91.6	Very high	86.8	Confident	144 Å²	144	125.6 Å²	125.6	63%	0.626	62%	0.616	S	S	*	*	H	α-helix	trans	-63	-39.5	176.9	-169.4	175.4	-178.6	177	0	112	L5 R6 C7 I12 M13	L5-K9 PolarHBondContact O-N 3Å; R6-K9 PolarHBondContact O-N 2.91Å; C7-K9 VanDerWaalsContact C-N 3.35Å; C7-K9 PolarHBondContact O-N 3.07Å; K9-I12 PolarHBondContact O-N 3.34Å; K9-M13 HydrophobicContact CG-CE 4.38Å; K9-M13 WeakPolarHBondContact O-CG 3.42Å; K9-M13 PolarHBondContact O-N 3.43Å
10	L	89.8	Confident	86.9	Confident	102 Å²	102	123.2 Å²	123.2	53%	0.534	61%	0.613	S	S	.	*	H	α-helix	trans	-65.3	-44	176	-69.9	172.8	0	0	0	111.8	R6 C7 L8 I12 M13 C14	R6-L10 WeakPolarHBondContact O-CG 3.39Å; R6-L10 PolarHBondContact O-N 3.22Å; R6-L10 VanDerWaalsContact O-N 3.15Å; C7-L10 PolarHBondContact O-N 2.9Å; L8-L10 VanDerWaalsContact C-N 3.33Å; L8-L10 PolarHBondContact O-N 3.42Å; L10-I12 VanDerWaalsContact C-N 3.3Å; L10-I12 PolarHBondContact O-N 3.15Å; L10-M13 HydrophobicContact CD2-CE 4.45Å; L10-M13 PolarHBondContact O-N 3.27Å; L10-C14 WeakPolarHBondContact O-CB 3.44Å; L10-C14 PolarHBondContact O-N 2.95Å; L10-C14 PolarHBondContact O-SG 3.43Å
11	L	88.6	Confident	86.9	Confident	122 Å²	122	122 Å²	122	64%	0.639	61%	0.608	S	S	*	*	H	α-helix	trans	-59	-41.7	176.7	-70.8	173.4	0	0	0	111.9	C7 L8 C14 K15	C7-L11 WeakPolarHBondContact O-CG 3.4Å; C7-L11 PolarHBondContact O-N 3.44Å; L8-L11 PolarHBondContact O-N 3.23Å; L11-C14 PolarHBondContact O-N 2.84Å; L11-K15 PolarHBondContact O-N 3.24Å
12	I	91.4	Very high	88.1	Confident	91 Å²	91	120.2 Å²	120.2	47%	0.467	59%	0.591	S	S	.	*	H	α-helix	trans	-65	-44.7	176.2	-64.8	166.4	0	0	0	111.2	L8 K9 L10 K15 K16	L8-I12 HydrophobicContact CG-CD1 4.31Å; L8-I12 WeakPolarHBondContact O-CG1 3.43Å; L8-I12 PolarHBondContact O-N 2.95Å; L8-I12 VanDerWaalsContact O-N 3.1Å; K9-I12 PolarHBondContact O-N 3.34Å; L10-I12 VanDerWaalsContact C-N 3.3Å; L10-I12 PolarHBondContact O-N 3.15Å; I12-K15 PolarHBondContact O-N 2.95Å; I12-K16 PolarHBondContact O-N 3.06Å; I12-K16 VanDerWaalsContact O-N 3.09Å
13	M	89.9	Confident	88.5	Confident	107 Å²	107	116.9 Å²	116.9	53%	0.527	58%	0.582	S	S	.	*	H	α-helix	trans	-63.7	-41.9	177.2	-73.8	-153	-86.6	0	0	112.1	K9 L10 K16 K17	K9-M13 HydrophobicContact CG-CE 4.38Å; K9-M13 WeakPolarHBondContact O-CG 3.42Å; K9-M13 PolarHBondContact O-N 3.43Å; L10-M13 HydrophobicContact CD2-CE 4.45Å; L10-M13 PolarHBondContact O-N 3.27Å; M13-K16 PolarHBondContact O-N 2.98Å; M13-K17 PolarHBondContact O-N 2.95Å
14	C	90.2	Very high	88.9	Confident	83 Å²	83	111.5 Å²	111.5	56%	0.561	56%	0.562	S	S	*	*	H	α-helix	trans	-61	-44.8	175.9	-71.9	0	0	0	0	111.9	L10 L11 K16 K17 A18	L10-C14 WeakPolarHBondContact O-CB 3.44Å; L10-C14 PolarHBondContact O-N 2.95Å; L10-C14 PolarHBondContact O-SG 3.43Å; L11-C14 PolarHBondContact O-N 2.84Å; C14-K16 PolarHBondContact O-N 3.49Å; C14-K17 PolarHBondContact O-N 3.4Å; C14-A18 WeakPolarHBondContact O-CB 3.5Å; C14-A18 PolarHBondContact O-N 2.89Å
15	K	91	Very high	89.2	Confident	148 Å²	148	109.1 Å²	109.1	64%	0.643	55%	0.553	S	S	*	*	H	α-helix	trans	-61.2	-43	176.9	-172.5	173.3	-177.9	175.6	0	112.1	L11 I12 A18 N19	L11-K15 PolarHBondContact O-N 3.24Å; I12-K15 PolarHBondContact O-N 2.95Å; K15-A18 PolarHBondContact O-N 3.46Å; K15-N19 PolarHBondContact O-N 3.25Å
