G4M195_SCHMA Loading...

Dpy30-related

AlphaFold DB , UniProt , Accession G4M195, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 62 aa.

						>G4M195_SCHMA|G4M195
MESQDDNNTQDPKSTDTRAYLDKTVVPVLLKGLNMIAKERPPNPIEALATFLMQHKEEIENE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58.8	Low	56.8	Low	248 Å²	248	149.3 Å²	149.3	100%	1.222	78%	0.781	S	S	*	*				0	87.5	0	-95.4	165.5	162	0	0	106.3
2	E	48.8	Very low	57.2	Low	190 Å²	190	145.4 Å²	145.4	89%	0.888	77%	0.772	S	S	*	*			trans	-100.5	107.3	171	-79.7	169.2	126.6	0	0	107
3	S	56.9	Low	58.1	Low	108 Å²	108	147.5 Å²	147.5	76%	0.755	77%	0.77	S	S	*	*			trans	-163.5	65.5	160.8	-62.4	0	0	0	0	105.2	D5	S3-D5 PolarHBondContact O-N 3.09Å
4	Q	53.5	Low	58.8	Low	196 Å²	196	141.2 Å²	141.2	92%	0.916	75%	0.745	S	S	*	*			trans	-91.8	94.1	162.4	-92.9	169.4	-88.4	0	0	105.3	D6	Q4-D6 PolarHBondContact O-N 3.16Å
5	D	57.6	Low	59.9	Low	143 Å²	143	136.7 Å²	136.7	77%	0.765	73%	0.725	S	S	*	*			trans	-38.8	123.6	170.3	-63.2	-69.2	0	0	0	109.8	S3 N7	S3-D5 PolarHBondContact O-N 3.09Å; D5-N7 PolarHBondContact O-N 3.34Å
6	D	55.9	Low	61.6	Low	165 Å²	165	135.4 Å²	135.4	88%	0.882	72%	0.719	S	S	*	*			trans	-55.5	89.3	166.1	-76.7	-58.4	0	0	0	107.6	Q4 N8	Q4-D6 PolarHBondContact O-N 3.16Å; D6-N8 PolarHBondContact O-N 3.41Å
7	N	55	Low	63.4	Low	139 Å²	139	132.2 Å²	132.2	74%	0.743	71%	0.705	S	S	*	*			trans	-70.8	86.5	178.4	-163.4	14.3	0	0	0	105.9	D5 T9	D5-N7 PolarHBondContact O-N 3.34Å; N7-T9 PolarHBondContact O-N 2.84Å; N7-T9 PolarHBondContact O-OG1 2.91Å
8	N	56.5	Low	65.1	Low	119 Å²	119	134.7 Å²	134.7	64%	0.636	70%	0.703	S	S	*	*			trans	-48.7	81.8	168.3	177	42.5	0	0	0	108	D6 Q10	D6-N8 PolarHBondContact O-N 3.41Å; N8-Q10 WeakPolarHBondContact ND2-CG 3.42Å; N8-Q10 PolarHBondContact O-N 3.43Å
9	T	58.9	Low	66.5	Low	104 Å²	104	129.8 Å²	129.8	64%	0.638	69%	0.685	S	S	*	*			trans	-74.7	86.3	178.8	-57.6	0	0	0	0	104.2	N7 D11	N7-T9 PolarHBondContact O-N 2.84Å; N7-T9 PolarHBondContact O-OG1 2.91Å; T9-D11 VanDerWaalsContact C-N 3.29Å; T9-D11 PolarHBondContact O-N 2.85Å
10	Q	60.8	Low	67.8	Low	126 Å²	126	130.7 Å²	130.7	59%	0.589	68%	0.679	S	S	*	*			trans	-65.8	95.3	175	-68.3	-176.6	-54.5	0	0	107.1	N8 P12	N8-Q10 WeakPolarHBondContact ND2-CG 3.42Å; N8-Q10 PolarHBondContact O-N 3.43Å; Q10-P12 WeakPolarHBondContact O-CD 3.38Å
11	D	61.9	Low	69.1	Low	104 Å²	104	127.9 Å²	127.9	56%	0.556	67%	0.665	S	S	*	*			trans	-52.8	122.1	172.6	-75.6	-67	0	0	0	108.5	T9 K13 S14	T9-D11 VanDerWaalsContact C-N 3.29Å; T9-D11 PolarHBondContact O-N 2.85Å; D11-K13 PolarHBondContact O-N 3.22Å; D11-S14 WeakPolarHBondContact O-CA 3.3Å; D11-S14 WeakPolarHBondContact O-CB 3.49Å; D11-S14 PolarHBondContact O-N 3.24Å; D11-S14 PolarHBondContact O-OG 2.99Å
