G4LZB6_SCHMA Loading...

Transcriptional regulator

AlphaFold DB , UniProt , Accession G4LZB6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 55 aa.

						>G4LZB6_SCHMA|G4LZB6
MSKRLPSSVTEQYRLSYVRAVVDHLDDDIIYRLTSYRKTSMSLQPVSFDLLKKRA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.6	Very low	73.3	Confident	239 Å²	239	127 Å²	127	100%	1.177	67%	0.667	S	S	*	*				0	104.8	0	-152.8	157.3	169.9	0	0	107.7	K3	M1-K3 PolarHBondContact O-N 3.3Å
2	S	66.3	Low	74.4	Confident	121 Å²	121	127.4 Å²	127.4	85%	0.846	66%	0.663	S	S	*	*			trans	-78.6	108.7	-173.5	-160.9	0	0	0	0	109.5	R4	S2-R4 PolarHBondContact O-N 3.32Å; S2-R4 VanDerWaalsContact O-N 3.14Å
3	K	73.2	Confident	75.5	Confident	200 Å²	200	130.6 Å²	130.6	87%	0.87	66%	0.663	S	S	*	*			trans	-73.1	104.1	178.4	-68.3	-178	-179.2	177.9	0	107.9	M1 L5	M1-K3 PolarHBondContact O-N 3.3Å; K3-L5 PolarHBondContact O-N 3.14Å
4	R	72.8	Confident	76.1	Confident	238 Å²	238	133.1 Å²	133.1	90%	0.898	66%	0.66	S	S	*	*	P	Polyproline II helix	trans	-61.7	125.9	172.1	-72.1	-175.3	179.6	-179.8	0.2	108.2	S2	S2-R4 PolarHBondContact O-N 3.32Å; S2-R4 VanDerWaalsContact O-N 3.14Å
5	L	70.5	Confident	77.2	Confident	123 Å²	123	132 Å²	132	64%	0.644	66%	0.656	S	S	*	*	P	Polyproline II helix	trans	-59.7	142.8	174	-80.7	154	0	0	0	109.2	K3 S7 V9	K3-L5 PolarHBondContact O-N 3.14Å; L5-S7 PolarHBondContact O-N 3.45Å; L5-V9 HydrophobicContact CD2-CG1 4.16Å
6	P	75.1	Confident	78.1	Confident	75 Å²	75	128.6 Å²	128.6	49%	0.487	65%	0.65	S	S	.	*	P	Polyproline II helix	trans	-53.5	140.1	173.2	-20.1	30	0	0	0	110	S8 V9 T10	P6-S8 PolarHBondContact O-N 3.26Å; P6-V9 HydrophobicContact CB-CG2 4.17Å; P6-V9 HydrophobicContact CG-CG2 4.14Å; P6-V9 PolarHBondContact O-N 3.43Å; P6-T10 PolarHBondContact O-N 3.17Å; P6-T10 PolarHBondContact O-OG1 3.47Å
7	S	79.3	Confident	78.8	Confident	96 Å²	96	129.6 Å²	129.6	67%	0.671	65%	0.645	S	S	*	*	H	α-helix	trans	-54.3	-37.4	-178.6	49.3	0	0	0	0	112.2	L5 V9 T10 E11	L5-S7 PolarHBondContact O-N 3.45Å; S7-V9 PolarHBondContact O-N 3.37Å; S7-T10 WeakPolarHBondContact O-CB 3.39Å; S7-T10 PolarHBondContact O-N 2.89Å; S7-T10 VanDerWaalsContact O-N 3.12Å; S7-E11 PolarHBondContact O-N 3.12Å
8	S	78.7	Confident	79.4	Confident	66 Å²	66	127.2 Å²	127.2	46%	0.462	64%	0.638	S	S	.	*	H	α-helix	trans	-59.5	-41.9	177.1	57.6	0	0	0	0	113.5	P6 T10 E11 Q12	P6-S8 PolarHBondContact O-N 3.26Å; S8-T10 VanDerWaalsContact C-N 3.28Å; S8-T10 PolarHBondContact O-N 3.43Å; S8-E11 PolarHBondContact O-N 3.05Å; S8-Q12 WeakPolarHBondContact O-CG 3.47Å; S8-Q12 PolarHBondContact O-N 3.17Å
9	V	78	Confident	80.1	Confident	62 Å²	62	130.4 Å²	130.4	38%	0.376	64%	0.642	S	S	.	*	H	α-helix	trans	-66.2	-37.4	177.1	-179.6	0	0	0	0	110.1	L5 P6 S7 Y13	L5-V9 HydrophobicContact CD2-CG1 4.16Å; P6-V9 HydrophobicContact CB-CG2 4.17Å; P6-V9 HydrophobicContact CG-CG2 4.14Å; P6-V9 PolarHBondContact O-N 3.43Å; S7-V9 PolarHBondContact O-N 3.37Å; V9-Y13 WeakPolarHBondContact O-CB 3.43Å; V9-Y13 PolarHBondContact O-N 3.03Å