16	K	89.4	Confident	89.4	Confident	153 Å²	153	107.8 Å²	107.8	67%	0.665	55%	0.545	S	S	*	.	H	α-helix	trans	-62.2	-44.3	175.6	-73.8	-174.1	177.5	-173.3	0	111.9	I12 M13 C14 N19 S20	I12-K16 PolarHBondContact O-N 3.06Å; I12-K16 VanDerWaalsContact O-N 3.09Å; M13-K16 PolarHBondContact O-N 2.98Å; C14-K16 PolarHBondContact O-N 3.49Å; K16-N19 PolarHBondContact O-N 2.97Å; K16-S20 PolarHBondContact O-N 3.26Å
17	K	88.1	Confident	89.4	Confident	145 Å²	145	103.8 Å²	103.8	63%	0.63	54%	0.538	S	S	*	.	H	α-helix	trans	-64.5	-42.2	177.7	-170.1	172.8	-177.8	178.2	0	111.7	M13 C14 S20 L21	M13-K17 PolarHBondContact O-N 2.95Å; C14-K17 PolarHBondContact O-N 3.4Å; K17-S20 PolarHBondContact O-N 3.38Å; K17-L21 HydrophobicContact CG-CD1 4.26Å; K17-L21 WeakPolarHBondContact O-CG 3.44Å; K17-L21 PolarHBondContact O-N 3.04Å
18	A	87.4	Confident	89.6	Confident	44 Å²	44	107 Å²	107	36%	0.364	55%	0.546	S	S	.	.	H	α-helix	trans	-60.6	-46.2	176.6	0	0	0	0	0	111.9	C14 K15 S20 L21 Y22	C14-A18 WeakPolarHBondContact O-CB 3.5Å; C14-A18 PolarHBondContact O-N 2.89Å; K15-A18 PolarHBondContact O-N 3.46Å; A18-S20 VanDerWaalsContact C-N 3.34Å; A18-S20 PolarHBondContact O-N 3.27Å; A18-L21 PolarHBondContact O-N 3.32Å; A18-Y22 PolarHBondContact O-N 3.41Å
19	N	87.5	Confident	89.7	Confident	92 Å²	92	105.5 Å²	105.5	49%	0.492	54%	0.541	S	S	.	.	H	α-helix	trans	-61.9	-41.7	175.8	-74.5	-0	0	0	0	112	K15 K16 Y22 N23	K15-N19 PolarHBondContact O-N 3.25Å; K16-N19 PolarHBondContact O-N 2.97Å; N19-Y22 PolarHBondContact O-N 3.11Å; N19-N23 WeakPolarHBondContact O-CB 3.4Å; N19-N23 VanDerWaalsContact O-CG 3.28Å; N19-N23 PolarHBondContact O-N 2.9Å
20	S	87.7	Confident	89.8	Confident	78 Å²	78	102.3 Å²	102.3	55%	0.545	53%	0.533	S	S	.	.	H	α-helix	trans	-62.3	-42.8	176.2	-172.4	0	0	0	0	112	K16 K17 A18 S24	K16-S20 PolarHBondContact O-N 3.26Å; K17-S20 PolarHBondContact O-N 3.38Å; A18-S20 VanDerWaalsContact C-N 3.34Å; A18-S20 PolarHBondContact O-N 3.27Å; S20-S24 WeakPolarHBondContact O-CB 3.08Å; S20-S24 PolarHBondContact O-N 2.88Å
21	L	86.5	Confident	89.9	Confident	97 Å²	97	101 Å²	101	51%	0.508	53%	0.526	S	S	.	.	H	α-helix	trans	-64.7	-46.7	177.2	-72.5	171.6	0	0	0	110.8	K17 A18 N23 S24 V25	K17-L21 HydrophobicContact CG-CD1 4.26Å; K17-L21 WeakPolarHBondContact O-CG 3.44Å; K17-L21 PolarHBondContact O-N 3.04Å; A18-L21 PolarHBondContact O-N 3.32Å; L21-N23 PolarHBondContact O-N 3.44Å; L21-S24 PolarHBondContact O-N 3.14Å; L21-S24 VanDerWaalsContact O-N 3.15Å; L21-S24 PolarHBondContact O-OG 2.95Å; L21-V25 WeakPolarHBondContact O-CG2 3.4Å; L21-V25 PolarHBondContact O-N 2.92Å
22	Y	90.2	Very high	90.1	Very high	169 Å²	169	99.8 Å²	99.8	66%	0.663	52%	0.519	S	S	*	.	H	α-helix	trans	-56.4	-48.9	175.6	-104.3	-85	0	0	0	112.2	A18 N19 S24 V25 I26	A18-Y22 PolarHBondContact O-N 3.41Å; N19-Y22 PolarHBondContact O-N 3.11Å; Y22-S24 VanDerWaalsContact C-N 3.27Å; Y22-S24 PolarHBondContact O-N 3.41Å; Y22-V25 PolarHBondContact O-N 3.08Å; Y22-I26 VanDerWaalsContact O-CG1 3.31Å; Y22-I26 WeakPolarHBondContact O-CG1 3.49Å; Y22-I26 PolarHBondContact O-N 3.22Å
23	N	89	Confident	90.2	Very high	109 Å²	109	99.3 Å²	99.3	58%	0.583	52%	0.518	S	S	*	.	H	α-helix	trans	-61.3	-38.1	178.4	-72.3	-6.9	0	0	0	111.8	N19 L21 L27	N19-N23 WeakPolarHBondContact O-CB 3.4Å; N19-N23 VanDerWaalsContact O-CG 3.28Å; N19-N23 PolarHBondContact O-N 2.9Å; L21-N23 PolarHBondContact O-N 3.44Å; N23-L27 VanDerWaalsContact O-CB 3.29Å; N23-L27 WeakPolarHBondContact O-CB 3.37Å; N23-L27 PolarHBondContact O-N 3.33Å