12	P	61.9	Low	70.7	Confident	103 Å²	103	120 Å²	120	67%	0.669	63%	0.628	S	S	*	*	H	α-helix	trans	-59.5	-19.4	-177.5	18.8	-30.2	0	0	0	113.4	Q10 T15 D16	Q10-P12 WeakPolarHBondContact O-CD 3.38Å; P12-T15 VanDerWaalsContact C-OG1 3.3Å; P12-T15 WeakPolarHBondContact CA-OG1 3.39Å; P12-T15 PolarHBondContact O-OG1 3.37Å; P12-D16 PolarHBondContact O-N 2.83Å
13	K	68.9	Low	72.7	Confident	172 Å²	172	119.4 Å²	119.4	75%	0.748	62%	0.622	S	S	*	*	H	α-helix	trans	-70.4	-32.7	171.4	-63.6	-175.7	-179	178.2	0	113	D11 D16 T17	D11-K13 PolarHBondContact O-N 3.22Å; K13-D16 PolarHBondContact O-N 3.04Å; K13-T17 PolarHBondContact O-N 2.94Å; K13-T17 PolarHBondContact O-OG1 3.08Å
14	S	68.4	Low	74.3	Confident	60 Å²	60	116.4 Å²	116.4	42%	0.42	60%	0.599	S	S	.	*	H	α-helix	trans	-68.9	-38.8	178.4	72.5	0	0	0	0	111.4	D11 D16 T17 R18	D11-S14 WeakPolarHBondContact O-CA 3.3Å; D11-S14 WeakPolarHBondContact O-CB 3.49Å; D11-S14 PolarHBondContact O-N 3.24Å; D11-S14 PolarHBondContact O-OG 2.99Å; S14-D16 VanDerWaalsContact C-N 3.31Å; S14-D16 PolarHBondContact O-N 3.31Å; S14-T17 PolarHBondContact O-N 3.05Å; S14-R18 PolarHBondContact O-N 3.48Å
15	T	74.5	Confident	76.2	Confident	73 Å²	73	109.9 Å²	109.9	45%	0.448	57%	0.573	S	S	.	*	H	α-helix	trans	-62.6	-38.7	174	39.9	0	0	0	0	111.9	P12 A19	P12-T15 VanDerWaalsContact C-OG1 3.3Å; P12-T15 WeakPolarHBondContact CA-OG1 3.39Å; P12-T15 PolarHBondContact O-OG1 3.37Å; T15-A19 WeakPolarHBondContact O-CB 3.47Å; T15-A19 PolarHBondContact O-N 2.92Å
16	D	87.7	Confident	78	Confident	117 Å²	117	105.1 Å²	105.1	63%	0.626	55%	0.549	S	S	*	.	H	α-helix	trans	-66.6	-43.6	176.5	-167.4	15	0	0	0	111.4	P12 K13 S14 R18 A19 Y20	P12-D16 PolarHBondContact O-N 2.83Å; K13-D16 PolarHBondContact O-N 3.04Å; S14-D16 VanDerWaalsContact C-N 3.31Å; S14-D16 PolarHBondContact O-N 3.31Å; D16-R18 PolarHBondContact O-N 3.35Å; D16-A19 PolarHBondContact O-N 3.37Å; D16-Y20 VanDerWaalsContact O-CB 3.31Å; D16-Y20 WeakPolarHBondContact O-CB 3.49Å; D16-Y20 PolarHBondContact O-N 2.99Å
17	T	92.5	Very high	79.8	Confident	80 Å²	80	99.6 Å²	99.6	49%	0.491	52%	0.522	S	S	.	.	H	α-helix	trans	-60.9	-47.7	176.6	-55.8	0	0	0	0	111.6	K13 S14 Y20 L21	K13-T17 PolarHBondContact O-N 2.94Å; K13-T17 PolarHBondContact O-OG1 3.08Å; S14-T17 PolarHBondContact O-N 3.05Å; T17-Y20 PolarHBondContact O-N 3.28Å; T17-L21 HydrophobicContact CG2-CD1 4.09Å; T17-L21 HydrophobicContact CG2-CG 4.48Å; T17-L21 VanDerWaalsContact O-CG 3.32Å; T17-L21 WeakPolarHBondContact O-CG 3.48Å; T17-L21 PolarHBondContact O-N 2.82Å