10	T	83.3	Confident	80.6	Confident	52 Å²	52	126 Å²	126	32%	0.319	63%	0.627	S	S	.	*	H	α-helix	trans	-68.2	-39.2	177.6	-50.6	0	0	0	0	111.3	P6 S7 S8 R14	P6-T10 PolarHBondContact O-N 3.17Å; P6-T10 PolarHBondContact O-OG1 3.47Å; S7-T10 WeakPolarHBondContact O-CB 3.39Å; S7-T10 PolarHBondContact O-N 2.89Å; S7-T10 VanDerWaalsContact O-N 3.12Å; S8-T10 VanDerWaalsContact C-N 3.28Å; S8-T10 PolarHBondContact O-N 3.43Å; T10-R14 VanDerWaalsContact O-CG 3.3Å; T10-R14 WeakPolarHBondContact O-CG 3.5Å; T10-R14 PolarHBondContact O-N 2.94Å
11	E	83.2	Confident	81	Confident	125 Å²	125	122.9 Å²	122.9	58%	0.584	62%	0.615	S	S	*	*	H	α-helix	trans	-68.8	-43.4	175.7	-73.8	-159.3	148.3	0	0	112.7	S7 S8 Y13 R14 L15	S7-E11 PolarHBondContact O-N 3.12Å; S8-E11 PolarHBondContact O-N 3.05Å; E11-Y13 VanDerWaalsContact C-N 3.3Å; E11-Y13 PolarHBondContact O-N 3.17Å; E11-R14 WeakPolarHBondContact O-CB 3.3Å; E11-R14 PolarHBondContact O-N 3.33Å; E11-R14 VanDerWaalsContact O-N 3.17Å; E11-L15 WeakPolarHBondContact O-CG 3.35Å; E11-L15 PolarHBondContact O-N 3.02Å
12	Q	86.6	Confident	83.1	Confident	132 Å²	132	114.8 Å²	114.8	62%	0.617	58%	0.579	S	S	*	*	H	α-helix	trans	-57.6	-46	174.3	-77.2	-179.2	-20.9	0	0	111.1	S8 R14 L15 S16	S8-Q12 WeakPolarHBondContact O-CG 3.47Å; S8-Q12 PolarHBondContact O-N 3.17Å; Q12-R14 VanDerWaalsContact C-N 3.34Å; Q12-R14 PolarHBondContact O-N 2.9Å; Q12-L15 PolarHBondContact O-N 3.42Å; Q12-S16 WeakPolarHBondContact O-CB 3.41Å; Q12-S16 PolarHBondContact O-N 2.9Å; Q12-S16 PolarHBondContact O-OG 3.4Å
13	Y	88.5	Confident	84.2	Confident	169 Å²	169	113.6 Å²	113.6	66%	0.663	56%	0.563	S	S	*	*	H	α-helix	trans	-60.5	-42.8	176.5	-174.6	-93.5	0	0	0	112.3	V9 E11 S16 Y17	V9-Y13 WeakPolarHBondContact O-CB 3.43Å; V9-Y13 PolarHBondContact O-N 3.03Å; E11-Y13 VanDerWaalsContact C-N 3.3Å; E11-Y13 PolarHBondContact O-N 3.17Å; Y13-S16 PolarHBondContact O-N 2.9Å; Y13-Y17 WeakPolarHBondContact O-CB 3.43Å; Y13-Y17 PolarHBondContact O-N 3.27Å
14	R	84.7	Confident	84.8	Confident	166 Å²	166	110.7 Å²	110.7	63%	0.626	55%	0.552	S	S	*	*	H	α-helix	trans	-61.4	-44.7	176.1	-76.2	172.3	177	-172.4	-1.5	111.9	T10 E11 Q12 Y17 V18	T10-R14 VanDerWaalsContact O-CG 3.3Å; T10-R14 WeakPolarHBondContact O-CG 3.5Å; T10-R14 PolarHBondContact O-N 2.94Å; E11-R14 WeakPolarHBondContact O-CB 3.3Å; E11-R14 PolarHBondContact O-N 3.33Å; E11-R14 VanDerWaalsContact O-N 3.17Å; Q12-R14 VanDerWaalsContact C-N 3.34Å; Q12-R14 PolarHBondContact O-N 2.9Å; R14-Y17 PolarHBondContact O-N 3.29Å; R14-V18 VanDerWaalsContact O-CG2 3.31Å; R14-V18 WeakPolarHBondContact O-CG2 3.31Å; R14-V18 PolarHBondContact O-N 3.04Å
15	L	91.5	Very high	85.4	Confident	116 Å²	116	104 Å²	104	61%	0.607	53%	0.534	S	S	*	.	H	α-helix	trans	-65.5	-42.6	178.5	-71.2	171.7	0	0	0	111.8	E11 Q12 Y17 V18 R19	E11-L15 WeakPolarHBondContact O-CG 3.35Å; E11-L15 PolarHBondContact O-N 3.02Å; Q12-L15 PolarHBondContact O-N 3.42Å; L15-Y17 VanDerWaalsContact C-N 3.34Å; L15-Y17 PolarHBondContact O-N 3.33Å; L15-V18 PolarHBondContact O-N 3.12Å; L15-R19 PolarHBondContact O-N 3.28Å