24	S	89.6	Confident	90.4	Very high	47 Å²	47	97.3 Å²	97.3	33%	0.329	51%	0.512	S	S	.	.	H	α-helix	trans	-65.4	-40.6	176.6	73.9	0	0	0	0	112.7	S20 L21 Y22 L27 Q28	S20-S24 WeakPolarHBondContact O-CB 3.08Å; S20-S24 PolarHBondContact O-N 2.88Å; L21-S24 PolarHBondContact O-N 3.14Å; L21-S24 VanDerWaalsContact O-N 3.15Å; L21-S24 PolarHBondContact O-OG 2.95Å; Y22-S24 VanDerWaalsContact C-N 3.27Å; Y22-S24 PolarHBondContact O-N 3.41Å; S24-L27 PolarHBondContact O-N 3.05Å; S24-Q28 WeakPolarHBondContact O-CG 3.3Å; S24-Q28 PolarHBondContact O-N 3.27Å
25	V	91.2	Very high	90.5	Very high	81 Å²	81	99.4 Å²	99.4	49%	0.491	51%	0.511	S	S	.	.	H	α-helix	trans	-67.8	-43.3	177.6	173.7	0	0	0	0	110.9	L21 Y22 L27 Q28 T29	L21-V25 WeakPolarHBondContact O-CG2 3.4Å; L21-V25 PolarHBondContact O-N 2.92Å; Y22-V25 PolarHBondContact O-N 3.08Å; V25-L27 VanDerWaalsContact C-N 3.35Å; V25-L27 PolarHBondContact O-N 3.47Å; V25-Q28 PolarHBondContact O-N 3.45Å; V25-T29 WeakPolarHBondContact O-CB 3.44Å; V25-T29 PolarHBondContact O-N 2.95Å; V25-T29 PolarHBondContact O-OG1 3.41Å
26	I	90	Very high	90.6	Very high	93 Å²	93	98.1 Å²	98.1	48%	0.477	51%	0.506	S	S	.	.	H	α-helix	trans	-59.7	-48.4	175.4	-67.2	166.3	0	0	0	109.6	Y22 Q28 T29 V30	Y22-I26 VanDerWaalsContact O-CG1 3.31Å; Y22-I26 WeakPolarHBondContact O-CG1 3.49Å; Y22-I26 PolarHBondContact O-N 3.22Å; I26-Q28 PolarHBondContact O-N 2.97Å; I26-T29 PolarHBondContact O-N 3.42Å; I26-T29 VanDerWaalsContact O-N 3.17Å; I26-V30 HydrophobicContact CG2-CG2 4.31Å; I26-V30 WeakPolarHBondContact O-CG2 3.42Å; I26-V30 PolarHBondContact O-N 3.22Å
27	L	89.9	Confident	90.6	Very high	106 Å²	106	96.4 Å²	96.4	56%	0.555	50%	0.503	S	S	*	.	H	α-helix	trans	-60	-46.1	179.4	-177.1	63.9	0	0	0	111.9	N23 S24 V25 T29 V30 I31	N23-L27 VanDerWaalsContact O-CB 3.29Å; N23-L27 WeakPolarHBondContact O-CB 3.37Å; N23-L27 PolarHBondContact O-N 3.33Å; S24-L27 PolarHBondContact O-N 3.05Å; V25-L27 VanDerWaalsContact C-N 3.35Å; V25-L27 PolarHBondContact O-N 3.47Å; L27-T29 VanDerWaalsContact C-N 3.3Å; L27-T29 PolarHBondContact O-N 3.01Å; L27-V30 PolarHBondContact O-N 3Å; L27-I31 HydrophobicContact CD1-CD1 4.16Å; L27-I31 HydrophobicContact CD1-CG1 4.43Å; L27-I31 HydrophobicContact CG-CD1 3.88Å; L27-I31 WeakPolarHBondContact O-CB 3.48Å; L27-I31 VanDerWaalsContact O-CG1 3.24Å; L27-I31 WeakPolarHBondContact O-CG1 3.46Å; L27-I31 PolarHBondContact O-N 2.91Å
28	Q	91.8	Very high	90.8	Very high	137 Å²	137	94.2 Å²	94.2	64%	0.64	50%	0.497	S	S	*	.	H	α-helix	trans	-60.4	-40.4	176.2	-75.8	-178.8	-0.3	0	0	112	S24 V25 I26 I31 L32	S24-Q28 WeakPolarHBondContact O-CG 3.3Å; S24-Q28 PolarHBondContact O-N 3.27Å; V25-Q28 PolarHBondContact O-N 3.45Å; I26-Q28 PolarHBondContact O-N 2.97Å; Q28-I31 PolarHBondContact O-N 3.34Å; Q28-L32 WeakPolarHBondContact O-CB 3.48Å; Q28-L32 PolarHBondContact O-N 3.3Å
29	T	92.2	Very high	90.9	Very high	68 Å²	68	96.4 Å²	96.4	42%	0.417	50%	0.502	S	S	.	.	H	α-helix	trans	-66.7	-42.9	178.6	-54	0	0	0	0	111.5	V25 I26 L27 L32 N33	V25-T29 WeakPolarHBondContact O-CB 3.44Å; V25-T29 PolarHBondContact O-N 2.95Å; V25-T29 PolarHBondContact O-OG1 3.41Å; I26-T29 PolarHBondContact O-N 3.42Å; I26-T29 VanDerWaalsContact O-N 3.17Å; L27-T29 VanDerWaalsContact C-N 3.3Å; L27-T29 PolarHBondContact O-N 3.01Å; T29-L32 PolarHBondContact O-N 3.5Å; T29-N33 PolarHBondContact O-N 3.4Å