18	R	93.2	Very high	81.7	Confident	178 Å²	178	93.7 Å²	93.7	67%	0.672	49%	0.491	S	S	*	.	H	α-helix	trans	-60.6	-48.5	178.2	-178.2	177.9	-66.6	-176.7	-0.7	110.9	S14 D16 Y20 L21 D22	S14-R18 PolarHBondContact O-N 3.48Å; D16-R18 PolarHBondContact O-N 3.35Å; R18-Y20 VanDerWaalsContact C-N 3.31Å; R18-Y20 PolarHBondContact O-N 2.94Å; R18-L21 PolarHBondContact O-N 2.91Å; R18-D22 WeakPolarHBondContact CG-OD2 3.35Å; R18-D22 WeakPolarHBondContact O-CB 3.2Å; R18-D22 VanDerWaalsContact O-CG 3.23Å; R18-D22 PolarHBondContact O-N 3.27Å
19	A	92.4	Very high	83.6	Confident	42 Å²	42	90.7 Å²	90.7	35%	0.347	48%	0.475	S	S	.	.	H	α-helix	trans	-61.7	-39.2	179.9	0	0	0	0	0	112.5	T15 D16 K23	T15-A19 WeakPolarHBondContact O-CB 3.47Å; T15-A19 PolarHBondContact O-N 2.92Å; D16-A19 PolarHBondContact O-N 3.37Å; A19-K23 WeakPolarHBondContact O-CB 3.42Å; A19-K23 VanDerWaalsContact O-CG 3.27Å; A19-K23 WeakPolarHBondContact O-CG 3.48Å; A19-K23 PolarHBondContact O-N 3.46Å; A19-K23 VanDerWaalsContact O-N 3.15Å
20	Y	92.7	Very high	85.4	Confident	146 Å²	146	90.5 Å²	90.5	57%	0.573	47%	0.469	S	S	*	.	H	α-helix	trans	-62	-48.7	174.5	173.3	-102.9	0	0	0	111.5	D16 T17 R18 K23 T24	D16-Y20 VanDerWaalsContact O-CB 3.31Å; D16-Y20 WeakPolarHBondContact O-CB 3.49Å; D16-Y20 PolarHBondContact O-N 2.99Å; T17-Y20 PolarHBondContact O-N 3.28Å; R18-Y20 VanDerWaalsContact C-N 3.31Å; R18-Y20 PolarHBondContact O-N 2.94Å; Y20-K23 PolarHBondContact O-N 3.47Å; Y20-T24 HydrophobicContact CD2-CG2 4.02Å; Y20-T24 HydrophobicContact CE2-CG2 3.69Å; Y20-T24 WeakPolarHBondContact O-CB 3.38Å; Y20-T24 VanDerWaalsContact O-CG2 3.29Å; Y20-T24 WeakPolarHBondContact O-CG2 3.38Å; Y20-T24 PolarHBondContact O-N 3.38Å; Y20-T24 VanDerWaalsContact O-N 3.09Å; Y20-T24 PolarHBondContact O-OG1 3.29Å
21	L	95.2	Very high	87.1	Confident	72 Å²	72	88.8 Å²	88.8	38%	0.377	46%	0.46	S	S	.	.	H	α-helix	trans	-66.2	-42	179.9	-66.1	176.9	0	0	0	112	T17 R18 K23 T24 V25 V26	T17-L21 HydrophobicContact CG2-CD1 4.09Å; T17-L21 HydrophobicContact CG2-CG 4.48Å; T17-L21 VanDerWaalsContact O-CG 3.32Å; T17-L21 WeakPolarHBondContact O-CG 3.48Å; T17-L21 PolarHBondContact O-N 2.82Å; R18-L21 PolarHBondContact O-N 2.91Å; L21-K23 PolarHBondContact O-N 3.45Å; L21-T24 PolarHBondContact O-N 3.28Å; L21-V25 HydrophobicContact CB-CG2 4.4Å; L21-V25 HydrophobicContact CD2-CG2 3.76Å; L21-V25 PolarHBondContact O-N 3.27Å; L21-V26 HydrophobicContact CB-CG2 4.03Å; L21-V26 WeakPolarHBondContact O-CB 3.29Å; L21-V26 VanDerWaalsContact O-CG2 3.29Å; L21-V26 WeakPolarHBondContact O-CG2 3.4Å; L21-V26 PolarHBondContact O-N 2.88Å
22	D	92.1	Very high	88.7	Confident	83 Å²	83	83.8 Å²	83.8	44%	0.444	43%	0.433	S	S	.	.	H	α-helix	trans	-58.4	-34.1	176.9	-75.4	-15.1	0	0	0	112.2	R18 P27	R18-D22 WeakPolarHBondContact CG-OD2 3.35Å; R18-D22 WeakPolarHBondContact O-CB 3.2Å; R18-D22 VanDerWaalsContact O-CG 3.23Å; R18-D22 PolarHBondContact O-N 3.27Å; D22-P27 VanDerWaalsContact O-CD 3.27Å; D22-P27 WeakPolarHBondContact O-CD 3.33Å; D22-P27 WeakPolarHBondContact O-CG 3.44Å