16	S	91.7	Very high	86.1	Confident	78 Å²	78	102.1 Å²	102.1	55%	0.545	52%	0.524	S	S	.	.	H	α-helix	trans	-61.4	-42.2	174.6	-67.4	0	0	0	0	111.9	Q12 Y13 R19 A20	Q12-S16 WeakPolarHBondContact O-CB 3.41Å; Q12-S16 PolarHBondContact O-N 2.9Å; Q12-S16 PolarHBondContact O-OG 3.4Å; Y13-S16 PolarHBondContact O-N 2.9Å; S16-R19 PolarHBondContact O-N 3.02Å; S16-A20 PolarHBondContact O-N 2.96Å
17	Y	91.4	Very high	86.6	Confident	146 Å²	146	103.4 Å²	103.4	57%	0.573	53%	0.527	S	S	*	.	H	α-helix	trans	-63.3	-47	176.4	178.6	-98.5	0	0	0	112	Y13 R14 L15 R19 A20 V21	Y13-Y17 WeakPolarHBondContact O-CB 3.43Å; Y13-Y17 PolarHBondContact O-N 3.27Å; R14-Y17 PolarHBondContact O-N 3.29Å; L15-Y17 VanDerWaalsContact C-N 3.34Å; L15-Y17 PolarHBondContact O-N 3.33Å; Y17-R19 VanDerWaalsContact C-N 3.33Å; Y17-R19 PolarHBondContact O-N 3.43Å; Y17-A20 PolarHBondContact O-N 3.36Å; Y17-V21 HydrophobicContact CD1-CG2 4.35Å; Y17-V21 HydrophobicContact CE1-CG2 3.91Å; Y17-V21 HydrophobicContact CE2-CG2 4.29Å; Y17-V21 WeakPolarHBondContact O-CG2 3.43Å; Y17-V21 PolarHBondContact O-N 3.4Å
18	V	89.2	Confident	87	Confident	85 Å²	85	102.6 Å²	102.6	52%	0.515	52%	0.515	S	S	.	.	H	α-helix	trans	-60.9	-42.7	177.5	171.7	0	0	0	0	111.1	R14 L15 V21 V22	R14-V18 VanDerWaalsContact O-CG2 3.31Å; R14-V18 WeakPolarHBondContact O-CG2 3.31Å; R14-V18 PolarHBondContact O-N 3.04Å; L15-V18 PolarHBondContact O-N 3.12Å; V18-V21 PolarHBondContact O-N 3.04Å; V18-V22 WeakPolarHBondContact O-CG2 3.39Å; V18-V22 PolarHBondContact O-N 3.08Å
19	R	92.3	Very high	87.2	Confident	188 Å²	188	103.6 Å²	103.6	71%	0.709	52%	0.515	S	S	*	.	H	α-helix	trans	-59	-49.1	175	-83	-175.7	178.9	-179.4	-0.8	112.2	L15 S16 Y17 V21 V22 D23	L15-R19 PolarHBondContact O-N 3.28Å; S16-R19 PolarHBondContact O-N 3.02Å; Y17-R19 VanDerWaalsContact C-N 3.33Å; Y17-R19 PolarHBondContact O-N 3.43Å; R19-V21 VanDerWaalsContact C-N 3.27Å; R19-V21 PolarHBondContact O-N 2.94Å; R19-V22 PolarHBondContact O-N 3.43Å; R19-V22 VanDerWaalsContact O-N 3.11Å; R19-D23 VanDerWaalsContact O-CG 3.28Å; R19-D23 PolarHBondContact O-N 3.49Å
20	A	90.6	Very high	87.4	Confident	43 Å²	43	105.3 Å²	105.3	36%	0.355	52%	0.521	S	S	.	.	H	α-helix	trans	-59.9	-37.6	179.5	0	0	0	0	0	112.6	S16 Y17 H24	S16-A20 PolarHBondContact O-N 2.96Å; Y17-A20 PolarHBondContact O-N 3.36Å; A20-H24 WeakPolarHBondContact O-CB 3.39Å; A20-H24 PolarHBondContact O-CD2 3.38Å; A20-H24 PolarHBondContact O-N 3.5Å; A20-H24 VanDerWaalsContact O-N 3.08Å
21	V	89.1	Confident	87.3	Confident	60 Å²	60	110.2 Å²	110.2	36%	0.364	53%	0.534	S	S	.	.	H	α-helix	trans	-66.8	-42.4	175.9	172.7	0	0	0	0	111.5	Y17 V18 R19 H24 L25	Y17-V21 HydrophobicContact CD1-CG2 4.35Å; Y17-V21 HydrophobicContact CE1-CG2 3.91Å; Y17-V21 HydrophobicContact CE2-CG2 4.29Å; Y17-V21 WeakPolarHBondContact O-CG2 3.43Å; Y17-V21 PolarHBondContact O-N 3.4Å; V18-V21 PolarHBondContact O-N 3.04Å; R19-V21 VanDerWaalsContact C-N 3.27Å; R19-V21 PolarHBondContact O-N 2.94Å; V21-H24 PolarHBondContact O-N 3.31Å; V21-L25 HydrophobicContact CG1-CD1 4.11Å; V21-L25 VanDerWaalsContact O-CG 3.31Å; V21-L25 WeakPolarHBondContact O-CG 3.4Å; V21-L25 PolarHBondContact O-N 2.9Å; V21-L25 VanDerWaalsContact O-N 3.08Å