30	V	93.7	Very high	91.1	Very high	76 Å²	76	96.9 Å²	96.9	46%	0.461	50%	0.504	S	S	.	.	H	α-helix	trans	-62.6	-44.6	174.9	172	0	0	0	0	110.8	I26 L27 L32 N33 T34	I26-V30 HydrophobicContact CG2-CG2 4.31Å; I26-V30 WeakPolarHBondContact O-CG2 3.42Å; I26-V30 PolarHBondContact O-N 3.22Å; L27-V30 PolarHBondContact O-N 3Å; V30-L32 VanDerWaalsContact C-N 3.32Å; V30-L32 PolarHBondContact O-N 2.92Å; V30-N33 PolarHBondContact O-N 2.85Å; V30-T34 HydrophobicContact CG1-CG2 4.33Å; V30-T34 WeakPolarHBondContact O-CB 3.4Å; V30-T34 WeakPolarHBondContact O-CG2 3.34Å; V30-T34 PolarHBondContact O-N 3.43Å; V30-T34 PolarHBondContact O-OG1 3.05Å
31	I	92.8	Very high	91.1	Very high	75 Å²	75	95.7 Å²	95.7	39%	0.385	50%	0.499	S	S	.	.	H	α-helix	trans	-61	-42.1	176.3	-69	166.5	0	0	0	110.9	L27 Q28 T34 K35	L27-I31 HydrophobicContact CD1-CD1 4.16Å; L27-I31 HydrophobicContact CD1-CG1 4.43Å; L27-I31 HydrophobicContact CG-CD1 3.88Å; L27-I31 WeakPolarHBondContact O-CB 3.48Å; L27-I31 VanDerWaalsContact O-CG1 3.24Å; L27-I31 WeakPolarHBondContact O-CG1 3.46Å; L27-I31 PolarHBondContact O-N 2.91Å; Q28-I31 PolarHBondContact O-N 3.34Å; I31-T34 WeakPolarHBondContact CA-OG1 3.34Å; I31-T34 PolarHBondContact O-OG1 3.5Å; I31-K35 HydrophobicContact CG2-CD 4.28Å; I31-K35 WeakPolarHBondContact O-CB 3.4Å; I31-K35 WeakPolarHBondContact O-CG 3.46Å; I31-K35 PolarHBondContact O-N 3.42Å
32	L	93.1	Very high	91.2	Very high	96 Å²	96	96.1 Å²	96.1	50%	0.503	50%	0.501	S	S	.	.	H	α-helix	trans	-64.3	-45	178.6	-173.5	68.5	0	0	0	111.7	Q28 T29 V30 K35 K36	Q28-L32 WeakPolarHBondContact O-CB 3.48Å; Q28-L32 PolarHBondContact O-N 3.3Å; T29-L32 PolarHBondContact O-N 3.5Å; V30-L32 VanDerWaalsContact C-N 3.32Å; V30-L32 PolarHBondContact O-N 2.92Å; L32-K35 PolarHBondContact O-N 2.92Å; L32-K36 WeakPolarHBondContact O-CG 3.49Å; L32-K36 PolarHBondContact O-N 2.88Å; L32-K36 VanDerWaalsContact O-N 3.11Å
33	N	92.5	Very high	91.1	Very high	82 Å²	82	95 Å²	95	44%	0.439	50%	0.5	S	S	.	.	H	α-helix	trans	-67.1	-42.3	-179.9	-75.5	-16.8	0	0	0	112.1	T29 V30 K36 L37	T29-N33 PolarHBondContact O-N 3.4Å; V30-N33 PolarHBondContact O-N 2.85Å; N33-K36 PolarHBondContact O-N 3.31Å; N33-L37 WeakPolarHBondContact O-CG 3.37Å; N33-L37 PolarHBondContact O-N 3.17Å
34	T	94.1	Very high	91.1	Very high	65 Å²	65	99 Å²	99	40%	0.399	51%	0.507	S	S	.	.	H	α-helix	trans	-62.7	-43.3	176.2	49.3	0	0	0	0	111.8	V30 I31 K36 L37 I38	V30-T34 HydrophobicContact CG1-CG2 4.33Å; V30-T34 WeakPolarHBondContact O-CB 3.4Å; V30-T34 WeakPolarHBondContact O-CG2 3.34Å; V30-T34 PolarHBondContact O-N 3.43Å; V30-T34 PolarHBondContact O-OG1 3.05Å; I31-T34 WeakPolarHBondContact CA-OG1 3.34Å; I31-T34 PolarHBondContact O-OG1 3.5Å; T34-K36 PolarHBondContact O-N 2.98Å; T34-L37 PolarHBondContact O-N 3.11Å; T34-I38 WeakPolarHBondContact O-CG1 3.48Å; T34-I38 PolarHBondContact O-N 3.48Å
35	K	93.5	Very high	90.9	Very high	127 Å²	127	101.3 Å²	101.3	55%	0.552	52%	0.518	S	S	*	.	H	α-helix	trans	-58.8	-43.2	173.7	-76.6	-178.5	178.7	-175.2	0	112.6	I31 L32 L37 I38 I39	I31-K35 HydrophobicContact CG2-CD 4.28Å; I31-K35 WeakPolarHBondContact O-CB 3.4Å; I31-K35 WeakPolarHBondContact O-CG 3.46Å; I31-K35 PolarHBondContact O-N 3.42Å; L32-K35 PolarHBondContact O-N 2.92Å; K35-L37 VanDerWaalsContact C-N 3.34Å; K35-L37 PolarHBondContact O-N 3.45Å; K35-I38 PolarHBondContact O-N 2.94Å; K35-I39 WeakPolarHBondContact O-CG1 3.34Å; K35-I39 PolarHBondContact O-N 3.39Å
36	K	91.8	Very high	90.5	Very high	120 Å²	120	101.2 Å²	101.2	52%	0.522	52%	0.521	S	S	.	.	H	α-helix	trans	-59.9	-44.2	176.3	-75.1	177.8	-179.7	178.2	0	111.8	L32 N33 T34 I39 L40	L32-K36 WeakPolarHBondContact O-CG 3.49Å; L32-K36 PolarHBondContact O-N 2.88Å; L32-K36 VanDerWaalsContact O-N 3.11Å; N33-K36 PolarHBondContact O-N 3.31Å; T34-K36 PolarHBondContact O-N 2.98Å; K36-I39 PolarHBondContact O-N 3.41Å; K36-L40 WeakPolarHBondContact O-CG 3.46Å; K36-L40 PolarHBondContact O-N 3.32Å