23	K	89.3	Confident	90.4	Very high	177 Å²	177	83.4 Å²	83.4	77%	0.77	43%	0.425	S	S	*	.	H	α-helix	trans	-86.8	-20.4	179.5	-73.2	177.9	177.5	-176.6	0	114.7	A19 Y20 L21	A19-K23 WeakPolarHBondContact O-CB 3.42Å; A19-K23 VanDerWaalsContact O-CG 3.27Å; A19-K23 WeakPolarHBondContact O-CG 3.48Å; A19-K23 PolarHBondContact O-N 3.46Å; A19-K23 VanDerWaalsContact O-N 3.15Å; Y20-K23 PolarHBondContact O-N 3.47Å; L21-K23 PolarHBondContact O-N 3.45Å
24	T	91.2	Very high	91.8	Very high	45 Å²	45	80.6 Å²	80.6	28%	0.276	42%	0.418	S	S	.	.	H	α-helix	trans	-107.9	-65.8	-170.6	51.6	0	0	0	0	111.5	Y20 L21	Y20-T24 HydrophobicContact CD2-CG2 4.02Å; Y20-T24 HydrophobicContact CE2-CG2 3.69Å; Y20-T24 WeakPolarHBondContact O-CB 3.38Å; Y20-T24 VanDerWaalsContact O-CG2 3.29Å; Y20-T24 WeakPolarHBondContact O-CG2 3.38Å; Y20-T24 PolarHBondContact O-N 3.38Å; Y20-T24 VanDerWaalsContact O-N 3.09Å; Y20-T24 PolarHBondContact O-OG1 3.29Å; L21-T24 PolarHBondContact O-N 3.28Å
25	V	93.8	Very high	93.1	Very high	60 Å²	60	79.4 Å²	79.4	36%	0.364	41%	0.406	S	S	.	.	T	Hydrogen-bonded Turn	trans	-111.3	-27.5	-165.2	-63.2	0	0	0	0	113.2	L21 V28 L29	L21-V25 HydrophobicContact CB-CG2 4.4Å; L21-V25 HydrophobicContact CD2-CG2 3.76Å; L21-V25 PolarHBondContact O-N 3.27Å; V25-V28 WeakPolarHBondContact O-CG1 3.31Å; V25-V28 PolarHBondContact O-N 2.94Å; V25-L29 HydrophobicContact CB-CD1 3.95Å; V25-L29 HydrophobicContact CB-CG 4.46Å; V25-L29 HydrophobicContact CG2-CD1 3.94Å; V25-L29 VanDerWaalsContact O-CB 3.31Å; V25-L29 WeakPolarHBondContact O-CB 3.3Å; V25-L29 WeakPolarHBondContact O-CD1 3.48Å; V25-L29 WeakPolarHBondContact O-CG 3.25Å; V25-L29 PolarHBondContact O-N 3.26Å
26	V	94.6	Very high	94.3	Very high	43 Å²	43	77.3 Å²	77.3	26%	0.261	39%	0.392	S	S	.	.	H	α-helix	trans	-59.2	-44.5	-175.8	169.9	0	0	0	0	112.6	L21 V28 L29 L30	L21-V26 HydrophobicContact CB-CG2 4.03Å; L21-V26 WeakPolarHBondContact O-CB 3.29Å; L21-V26 VanDerWaalsContact O-CG2 3.29Å; L21-V26 WeakPolarHBondContact O-CG2 3.4Å; L21-V26 PolarHBondContact O-N 2.88Å; V26-V28 PolarHBondContact O-N 3.19Å; V26-L29 PolarHBondContact O-N 3.14Å; V26-L30 HydrophobicContact CG1-CD1 3.9Å; V26-L30 HydrophobicContact CG1-CG 4.18Å; V26-L30 WeakPolarHBondContact O-CG 3.34Å; V26-L30 PolarHBondContact O-N 2.92Å
27	P	94.6	Very high	94.7	Very high	49 Å²	49	74.9 Å²	74.9	32%	0.318	39%	0.388	S	S	.	.	H	α-helix	trans	-60.5	-44.3	-177.8	-24.3	35.5	0	0	0	112.6	D22 K31 I59	D22-P27 VanDerWaalsContact O-CD 3.27Å; D22-P27 WeakPolarHBondContact O-CD 3.33Å; D22-P27 WeakPolarHBondContact O-CG 3.44Å; P27-K31 WeakPolarHBondContact O-CG 3.34Å; P27-K31 PolarHBondContact O-N 3.42Å; P27-I59 HydrophobicContact CB-CD1 4.05Å