22	V	88.6	Confident	87.1	Confident	70 Å²	70	110.7 Å²	110.7	42%	0.424	53%	0.531	S	S	.	.	H	α-helix	trans	-64.3	-47.6	177.4	172.7	0	0	0	0	110.8	V18 R19 H24 L25 D26	V18-V22 WeakPolarHBondContact O-CG2 3.39Å; V18-V22 PolarHBondContact O-N 3.08Å; R19-V22 PolarHBondContact O-N 3.43Å; R19-V22 VanDerWaalsContact O-N 3.11Å; V22-H24 VanDerWaalsContact C-N 3.28Å; V22-H24 PolarHBondContact O-N 3.47Å; V22-L25 PolarHBondContact O-N 2.99Å; V22-D26 PolarHBondContact O-N 3.08Å
23	D	89.6	Confident	86.7	Confident	96 Å²	96	109.8 Å²	109.8	51%	0.513	53%	0.53	S	S	.	.	H	α-helix	trans	-58.7	-41.4	179.2	-65.3	-19.9	0	0	0	111	R19 L25 D26 D27	R19-D23 VanDerWaalsContact O-CG 3.28Å; R19-D23 PolarHBondContact O-N 3.49Å; D23-L25 PolarHBondContact O-N 3.11Å; D23-D26 PolarHBondContact O-N 3.06Å; D23-D27 PolarHBondContact O-N 3.11Å
24	H	87	Confident	86.2	Confident	139 Å²	139	104.8 Å²	104.8	64%	0.644	52%	0.517	S	S	*	.	H	α-helix	trans	-66.7	-34.3	175.8	-81.3	-46.8	0	0	0	114.1	A20 V21 V22 D28	A20-H24 WeakPolarHBondContact O-CB 3.39Å; A20-H24 PolarHBondContact O-CD2 3.38Å; A20-H24 PolarHBondContact O-N 3.5Å; A20-H24 VanDerWaalsContact O-N 3.08Å; V21-H24 PolarHBondContact O-N 3.31Å; V22-H24 VanDerWaalsContact C-N 3.28Å; V22-H24 PolarHBondContact O-N 3.47Å; H24-D28 PolarHBondContact O-N 3.07Å; H24-D28 VanDerWaalsContact O-N 3.11Å
25	L	83.9	Confident	85.7	Confident	97 Å²	97	98.7 Å²	98.7	51%	0.508	50%	0.5	S	S	.	.	H	α-helix	trans	-69.7	-39.5	176	-72.6	167.7	0	0	0	111.1	V21 V22 D23 D27 D28 I29	V21-L25 HydrophobicContact CG1-CD1 4.11Å; V21-L25 VanDerWaalsContact O-CG 3.31Å; V21-L25 WeakPolarHBondContact O-CG 3.4Å; V21-L25 PolarHBondContact O-N 2.9Å; V21-L25 VanDerWaalsContact O-N 3.08Å; V22-L25 PolarHBondContact O-N 2.99Å; D23-L25 PolarHBondContact O-N 3.11Å; L25-D27 VanDerWaalsContact C-N 3.34Å; L25-D28 PolarHBondContact O-N 2.8Å; L25-I29 WeakPolarHBondContact O-CB 3.41Å; L25-I29 VanDerWaalsContact O-CG1 3.25Å; L25-I29 WeakPolarHBondContact O-CG1 3.44Å; L25-I29 PolarHBondContact O-N 2.85Å
26	D	85.8	Confident	84.7	Confident	83 Å²	83	100.3 Å²	100.3	44%	0.444	50%	0.499	S	S	.	.	H	α-helix	trans	-62.2	-43.5	175.6	-76.3	-19.9	0	0	0	110.9	V22 D23 D28 I29 I30	V22-D26 PolarHBondContact O-N 3.08Å; D23-D26 PolarHBondContact O-N 3.06Å; D26-D28 PolarHBondContact O-N 3.35Å; D26-I29 PolarHBondContact O-N 3.49Å; D26-I30 WeakPolarHBondContact O-CB 3.31Å; D26-I30 WeakPolarHBondContact O-CD1 3.29Å; D26-I30 WeakPolarHBondContact O-CG1 3.27Å; D26-I30 PolarHBondContact O-N 2.91Å
27	D	85.8	Confident	83.5	Confident	102 Å²	102	105.4 Å²	105.4	55%	0.545	51%	0.506	S	S	.	.	H	α-helix	trans	-61.3	-43.2	175.6	-78.4	-21.7	0	0	0	112.7	D23 L25 I30 Y31	D23-D27 PolarHBondContact O-N 3.11Å; L25-D27 VanDerWaalsContact C-N 3.34Å; D27-I30 PolarHBondContact O-N 3.49Å; D27-Y31 VanDerWaalsContact O-CB 3.29Å; D27-Y31 WeakPolarHBondContact O-CB 3.25Å; D27-Y31 PolarHBondContact O-N 3.32Å