37	L	89.8	Confident	90.3	Very high	117 Å²	117	103.9 Å²	103.9	61%	0.613	53%	0.53	S	S	*	.	H	α-helix	trans	-63.3	-43	177.6	-71	172.8	0	0	0	112.1	N33 T34 K35 I39 L40 A41	N33-L37 WeakPolarHBondContact O-CG 3.37Å; N33-L37 PolarHBondContact O-N 3.17Å; T34-L37 PolarHBondContact O-N 3.11Å; K35-L37 VanDerWaalsContact C-N 3.34Å; K35-L37 PolarHBondContact O-N 3.45Å; L37-I39 PolarHBondContact O-N 2.9Å; L37-L40 PolarHBondContact O-N 3.4Å; L37-A41 WeakPolarHBondContact O-CB 3.36Å; L37-A41 PolarHBondContact O-N 2.94Å
38	I	91.9	Very high	89.8	Confident	99 Å²	99	105 Å²	105	51%	0.508	53%	0.534	S	S	.	.	H	α-helix	trans	-61.4	-46.1	176.7	-67.1	165.1	0	0	0	110.8	T34 K35 L40 A41 L42	T34-I38 WeakPolarHBondContact O-CG1 3.48Å; T34-I38 PolarHBondContact O-N 3.48Å; K35-I38 PolarHBondContact O-N 2.94Å; I38-L40 VanDerWaalsContact C-N 3.33Å; I38-L40 PolarHBondContact O-N 2.77Å; I38-A41 PolarHBondContact O-N 2.95Å; I38-L42 HydrophobicContact CG2-CD1 3.93Å; I38-L42 HydrophobicContact CG2-CG 4.32Å; I38-L42 WeakPolarHBondContact O-CG 3.33Å; I38-L42 PolarHBondContact O-N 2.91Å
39	I	90.9	Very high	89.3	Confident	90 Å²	90	102.7 Å²	102.7	46%	0.462	53%	0.526	S	S	.	.	H	α-helix	trans	-61.9	-41.9	178.3	-67.4	165.9	0	0	0	111.1	K35 K36 L37 L42 K43	K35-I39 WeakPolarHBondContact O-CG1 3.34Å; K35-I39 PolarHBondContact O-N 3.39Å; K36-I39 PolarHBondContact O-N 3.41Å; L37-I39 PolarHBondContact O-N 2.9Å; I39-L42 PolarHBondContact O-N 3.19Å; I39-K43 HydrophobicContact CG2-CD 4.33Å; I39-K43 WeakPolarHBondContact O-CB 3.47Å; I39-K43 WeakPolarHBondContact O-CG 3.33Å; I39-K43 PolarHBondContact O-N 3Å
40	L	90.2	Very high	88.7	Confident	102 Å²	102	101.8 Å²	101.8	53%	0.534	53%	0.525	S	S	.	.	H	α-helix	trans	-62.5	-42.4	175.8	-76.5	167.2	0	0	0	111.8	K36 L37 I38 K43 R44	K36-L40 WeakPolarHBondContact O-CG 3.46Å; K36-L40 PolarHBondContact O-N 3.32Å; L37-L40 PolarHBondContact O-N 3.4Å; I38-L40 VanDerWaalsContact C-N 3.33Å; I38-L40 PolarHBondContact O-N 2.77Å; L40-K43 PolarHBondContact O-N 2.93Å; L40-R44 WeakPolarHBondContact O-CG 3.29Å; L40-R44 PolarHBondContact O-N 2.94Å; L40-R44 VanDerWaalsContact O-N 3.08Å
41	A	87.6	Confident	88.3	Confident	53 Å²	53	102.7 Å²	102.7	44%	0.438	53%	0.526	S	S	.	.	H	α-helix	trans	-63.2	-47.3	176.3	0	0	0	0	0	111.5	L37 I38 K43 R44 V45	L37-A41 WeakPolarHBondContact O-CB 3.36Å; L37-A41 PolarHBondContact O-N 2.94Å; I38-A41 PolarHBondContact O-N 2.95Å; A41-K43 VanDerWaalsContact C-N 3.35Å; A41-K43 PolarHBondContact O-N 3.42Å; A41-R44 WeakPolarHBondContact O-CB 3.32Å; A41-R44 PolarHBondContact O-N 3.42Å; A41-R44 VanDerWaalsContact O-N 3.14Å; A41-V45 WeakPolarHBondContact O-CG2 3.24Å; A41-V45 PolarHBondContact O-N 3.41Å
42	L	89.8	Confident	87.7	Confident	106 Å²	106	101.8 Å²	101.8	56%	0.555	53%	0.527	S	S	*	.	H	α-helix	trans	-59.7	-43.5	177.1	-71.5	173.3	0	0	0	111.8	I38 I39 R44 V45 S46	I38-L42 HydrophobicContact CG2-CD1 3.93Å; I38-L42 HydrophobicContact CG2-CG 4.32Å; I38-L42 WeakPolarHBondContact O-CG 3.33Å; I38-L42 PolarHBondContact O-N 2.91Å; I39-L42 PolarHBondContact O-N 3.19Å; L42-R44 VanDerWaalsContact C-N 3.33Å; L42-R44 PolarHBondContact O-N 2.99Å; L42-V45 PolarHBondContact O-N 2.85Å; L42-S46 WeakPolarHBondContact O-CB 3.46Å; L42-S46 PolarHBondContact O-N 3.34Å; L42-S46 PolarHBondContact O-OG 3.15Å; L42-S46 VanDerWaalsContact O-OG 3.11Å