28	V	94.6	Very high	95	Very high	14 Å²	14	79.7 Å²	79.7	9%	0.085	40%	0.402	C	S	.	.	H	α-helix	trans	-72.5	-37.2	178.9	70.2	0	0	0	0	112.2	V25 V26 L30 K31 G32 F51 L52 H55 I59	V25-V28 WeakPolarHBondContact O-CG1 3.31Å; V25-V28 PolarHBondContact O-N 2.94Å; V26-V28 PolarHBondContact O-N 3.19Å; V28-L30 VanDerWaalsContact C-N 3.34Å; V28-L30 PolarHBondContact O-N 3.02Å; V28-K31 PolarHBondContact O-N 2.89Å; V28-G32 PolarHBondContact O-N 3.31Å; V28-F51 HydrophobicContact CG2-CE1 4.21Å; V28-L52 HydrophobicContact CB-CD2 4.14Å; V28-L52 HydrophobicContact CG1-CD2 3.63Å; V28-L52 HydrophobicContact CG2-CD2 3.65Å; V28-H55 HydrophobicContact CG2-CB 4.4Å; V28-I59 HydrophobicContact CB-CD1 3.6Å; V28-I59 HydrophobicContact CB-CG1 3.78Å; V28-I59 HydrophobicContact CG2-CD1 4.24Å; V28-I59 HydrophobicContact CG2-CG1 4.03Å
29	L	96.9	Very high	95.2	Very high	57 Å²	57	77.5 Å²	77.5	30%	0.298	40%	0.399	S	S	.	.	H	α-helix	trans	-62	-43.3	176.2	-75.2	170	0	0	0	110.8	V25 V26 K31 G32 L33 L48 L52	V25-L29 HydrophobicContact CB-CD1 3.95Å; V25-L29 HydrophobicContact CB-CG 4.46Å; V25-L29 HydrophobicContact CG2-CD1 3.94Å; V25-L29 VanDerWaalsContact O-CB 3.31Å; V25-L29 WeakPolarHBondContact O-CB 3.3Å; V25-L29 WeakPolarHBondContact O-CD1 3.48Å; V25-L29 WeakPolarHBondContact O-CG 3.25Å; V25-L29 PolarHBondContact O-N 3.26Å; V26-L29 PolarHBondContact O-N 3.14Å; L29-K31 PolarHBondContact O-N 3.17Å; L29-G32 PolarHBondContact O-N 3.47Å; L29-L33 WeakPolarHBondContact O-CB 3.27Å; L29-L33 WeakPolarHBondContact O-CG 3.45Å; L29-L33 PolarHBondContact O-N 2.75Å; L29-L48 HydrophobicContact CD2-CD2 4.48Å; L29-L52 HydrophobicContact CD2-CD1 4.08Å; L29-L52 HydrophobicContact CD2-CD2 4.24Å
30	L	96.6	Very high	95.4	Very high	100 Å²	100	85.6 Å²	85.6	52%	0.524	42%	0.421	S	S	.	.	H	α-helix	trans	-61.8	-42.1	176.5	-70.4	176.8	0	0	0	112.1	V26 V28 N34	V26-L30 HydrophobicContact CG1-CD1 3.9Å; V26-L30 HydrophobicContact CG1-CG 4.18Å; V26-L30 WeakPolarHBondContact O-CG 3.34Å; V26-L30 PolarHBondContact O-N 2.92Å; V28-L30 VanDerWaalsContact C-N 3.34Å; V28-L30 PolarHBondContact O-N 3.02Å; L30-N34 WeakPolarHBondContact O-CB 3.18Å; L30-N34 PolarHBondContact O-N 3.39Å; L30-N34 PolarHBondContact O-ND2 3.06Å
31	K	95.7	Very high	95.7	Very high	89 Å²	89	80 Å²	80	39%	0.387	40%	0.403	S	S	.	.	H	α-helix	trans	-61.3	-47.1	174.7	-68.7	175.9	-178	176	0	111.1	P27 V28 L29 N34 M35 F51	P27-K31 WeakPolarHBondContact O-CG 3.34Å; P27-K31 PolarHBondContact O-N 3.42Å; V28-K31 PolarHBondContact O-N 2.89Å; L29-K31 PolarHBondContact O-N 3.17Å; K31-N34 PolarHBondContact O-N 3.37Å; K31-M35 PolarHBondContact O-N 3.46Å; K31-M35 VanDerWaalsContact O-N 3.08Å; K31-F51 HydrophobicContact CB-CE1 3.94Å; K31-F51 HydrophobicContact CB-CZ 3.83Å