28	D	86.4	Confident	82.2	Confident	79 Å²	79	106.4 Å²	106.4	42%	0.422	51%	0.513	S	S	.	.	H	α-helix	trans	-66	-41.2	177.5	-174.2	61.5	0	0	0	111.8	H24 L25 D26 Y31 R32	H24-D28 PolarHBondContact O-N 3.07Å; H24-D28 VanDerWaalsContact O-N 3.11Å; L25-D28 PolarHBondContact O-N 2.8Å; D26-D28 PolarHBondContact O-N 3.35Å; D28-Y31 PolarHBondContact O-N 2.85Å; D28-R32 WeakPolarHBondContact O-CB 3.42Å; D28-R32 VanDerWaalsContact O-CG 3.27Å; D28-R32 WeakPolarHBondContact O-CG 3.32Å; D28-R32 PolarHBondContact O-N 3.35Å; D28-R32 WeakPolarHBondContact OD2-CD 3.27Å
29	I	83.2	Confident	80.9	Confident	88 Å²	88	106.1 Å²	106.1	45%	0.451	51%	0.512	S	S	.	.	H	α-helix	trans	-62.4	-46.4	176.2	-69.4	166.4	0	0	0	110.2	L25 D26 Y31 R32 L33	L25-I29 WeakPolarHBondContact O-CB 3.41Å; L25-I29 VanDerWaalsContact O-CG1 3.25Å; L25-I29 WeakPolarHBondContact O-CG1 3.44Å; L25-I29 PolarHBondContact O-N 2.85Å; D26-I29 PolarHBondContact O-N 3.49Å; I29-Y31 VanDerWaalsContact C-N 3.35Å; I29-Y31 PolarHBondContact O-N 2.9Å; I29-R32 PolarHBondContact O-N 2.97Å; I29-L33 HydrophobicContact CG2-CD1 3.9Å; I29-L33 HydrophobicContact CG2-CG 4.42Å; I29-L33 WeakPolarHBondContact O-CB 3.5Å; I29-L33 VanDerWaalsContact O-CG 3.32Å; I29-L33 WeakPolarHBondContact O-CG 3.21Å; I29-L33 PolarHBondContact O-N 3.5Å
30	I	83.1	Confident	79.1	Confident	98 Å²	98	100 Å²	100	50%	0.503	50%	0.497	S	S	.	.	H	α-helix	trans	-61.7	-44.2	176.8	-69.3	166.7	0	0	0	110.4	D26 D27 R32 L33 T34	D26-I30 WeakPolarHBondContact O-CB 3.31Å; D26-I30 WeakPolarHBondContact O-CD1 3.29Å; D26-I30 WeakPolarHBondContact O-CG1 3.27Å; D26-I30 PolarHBondContact O-N 2.91Å; D27-I30 PolarHBondContact O-N 3.49Å; I30-R32 PolarHBondContact O-N 3.49Å; I30-L33 PolarHBondContact O-N 2.87Å; I30-T34 HydrophobicContact CG2-CG2 4.32Å; I30-T34 WeakPolarHBondContact O-CB 3.27Å; I30-T34 VanDerWaalsContact O-CG2 3.27Å; I30-T34 WeakPolarHBondContact O-CG2 3.42Å; I30-T34 PolarHBondContact O-N 2.93Å; I30-T34 PolarHBondContact O-OG1 3.1Å
31	Y	81.5	Confident	77.3	Confident	155 Å²	155	105.4 Å²	105.4	61%	0.608	52%	0.518	S	S	*	.	H	α-helix	trans	-61.5	-44.5	177.6	177.9	-100.7	0	0	0	112	D27 D28 I29 T34 S35	D27-Y31 VanDerWaalsContact O-CB 3.29Å; D27-Y31 WeakPolarHBondContact O-CB 3.25Å; D27-Y31 PolarHBondContact O-N 3.32Å; D28-Y31 PolarHBondContact O-N 2.85Å; I29-Y31 VanDerWaalsContact C-N 3.35Å; I29-Y31 PolarHBondContact O-N 2.9Å; Y31-T34 WeakPolarHBondContact CA-OG1 3.34Å; Y31-T34 PolarHBondContact O-N 3.42Å; Y31-T34 PolarHBondContact O-OG1 3.2Å; Y31-S35 VanDerWaalsContact O-CB 3.27Å; Y31-S35 WeakPolarHBondContact O-CB 3.23Å; Y31-S35 PolarHBondContact O-N 2.91Å; Y31-S35 PolarHBondContact O-OG 2.71Å