43	K	88.6	Confident	87.3	Confident	147 Å²	147	105.4 Å²	105.4	64%	0.639	53%	0.534	S	S	*	.	H	α-helix	trans	-60.4	-40.7	175.4	-76.9	-177.8	178.4	-174.5	0	112.3	I39 L40 A41 K47	I39-K43 HydrophobicContact CG2-CD 4.33Å; I39-K43 WeakPolarHBondContact O-CB 3.47Å; I39-K43 WeakPolarHBondContact O-CG 3.33Å; I39-K43 PolarHBondContact O-N 3Å; L40-K43 PolarHBondContact O-N 2.93Å; A41-K43 VanDerWaalsContact C-N 3.35Å; A41-K43 PolarHBondContact O-N 3.42Å; K43-K47 PolarHBondContact O-N 3.33Å
44	R	88	Confident	86.7	Confident	192 Å²	192	106.2 Å²	106.2	73%	0.725	54%	0.538	S	S	*	.	H	α-helix	trans	-64.4	-46.6	176.5	-74.2	179.6	177.3	-174.5	-0.6	111.6	L40 A41 L42 S46 K47 M48	L40-R44 WeakPolarHBondContact O-CG 3.29Å; L40-R44 PolarHBondContact O-N 2.94Å; L40-R44 VanDerWaalsContact O-N 3.08Å; A41-R44 WeakPolarHBondContact O-CB 3.32Å; A41-R44 PolarHBondContact O-N 3.42Å; A41-R44 VanDerWaalsContact O-N 3.14Å; L42-R44 VanDerWaalsContact C-N 3.33Å; L42-R44 PolarHBondContact O-N 2.99Å; R44-S46 PolarHBondContact O-N 2.66Å; R44-K47 PolarHBondContact O-N 3.44Å; R44-M48 WeakPolarHBondContact O-CG 3.48Å; R44-M48 PolarHBondContact O-N 3.03Å
45	V	84.7	Confident	86.1	Confident	95 Å²	95	105.9 Å²	105.9	58%	0.576	54%	0.538	S	S	*	.	H	α-helix	trans	-61.1	-45.6	177.4	174.8	0	0	0	0	110.9	A41 L42 K47 M48 N49	A41-V45 WeakPolarHBondContact O-CG2 3.24Å; A41-V45 PolarHBondContact O-N 3.41Å; L42-V45 PolarHBondContact O-N 2.85Å; V45-K47 VanDerWaalsContact C-N 3.33Å; V45-K47 PolarHBondContact O-N 3.02Å; V45-M48 PolarHBondContact O-N 3.09Å; V45-N49 WeakPolarHBondContact O-CB 3.31Å; V45-N49 PolarHBondContact O-N 3.45Å
46	S	84.5	Confident	85.7	Confident	79 Å²	79	106.9 Å²	106.9	55%	0.552	54%	0.538	S	S	*	.	H	α-helix	trans	-59.9	-41.3	176.8	-65.5	0	0	0	0	112.4	L42 R44 N49 A50	L42-S46 WeakPolarHBondContact O-CB 3.46Å; L42-S46 PolarHBondContact O-N 3.34Å; L42-S46 PolarHBondContact O-OG 3.15Å; L42-S46 VanDerWaalsContact O-OG 3.11Å; R44-S46 PolarHBondContact O-N 2.66Å; S46-N49 PolarHBondContact O-N 3.27Å; S46-A50 PolarHBondContact O-N 3.46Å
47	K	84.5	Confident	85.2	Confident	150 Å²	150	106 Å²	106	65%	0.652	53%	0.534	S	S	*	.	H	α-helix	trans	-66.1	-43.1	176.5	-169.7	175.1	-178.8	179	0	111.9	K43 R44 V45 N49 A50 I51	K43-K47 PolarHBondContact O-N 3.33Å; R44-K47 PolarHBondContact O-N 3.44Å; V45-K47 VanDerWaalsContact C-N 3.33Å; V45-K47 PolarHBondContact O-N 3.02Å; K47-N49 VanDerWaalsContact C-N 3.32Å; K47-N49 PolarHBondContact O-N 3.19Å; K47-A50 PolarHBondContact O-N 3.05Å; K47-I51 HydrophobicContact CG-CD1 4.15Å; K47-I51 VanDerWaalsContact O-CG1 3.3Å; K47-I51 WeakPolarHBondContact O-CG1 3.44Å; K47-I51 PolarHBondContact O-N 3.4Å
48	M	79.4	Confident	84.7	Confident	129 Å²	129	105 Å²	105	64%	0.635	53%	0.525	S	S	*	.	H	α-helix	trans	-62.7	-38.6	175.4	-71.6	179.1	69.9	0	0	112.2	R44 V45 I51 S52	R44-M48 WeakPolarHBondContact O-CG 3.48Å; R44-M48 PolarHBondContact O-N 3.03Å; V45-M48 PolarHBondContact O-N 3.09Å; M48-I51 PolarHBondContact O-N 3.26Å; M48-S52 WeakPolarHBondContact O-CB 3.43Å; M48-S52 PolarHBondContact O-N 2.91Å; M48-S52 PolarHBondContact O-OG 3.01Å
49	N	81.9	Confident	84.2	Confident	89 Å²	89	107.1 Å²	107.1	48%	0.476	54%	0.537	S	S	.	.	H	α-helix	trans	-66.3	-41	175.6	-168	32.4	0	0	0	111.3	V45 S46 K47 S52 R53	V45-N49 WeakPolarHBondContact O-CB 3.31Å; V45-N49 PolarHBondContact O-N 3.45Å; S46-N49 PolarHBondContact O-N 3.27Å; K47-N49 VanDerWaalsContact C-N 3.32Å; K47-N49 PolarHBondContact O-N 3.19Å; N49-S52 PolarHBondContact O-N 3.37Å; N49-R53 WeakPolarHBondContact O-CG 3.36Å; N49-R53 PolarHBondContact O-N 3.47Å