32	G	96.4	Very high	95.8	Very high	0 Å²	0	82.6 Å²	82.6	0%	0	42%	0.424	C	S	.	.	H	α-helix	trans	-65	-41.3	179.6	0	0	0	0	0	113.4	V28 L29 N34 M35 I36 F51	V28-G32 PolarHBondContact O-N 3.31Å; L29-G32 PolarHBondContact O-N 3.47Å; G32-N34 VanDerWaalsContact C-N 3.34Å; G32-N34 PolarHBondContact O-N 3.4Å; G32-M35 WeakPolarHBondContact O-CB 3.22Å; G32-M35 PolarHBondContact O-N 3.08Å; G32-I36 WeakPolarHBondContact O-CG1 3.48Å; G32-I36 PolarHBondContact O-N 3.47Å; G32-F51 VanDerWaalsContact CA-CD1 3.43Å; G32-F51 VanDerWaalsContact CA-CE1 3.44Å; G32-F51 VanDerWaalsContact N-CE1 3.32Å
33	L	98	Very high	96	Very high	95 Å²	95	83 Å²	83	50%	0.497	43%	0.426	S	S	.	.	H	α-helix	trans	-64.1	-38.6	175.6	-71	175.9	0	0	0	111.9	L29 I36 A37	L29-L33 WeakPolarHBondContact O-CB 3.27Å; L29-L33 WeakPolarHBondContact O-CG 3.45Å; L29-L33 PolarHBondContact O-N 2.75Å; L33-I36 PolarHBondContact O-N 3.26Å; L33-A37 WeakPolarHBondContact O-CB 3.44Å; L33-A37 PolarHBondContact O-N 3.41Å
34	N	97.5	Very high	96.4	Very high	113 Å²	113	77.5 Å²	77.5	60%	0.604	41%	0.408	S	S	*	.	H	α-helix	trans	-63	-41.7	173.5	-80	-47.4	0	0	0	112.1	L30 K31 G32 A37 K38	L30-N34 WeakPolarHBondContact O-CB 3.18Å; L30-N34 PolarHBondContact O-N 3.39Å; L30-N34 PolarHBondContact O-ND2 3.06Å; K31-N34 PolarHBondContact O-N 3.37Å; G32-N34 VanDerWaalsContact C-N 3.34Å; G32-N34 PolarHBondContact O-N 3.4Å; N34-A37 PolarHBondContact O-N 3.03Å; N34-K38 WeakPolarHBondContact O-CB 3.39Å; N34-K38 PolarHBondContact O-N 2.94Å; N34-K38 VanDerWaalsContact O-N 3.09Å
35	M	96.4	Very high	96.7	Very high	35 Å²	35	82.2 Å²	82.2	17%	0.172	43%	0.43	C	S	.	.	H	α-helix	trans	-60.2	-47.3	174.6	174.5	-88	-79.3	0	0	111.2	K31 G32 A37 K38 E39 F51	K31-M35 PolarHBondContact O-N 3.46Å; K31-M35 VanDerWaalsContact O-N 3.08Å; G32-M35 WeakPolarHBondContact O-CB 3.22Å; G32-M35 PolarHBondContact O-N 3.08Å; M35-A37 PolarHBondContact O-N 3.29Å; M35-K38 PolarHBondContact O-N 2.96Å; M35-K38 VanDerWaalsContact O-N 3.16Å; M35-E39 HydrophobicContact CG-CG 4.44Å; M35-E39 WeakPolarHBondContact O-CB 3.5Å; M35-E39 PolarHBondContact O-N 2.71Å; M35-F51 HydrophobicContact CB-CE2 4.43Å; M35-F51 HydrophobicContact CE-CB 3.44Å; M35-F51 VanDerWaalsContact CE-CB 3.44Å; M35-F51 HydrophobicContact CE-CD2 3.45Å; M35-F51 VanDerWaalsContact CE-CD2 3.45Å; M35-F51 HydrophobicContact CE-CE2 4.43Å; M35-F51 HydrophobicContact CE-CG 3.65Å; M35-F51 HydrophobicContact CG-CD2 4.46Å
36	I	98	Very high	97	Very high	28 Å²	28	85.1 Å²	85.1	14%	0.144	44%	0.44	C	S	.	.	H	α-helix	trans	-62.4	-42.8	178.2	-68.5	163.5	0	0	0	111.7	G32 L33 K38 R40 P44 L48	G32-I36 WeakPolarHBondContact O-CG1 3.48Å; G32-I36 PolarHBondContact O-N 3.47Å; L33-I36 PolarHBondContact O-N 3.26Å; I36-K38 PolarHBondContact O-N 2.85Å; I36-R40 VanDerWaalsContact O-CA 3.3Å; I36-R40 WeakPolarHBondContact O-CA 3.34Å; I36-R40 PolarHBondContact O-N 2.66Å; I36-P44 WeakPolarHBondContact CD1-O 3.5Å; I36-P44 HydrophobicContact CG2-CB 3.83Å; I36-L48 HydrophobicContact CD1-CB 3.61Å; I36-L48 HydrophobicContact CD1-CD1 3.88Å; I36-L48 HydrophobicContact CD1-CD2 4.35Å; I36-L48 HydrophobicContact CD1-CG 4.13Å