32	R	77.7	Confident	75.6	Confident	135 Å²	135	107.1 Å²	107.1	51%	0.509	53%	0.532	S	S	.	.	H	α-helix	trans	-64.7	-45.9	176.9	-71.8	176.1	67.4	-166.1	-0.4	111.4	D28 I29 I30 T34 S35 Y36	D28-R32 WeakPolarHBondContact O-CB 3.42Å; D28-R32 VanDerWaalsContact O-CG 3.27Å; D28-R32 WeakPolarHBondContact O-CG 3.32Å; D28-R32 PolarHBondContact O-N 3.35Å; D28-R32 WeakPolarHBondContact OD2-CD 3.27Å; I29-R32 PolarHBondContact O-N 2.97Å; I30-R32 PolarHBondContact O-N 3.49Å; R32-T34 PolarHBondContact O-N 3.35Å; R32-S35 PolarHBondContact O-N 2.94Å; R32-Y36 WeakPolarHBondContact O-CB 3.5Å; R32-Y36 WeakPolarHBondContact O-CD2 3.41Å; R32-Y36 PolarHBondContact O-N 3.41Å
33	L	79	Confident	73.9	Confident	113 Å²	113	109.9 Å²	109.9	59%	0.592	54%	0.544	S	S	*	.	H	α-helix	trans	-61.7	-42.9	178	-74.8	171.9	0	0	0	112.3	I29 I30 Y36 R37	I29-L33 HydrophobicContact CG2-CD1 3.9Å; I29-L33 HydrophobicContact CG2-CG 4.42Å; I29-L33 WeakPolarHBondContact O-CB 3.5Å; I29-L33 VanDerWaalsContact O-CG 3.32Å; I29-L33 WeakPolarHBondContact O-CG 3.21Å; I29-L33 PolarHBondContact O-N 3.5Å; I30-L33 PolarHBondContact O-N 2.87Å; L33-Y36 PolarHBondContact O-N 3.41Å; L33-R37 WeakPolarHBondContact O-CB 3.44Å; L33-R37 PolarHBondContact O-N 2.82Å
34	T	78.3	Confident	72.1	Confident	64 Å²	64	113.4 Å²	113.4	39%	0.393	56%	0.557	S	S	.	*	H	α-helix	trans	-68.2	-37.8	177.6	53.5	0	0	0	0	111.8	I30 Y31 R32 R37 K38	I30-T34 HydrophobicContact CG2-CG2 4.32Å; I30-T34 WeakPolarHBondContact O-CB 3.27Å; I30-T34 VanDerWaalsContact O-CG2 3.27Å; I30-T34 WeakPolarHBondContact O-CG2 3.42Å; I30-T34 PolarHBondContact O-N 2.93Å; I30-T34 PolarHBondContact O-OG1 3.1Å; Y31-T34 WeakPolarHBondContact CA-OG1 3.34Å; Y31-T34 PolarHBondContact O-N 3.42Å; Y31-T34 PolarHBondContact O-OG1 3.2Å; R32-T34 PolarHBondContact O-N 3.35Å; T34-R37 PolarHBondContact O-N 3.18Å; T34-K38 WeakPolarHBondContact O-CG 3.47Å; T34-K38 PolarHBondContact O-N 2.84Å
35	S	73.4	Confident	70.5	Confident	38 Å²	38	112.5 Å²	112.5	27%	0.266	56%	0.564	S	S	.	*	H	α-helix	trans	-64.1	-46.5	173.3	-62.5	0	0	0	0	111.5	Y31 R32 R37 K38 T39	Y31-S35 VanDerWaalsContact O-CB 3.27Å; Y31-S35 WeakPolarHBondContact O-CB 3.23Å; Y31-S35 PolarHBondContact O-N 2.91Å; Y31-S35 PolarHBondContact O-OG 2.71Å; R32-S35 PolarHBondContact O-N 2.94Å; S35-R37 VanDerWaalsContact C-N 3.33Å; S35-R37 PolarHBondContact O-N 3.3Å; S35-K38 PolarHBondContact O-N 3.09Å; S35-T39 PolarHBondContact O-N 3Å; S35-T39 PolarHBondContact O-OG1 2.91Å; S35-T39 VanDerWaalsContact O-OG1 3.1Å
36	Y	71.4	Confident	69.1	Low	150 Å²	150	113 Å²	113	59%	0.588	57%	0.571	S	S	*	*	H	α-helix	trans	-57.3	-45.7	173.8	-87.3	-66.2	0	0	0	111.3	R32 L33 K38 T39 S40	R32-Y36 WeakPolarHBondContact O-CB 3.5Å; R32-Y36 WeakPolarHBondContact O-CD2 3.41Å; R32-Y36 PolarHBondContact O-N 3.41Å; L33-Y36 PolarHBondContact O-N 3.41Å; Y36-K38 VanDerWaalsContact C-N 3.33Å; Y36-K38 PolarHBondContact O-N 3.39Å; Y36-T39 WeakPolarHBondContact CA-OG1 3.43Å; Y36-T39 CarbonylContact O-C 3.58Å; Y36-T39 PolarHBondContact O-N 3.47Å; Y36-T39 PolarHBondContact O-OG1 3.39Å; Y36-S40 VanDerWaalsContact O-CB 3.23Å; Y36-S40 WeakPolarHBondContact O-CB 3.46Å; Y36-S40 PolarHBondContact O-N 2.91Å; Y36-S40 PolarHBondContact O-OG 3.43Å; Y36-S40 VanDerWaalsContact O-OG 3.09Å