50	A	80.5	Confident	83.8	Confident	49 Å²	49	108.1 Å²	108.1	41%	0.405	55%	0.547	S	S	.	.	H	α-helix	trans	-61.5	-45.4	174.7	0	0	0	0	0	112	S46 K47 S52 R53 L54	S46-A50 PolarHBondContact O-N 3.46Å; K47-A50 PolarHBondContact O-N 3.05Å; A50-S52 VanDerWaalsContact C-N 3.32Å; A50-S52 PolarHBondContact O-N 3.46Å; A50-R53 PolarHBondContact O-N 3.27Å; A50-R53 VanDerWaalsContact O-N 3.15Å; A50-L54 WeakPolarHBondContact O-CG 3.42Å; A50-L54 PolarHBondContact O-N 2.85Å
51	I	83.7	Confident	83.1	Confident	95 Å²	95	106.7 Å²	106.7	49%	0.487	54%	0.54	S	S	.	.	H	α-helix	trans	-60.3	-43.1	174.9	-66.4	164.4	0	0	0	110.6	K47 M48 R53 L54 S55	K47-I51 HydrophobicContact CG-CD1 4.15Å; K47-I51 VanDerWaalsContact O-CG1 3.3Å; K47-I51 WeakPolarHBondContact O-CG1 3.44Å; K47-I51 PolarHBondContact O-N 3.4Å; M48-I51 PolarHBondContact O-N 3.26Å; I51-R53 VanDerWaalsContact C-N 3.26Å; I51-R53 PolarHBondContact O-N 2.96Å; I51-L54 PolarHBondContact O-N 3.24Å; I51-S55 WeakPolarHBondContact O-CB 3.41Å; I51-S55 PolarHBondContact O-N 3.42Å; I51-S55 PolarHBondContact O-OG 3.33Å
52	S	81.7	Confident	82.3	Confident	56 Å²	56	108.6 Å²	108.6	39%	0.392	55%	0.548	S	S	.	.	H	α-helix	trans	-67.6	-23.7	178	-61.1	0	0	0	0	113.7	M48 N49 A50 S55 R56	M48-S52 WeakPolarHBondContact O-CB 3.43Å; M48-S52 PolarHBondContact O-N 2.91Å; M48-S52 PolarHBondContact O-OG 3.01Å; N49-S52 PolarHBondContact O-N 3.37Å; A50-S52 VanDerWaalsContact C-N 3.32Å; A50-S52 PolarHBondContact O-N 3.46Å; S52-S55 WeakPolarHBondContact CA-OG 3.35Å; S52-S55 PolarHBondContact O-OG 3.1Å; S52-R56 WeakPolarHBondContact O-CG 3.39Å; S52-R56 PolarHBondContact O-NE 3.42Å
53	R	83.6	Confident	81.5	Confident	171 Å²	171	111.9 Å²	111.9	65%	0.645	57%	0.565	S	S	*	*	H	α-helix	trans	-79.3	-42.2	171.8	-70.6	-179.2	85.8	174.6	6.6	110.9	N49 A50 I51 R56 F57	N49-R53 WeakPolarHBondContact O-CG 3.36Å; N49-R53 PolarHBondContact O-N 3.47Å; A50-R53 PolarHBondContact O-N 3.27Å; A50-R53 VanDerWaalsContact O-N 3.15Å; I51-R53 VanDerWaalsContact C-N 3.26Å; I51-R53 PolarHBondContact O-N 2.96Å; R53-R56 PolarHBondContact O-N 3.33Å; R53-F57 PolarHBondContact O-N 3.3Å
54	L	79.5	Confident	80.3	Confident	100 Å²	100	112.9 Å²	112.9	52%	0.524	57%	0.569	S	S	.	*	H	α-helix	trans	-62.5	-46.9	175.6	-72.6	170.8	0	0	0	111.4	A50 I51 R56 F57 F58	A50-L54 WeakPolarHBondContact O-CG 3.42Å; A50-L54 PolarHBondContact O-N 2.85Å; I51-L54 PolarHBondContact O-N 3.24Å; L54-R56 VanDerWaalsContact C-N 3.3Å; L54-R56 PolarHBondContact O-N 3.45Å; L54-F57 WeakPolarHBondContact O-CB 3.43Å; L54-F57 PolarHBondContact O-N 3.32Å; L54-F58 HydrophobicContact CB-CE2 4.39Å; L54-F58 WeakPolarHBondContact O-CD2 3.48Å; L54-F58 PolarHBondContact O-N 3.15Å
55	S	81.6	Confident	78.8	Confident	57 Å²	57	108.7 Å²	108.7	40%	0.399	58%	0.576	S	S	.	*	H	α-helix	trans	-59.4	-40.4	178.3	63.9	0	0	0	0	112.4	I51 S52 F58 L59	I51-S55 WeakPolarHBondContact O-CB 3.41Å; I51-S55 PolarHBondContact O-N 3.42Å; I51-S55 PolarHBondContact O-OG 3.33Å; S52-S55 WeakPolarHBondContact CA-OG 3.35Å; S52-S55 PolarHBondContact O-OG 3.1Å; S55-F58 PolarHBondContact O-N 3.21Å; S55-L59 WeakPolarHBondContact O-CG 3.5Å; S55-L59 PolarHBondContact O-N 2.97Å; S55-L59 VanDerWaalsContact O-N 3.12Å