37	A	97.6	Very high	97.1	Very high	66 Å²	66	84.2 Å²	84.2	55%	0.545	44%	0.437	S	S	.	.	H	α-helix	trans	-61	-35.6	178.1	0	0	0	0	0	112.1	L33 N34 M35	L33-A37 WeakPolarHBondContact O-CB 3.44Å; L33-A37 PolarHBondContact O-N 3.41Å; N34-A37 PolarHBondContact O-N 3.03Å; M35-A37 PolarHBondContact O-N 3.29Å
38	K	97.6	Very high	97.3	Very high	181 Å²	181	83.5 Å²	83.5	79%	0.787	43%	0.43	S	S	*	.	H	α-helix	trans	-78.2	-48.5	179.7	-174.6	-179.1	178.4	-173.5	0	112.7	N34 M35 I36	N34-K38 WeakPolarHBondContact O-CB 3.39Å; N34-K38 PolarHBondContact O-N 2.94Å; N34-K38 VanDerWaalsContact O-N 3.09Å; M35-K38 PolarHBondContact O-N 2.96Å; M35-K38 VanDerWaalsContact O-N 3.16Å; I36-K38 PolarHBondContact O-N 2.85Å
39	E	97.6	Very high	97.4	Very high	132 Å²	132	85.1 Å²	85.1	62%	0.617	45%	0.445	S	S	*	.	H	α-helix	trans	-88.6	-23.9	-171.8	-65.3	-173	-171.5	0	0	113.3	M35	M35-E39 HydrophobicContact CG-CG 4.44Å; M35-E39 WeakPolarHBondContact O-CB 3.5Å; M35-E39 PolarHBondContact O-N 2.71Å
40	R	97.4	Very high	97.4	Very high	213 Å²	213	85.6 Å²	85.6	80%	0.804	45%	0.451	S	S	*	.			trans	44.1	55.5	-176.4	-60.7	-173.5	176.5	-174	-2.1	112.5	I36	I36-R40 VanDerWaalsContact O-CA 3.3Å; I36-R40 WeakPolarHBondContact O-CA 3.34Å; I36-R40 PolarHBondContact O-N 2.66Å
41	P	97.4	Very high	97.4	Very high	29 Å²	29	82 Å²	82	19%	0.188	43%	0.431	C	S	.	.			trans	-60.5	150.3	-179.6	27.5	-35.6	0	0	0	110.8	N43 A47	P41-N43 PolarHBondContact O-N 2.94Å; P41-A47 HydrophobicContact CB-CB 4Å; P41-A47 HydrophobicContact CG-CB 3.56Å
42	P	97.8	Very high	97.5	Very high	126 Å²	126	80.1 Å²	80.1	82%	0.818	43%	0.425	S	S	*	.	S	Bend	trans	-60.8	-30.4	179.9	24	-33.5	0	0	0	112.7	P44	P42-P44 WeakPolarHBondContact O-CD 3.42Å
43	N	97.8	Very high	97.4	Very high	92 Å²	92	86.5 Å²	86.5	49%	0.492	46%	0.456	S	S	.	.	S	Bend	trans	-118.1	79.8	178.1	-60.6	-26.7	0	0	0	110.4	P41 I45 E46 A47	P41-N43 PolarHBondContact O-N 2.94Å; N43-I45 VanDerWaalsContact C-N 3.31Å; N43-I45 PolarHBondContact O-N 3.36Å; N43-E46 HydrophobicContact CB-CB 3.9Å; N43-E46 PolarHBondContact ND2-OE2 3.47Å; N43-E46 PolarHBondContact O-N 2.75Å; N43-A47 WeakPolarHBondContact O-CB 3.29Å; N43-A47 PolarHBondContact O-N 3.4Å
44	P	97.4	Very high	97.2	Very high	61 Å²	61	88.2 Å²	88.2	40%	0.396	46%	0.462	S	S	.	.	H	α-helix	trans	-64	-32	-173.2	24.6	-34.4	0	0	0	113.9	I36 P42 L48	I36-P44 WeakPolarHBondContact CD1-O 3.5Å; I36-P44 HydrophobicContact CG2-CB 3.83Å; P42-P44 WeakPolarHBondContact O-CD 3.42Å; P44-L48 WeakPolarHBondContact O-CB 3.27Å; P44-L48 PolarHBondContact O-N 3.29Å