37	R	66.1	Low	67.4	Low	184 Å²	184	111.8 Å²	111.8	69%	0.694	57%	0.569	S	S	*	*	H	α-helix	trans	-59.5	-42.3	177	-174.9	177.9	175.2	-173.7	-0.8	112.3	L33 T34 S35 S40 M41	L33-R37 WeakPolarHBondContact O-CB 3.44Å; L33-R37 PolarHBondContact O-N 2.82Å; T34-R37 PolarHBondContact O-N 3.18Å; S35-R37 VanDerWaalsContact C-N 3.33Å; S35-R37 PolarHBondContact O-N 3.3Å; R37-S40 WeakPolarHBondContact CA-OG 3.34Å; R37-S40 PolarHBondContact O-N 3.22Å; R37-S40 PolarHBondContact O-OG 3.38Å; R37-S40 VanDerWaalsContact O-OG 3.13Å; R37-M41 WeakPolarHBondContact O-CG 3.14Å; R37-M41 PolarHBondContact O-N 2.71Å
38	K	64.3	Low	65.9	Low	168 Å²	168	114.8 Å²	114.8	73%	0.73	58%	0.577	S	S	*	*	H	α-helix	trans	-63.8	-42.9	176.4	-74.3	178.6	-178.6	178.9	0	111.4	T34 S35 Y36	T34-K38 WeakPolarHBondContact O-CG 3.47Å; T34-K38 PolarHBondContact O-N 2.84Å; S35-K38 PolarHBondContact O-N 3.09Å; Y36-K38 VanDerWaalsContact C-N 3.33Å; Y36-K38 PolarHBondContact O-N 3.39Å
39	T	61.2	Low	64.4	Low	78 Å²	78	116 Å²	116	48%	0.479	58%	0.584	S	S	.	*	H	α-helix	trans	-72.6	-35.7	177.3	51	0	0	0	0	113	S35 Y36 M41 S42 L43	S35-T39 PolarHBondContact O-N 3Å; S35-T39 PolarHBondContact O-OG1 2.91Å; S35-T39 VanDerWaalsContact O-OG1 3.1Å; Y36-T39 WeakPolarHBondContact CA-OG1 3.43Å; Y36-T39 CarbonylContact O-C 3.58Å; Y36-T39 PolarHBondContact O-N 3.47Å; Y36-T39 PolarHBondContact O-OG1 3.39Å; T39-M41 VanDerWaalsContact C-N 3.31Å; T39-M41 PolarHBondContact O-N 3.21Å; T39-S42 WeakPolarHBondContact O-CB 3.43Å; T39-S42 PolarHBondContact O-N 3.35Å; T39-S42 PolarHBondContact O-OG 3.03Å; T39-L43 PolarHBondContact O-N 3.13Å
40	S	55.3	Low	63	Low	59 Å²	59	117.1 Å²	117.1	41%	0.413	59%	0.59	S	S	.	*	H	α-helix	trans	-74.2	-21.4	179.5	69.9	0	0	0	0	112.3	Y36 R37 S42 L43	Y36-S40 VanDerWaalsContact O-CB 3.23Å; Y36-S40 WeakPolarHBondContact O-CB 3.46Å; Y36-S40 PolarHBondContact O-N 2.91Å; Y36-S40 PolarHBondContact O-OG 3.43Å; Y36-S40 VanDerWaalsContact O-OG 3.09Å; R37-S40 WeakPolarHBondContact CA-OG 3.34Å; R37-S40 PolarHBondContact O-N 3.22Å; R37-S40 PolarHBondContact O-OG 3.38Å; R37-S40 VanDerWaalsContact O-OG 3.13Å; S40-S42 PolarHBondContact O-N 3.02Å; S40-L43 PolarHBondContact O-N 3.49Å
41	M	52.5	Low	61.7	Low	158 Å²	158	118 Å²	118	78%	0.778	60%	0.595	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.6	-19.2	166.1	-80.2	-172.5	66.9	0	0	113.1	R37 T39	R37-M41 WeakPolarHBondContact O-CG 3.14Å; R37-M41 PolarHBondContact O-N 2.71Å; T39-M41 VanDerWaalsContact C-N 3.31Å; T39-M41 PolarHBondContact O-N 3.21Å
42	S	54.5	Low	60.5	Low	96 Å²	96	118 Å²	118	67%	0.671	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.7	-18.8	171.9	82.9	0	0	0	0	113.5	T39 S40 Q44	T39-S42 WeakPolarHBondContact O-CB 3.43Å; T39-S42 PolarHBondContact O-N 3.35Å; T39-S42 PolarHBondContact O-OG 3.03Å; S40-S42 PolarHBondContact O-N 3.02Å; S42-Q44 PolarHBondContact O-N 3.46Å
43	L	51.2	Low	59.4	Low	128 Å²	128	120 Å²	120	67%	0.67	61%	0.611	S	S	*	*	S	Bend	trans	-81.3	100.8	169.6	-68.8	167.2	0	0	0	106.4	T39 S40	T39-L43 PolarHBondContact O-N 3.13Å; S40-L43 PolarHBondContact O-N 3.49Å