56	R	85.1	Confident	78.5	Confident	149 Å²	149	109.4 Å²	109.4	56%	0.562	58%	0.576	S	S	*	*	H	α-helix	trans	-66	-38.6	173.3	-79.1	-174	-74.6	-178.1	-4.4	112.9	S52 R53 L54 L59 V60	S52-R56 WeakPolarHBondContact O-CG 3.39Å; S52-R56 PolarHBondContact O-NE 3.42Å; R53-R56 PolarHBondContact O-N 3.33Å; L54-R56 VanDerWaalsContact C-N 3.3Å; L54-R56 PolarHBondContact O-N 3.45Å; R56-L59 PolarHBondContact O-N 3.07Å; R56-V60 WeakPolarHBondContact O-CG2 3.37Å; R56-V60 PolarHBondContact O-N 3.48Å; R56-V60 VanDerWaalsContact O-N 3.15Å
57	F	81.8	Confident	78.2	Confident	100 Å²	100	110.9 Å²	110.9	44%	0.439	58%	0.577	S	S	.	*	H	α-helix	trans	-61.8	-44.9	175.9	-178.4	-95.2	0	0	0	111.7	R53 L54 L59 V60 N61	R53-F57 PolarHBondContact O-N 3.3Å; L54-F57 WeakPolarHBondContact O-CB 3.43Å; L54-F57 PolarHBondContact O-N 3.32Å; F57-L59 VanDerWaalsContact C-N 3.33Å; F57-L59 PolarHBondContact O-N 3.4Å; F57-V60 PolarHBondContact O-N 3.26Å; F57-N61 PolarHBondContact O-N 3.2Å
58	F	80.2	Confident	77.8	Confident	97 Å²	97	108.8 Å²	108.8	43%	0.425	57%	0.573	S	S	.	*	H	α-helix	trans	-62.8	-36.7	176.4	-76.3	-69.6	0	0	0	112.9	L54 S55 N61 P62 A65	L54-F58 HydrophobicContact CB-CE2 4.39Å; L54-F58 WeakPolarHBondContact O-CD2 3.48Å; L54-F58 PolarHBondContact O-N 3.15Å; S55-F58 PolarHBondContact O-N 3.21Å; F58-N61 CarbonylContact O-C 3.49Å; F58-P62 WeakPolarHBondContact O-CA 3.45Å; F58-A65 HydrophobicContact CD1-CB 3.37Å; F58-A65 HydrophobicContact CE1-CB 3.35Å
59	L	80	Confident	77.7	Confident	144 Å²	144	107.6 Å²	107.6	75%	0.754	57%	0.569	S	S	*	*	H	α-helix	trans	-67.6	-36	176.5	-73.7	170.9	0	0	0	113	S55 R56 F57	S55-L59 WeakPolarHBondContact O-CG 3.5Å; S55-L59 PolarHBondContact O-N 2.97Å; S55-L59 VanDerWaalsContact O-N 3.12Å; R56-L59 PolarHBondContact O-N 3.07Å; F57-L59 VanDerWaalsContact C-N 3.33Å; F57-L59 PolarHBondContact O-N 3.4Å
60	V	82.8	Confident	77.5	Confident	111 Å²	111	108.8 Å²	108.8	67%	0.673	58%	0.575	S	S	*	*	H	α-helix	trans	-79.3	-35.6	-179.3	175.7	0	0	0	0	111.6	R56 F57	R56-V60 WeakPolarHBondContact O-CG2 3.37Å; R56-V60 PolarHBondContact O-N 3.48Å; R56-V60 VanDerWaalsContact O-N 3.15Å; F57-V60 PolarHBondContact O-N 3.26Å
61	N	76	Confident	77.3	Confident	71 Å²	71	112.7 Å²	112.7	38%	0.38	59%	0.586	S	S	.	*			trans	-129.4	74	-178.3	-71.7	-53.8	0	0	0	111.2	F57 F58 L63 K64	F57-N61 PolarHBondContact O-N 3.2Å; F58-N61 CarbonylContact O-C 3.49Å; N61-L63 PolarHBondContact O-N 3.19Å; N61-K64 HydrophobicContact CB-CB 4.09Å; N61-K64 PolarHBondContact O-N 3.49Å
62	P	70.1	Confident	76.8	Confident	93 Å²	93	114 Å²	114	60%	0.604	59%	0.593	S	S	*	*	G	3₁₀ helix	trans	-63.3	-25.1	-177.8	24.6	-33.9	0	0	0	113	F58 A65	F58-P62 WeakPolarHBondContact O-CA 3.45Å; P62-A65 WeakPolarHBondContact O-CB 3.48Å
63	L	73.9	Confident	76.5	Confident	176 Å²	176	118.5 Å²	118.5	92%	0.921	61%	0.609	S	S	*	*	G	3₁₀ helix	trans	-88.1	-9.4	-177	-63.5	174.1	0	0	0	114.2	N61	N61-L63 PolarHBondContact O-N 3.19Å
64	K	63.4	Low	75.9	Confident	167 Å²	167	114.1 Å²	114.1	73%	0.726	61%	0.605	S	S	*	*	G	3₁₀ helix	trans	-107.5	7.7	-178.2	-137.4	167.8	-171	172	0	112.9	N61	N61-K64 HydrophobicContact CB-CB 4.09Å; N61-K64 PolarHBondContact O-N 3.49Å
65	A	55.8	Low	75.5	Confident	104 Å²	104	115.4 Å²	115.4	86%	0.86	61%	0.613	S	S	*	*			trans	-67.8	0	179.5	0	0	0	0	0	112.4	F58 P62	F58-A65 HydrophobicContact CD1-CB 3.37Å; F58-A65 HydrophobicContact CE1-CB 3.35Å; P62-A65 WeakPolarHBondContact O-CB 3.48Å

Retrieved 65 of 65 residues in 59.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).