44	Q	53.3	Low	58.1	Low	169 Å²	169	126 Å²	126	79%	0.79	63%	0.626	S	S	*	*			trans	-43.3	136.8	169.1	-62.9	-152.4	-42.1	0	0	108.7	S42 V46	S42-Q44 PolarHBondContact O-N 3.46Å; Q44-V46 PolarHBondContact O-N 2.75Å
45	P	52.5	Low	56.6	Low	121 Å²	121	129.7 Å²	129.7	79%	0.786	66%	0.662	S	S	*	*			trans	-54	113.7	176.4	22.8	-30.7	0	0	0	105.9	S47	P45-S47 PolarHBondContact O-N 2.82Å
46	V	53.8	Low	55.8	Low	107 Å²	107	134.3 Å²	134.3	65%	0.648	68%	0.682	S	S	*	*			trans	-56	103.7	163.5	177.7	0	0	0	0	102.3	Q44 F48	Q44-V46 PolarHBondContact O-N 2.75Å; V46-F48 PolarHBondContact O-N 3.05Å
47	S	51.9	Low	55	Low	58 Å²	58	133.5 Å²	133.5	41%	0.406	69%	0.687	S	S	.	*			trans	-54.5	125.6	-173.4	55.2	0	0	0	0	105.6	P45 D49 L50	P45-S47 PolarHBondContact O-N 2.82Å; S47-D49 PolarHBondContact O-N 2.83Å; S47-L50 PolarHBondContact O-N 2.88Å
48	F	53.6	Low	54.3	Low	164 Å²	164	130.7 Å²	130.7	72%	0.719	69%	0.687	S	S	*	*	H	α-helix	trans	-51.9	-20.7	177.8	-126.7	-95	0	0	0	111.3	V46 L50 L51 K52	V46-F48 PolarHBondContact O-N 3.05Å; F48-L50 VanDerWaalsContact C-N 3.33Å; F48-L50 PolarHBondContact O-N 3.22Å; F48-L51 PolarHBondContact O-N 3.41Å; F48-K52 PolarHBondContact O-N 3.47Å; F48-K52 VanDerWaalsContact O-N 3.09Å
49	D	54.1	Low	53.7	Low	106 Å²	106	128.5 Å²	128.5	57%	0.567	68%	0.684	S	S	*	*	H	α-helix	trans	-57	-32.3	169.5	-87.7	-3.2	0	0	0	115.4	S47 K53	S47-D49 PolarHBondContact O-N 2.83Å; D49-K53 WeakPolarHBondContact O-CG 3.49Å; D49-K53 PolarHBondContact O-N 3.09Å
50	L	54.9	Low	53.3	Low	111 Å²	111	131.6 Å²	131.6	58%	0.581	70%	0.697	S	S	*	*	H	α-helix	trans	-73.6	-28.6	176.3	-77.6	170.2	0	0	0	112.5	S47 F48	S47-L50 PolarHBondContact O-N 2.88Å; F48-L50 VanDerWaalsContact C-N 3.33Å; F48-L50 PolarHBondContact O-N 3.22Å
51	L	54.5	Low	53.1	Low	117 Å²	117	136.5 Å²	136.5	61%	0.613	72%	0.716	S	S	*	*	H	α-helix	trans	-77.3	-37	173.5	-90.2	154.6	0	0	0	111.6	F48 K53 R54	F48-L51 PolarHBondContact O-N 3.41Å; L51-K53 PolarHBondContact O-N 3.41Å; L51-R54 PolarHBondContact O-N 3.49Å
52	K	56.7	Low	53.2	Low	154 Å²	154	134.9 Å²	134.9	67%	0.67	71%	0.711	S	S	*	*	H	α-helix	trans	-69.9	-26.7	176.4	-92.7	-172.2	178.1	-179.7	0	114.6	F48 R54	F48-K52 PolarHBondContact O-N 3.47Å; F48-K52 VanDerWaalsContact O-N 3.09Å; K52-R54 VanDerWaalsContact C-N 3.27Å; K52-R54 PolarHBondContact O-N 3.19Å
53	K	54.4	Low	53.1	Low	177 Å²	177	137.9 Å²	137.9	77%	0.77	72%	0.715	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.1	-6	177.8	-76.1	-177.8	179.3	179.9	0	114.1	D49 L51	D49-K53 WeakPolarHBondContact O-CG 3.49Å; D49-K53 PolarHBondContact O-N 3.09Å; L51-K53 PolarHBondContact O-N 3.41Å
54	R	52	Low	53.2	Low	240 Å²	240	138.8 Å²	138.8	91%	0.906	72%	0.718	S	S	*	*	T	Hydrogen-bonded Turn	trans	-111.9	0.9	178	-78.2	-172.8	172.4	-179.4	-1	114	L51 K52	L51-R54 PolarHBondContact O-N 3.49Å; K52-R54 VanDerWaalsContact C-N 3.27Å; K52-R54 PolarHBondContact O-N 3.19Å
55	A	47.4	Very low	53.2	Low	141 Å²	141	136 Å²	136	100%	1.165	71%	0.712	S	S	*	*			trans	-109.4	0	171.3	0	0	0	0	0	109.3

Retrieved 55 of 55 residues in 13.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).