45	I	98	Very high	97	Very high	144 Å²	144	85 Å²	85	74%	0.738	44%	0.443	S	S	*	.	H	α-helix	trans	-68.2	-45.1	178.2	-62.1	174.3	0	0	0	110.7	N43 L48 A49	N43-I45 VanDerWaalsContact C-N 3.31Å; N43-I45 PolarHBondContact O-N 3.36Å; I45-L48 PolarHBondContact O-N 3.21Å; I45-A49 WeakPolarHBondContact O-CB 3.29Å; I45-A49 PolarHBondContact O-N 3.21Å
46	E	98.2	Very high	96.5	Very high	120 Å²	120	88.4 Å²	88.4	56%	0.561	46%	0.457	S	S	*	.	H	α-helix	trans	-64.7	-46.1	178.1	-172.6	177.7	-172.4	0	0	110.6	N43 L48 A49 T50	N43-E46 HydrophobicContact CB-CB 3.9Å; N43-E46 PolarHBondContact ND2-OE2 3.47Å; N43-E46 PolarHBondContact O-N 2.75Å; E46-L48 VanDerWaalsContact C-N 3.31Å; E46-L48 PolarHBondContact O-N 3.28Å; E46-A49 PolarHBondContact O-N 3.32Å; E46-T50 PolarHBondContact O-N 3.15Å; E46-T50 PolarHBondContact O-OG1 3Å; E46-T50 VanDerWaalsContact O-OG1 3.14Å
47	A	98	Very high	95.8	Very high	24 Å²	24	92.9 Å²	92.9	20%	0.198	48%	0.477	C	S	.	.	H	α-helix	trans	-58.4	-42.4	175.1	0	0	0	0	0	112.2	P41 N43 F51	P41-A47 HydrophobicContact CB-CB 4Å; P41-A47 HydrophobicContact CG-CB 3.56Å; N43-A47 WeakPolarHBondContact O-CB 3.29Å; N43-A47 PolarHBondContact O-N 3.4Å; A47-F51 VanDerWaalsContact O-CB 3.29Å; A47-F51 WeakPolarHBondContact O-CB 3.32Å; A47-F51 PolarHBondContact O-N 3.34Å
48	L	97.9	Very high	94.9	Very high	34 Å²	34	94.9 Å²	94.9	18%	0.178	48%	0.475	C	S	.	.	H	α-helix	trans	-61.1	-50	174.6	-169.5	52.6	0	0	0	111	L29 I36 P44 I45 E46 T50 F51 L52	L29-L48 HydrophobicContact CD2-CD2 4.48Å; I36-L48 HydrophobicContact CD1-CB 3.61Å; I36-L48 HydrophobicContact CD1-CD1 3.88Å; I36-L48 HydrophobicContact CD1-CD2 4.35Å; I36-L48 HydrophobicContact CD1-CG 4.13Å; P44-L48 WeakPolarHBondContact O-CB 3.27Å; P44-L48 PolarHBondContact O-N 3.29Å; I45-L48 PolarHBondContact O-N 3.21Å; E46-L48 VanDerWaalsContact C-N 3.31Å; E46-L48 PolarHBondContact O-N 3.28Å; L48-T50 VanDerWaalsContact C-N 3.34Å; L48-T50 PolarHBondContact O-N 3.06Å; L48-F51 WeakPolarHBondContact O-CB 3.42Å; L48-F51 PolarHBondContact O-N 2.84Å; L48-L52 HydrophobicContact CD1-CD1 4.5Å; L48-L52 HydrophobicContact CD1-CD2 4.47Å; L48-L52 HydrophobicContact CD1-CG 4.25Å; L48-L52 HydrophobicContact CG-CD1 4.15Å; L48-L52 HydrophobicContact CG-CG 4.32Å; L48-L52 VanDerWaalsContact O-CG 3.25Å; L48-L52 WeakPolarHBondContact O-CG 3.4Å; L48-L52 PolarHBondContact O-N 3.22Å
49	A	97.5	Very high	93.8	Very high	49 Å²	49	87.7 Å²	87.7	41%	0.405	45%	0.445	S	S	.	.	H	α-helix	trans	-59.7	-45.4	-178.4	0	0	0	0	0	111.6	I45 E46 L52 M53	I45-A49 WeakPolarHBondContact O-CB 3.29Å; I45-A49 PolarHBondContact O-N 3.21Å; E46-A49 PolarHBondContact O-N 3.32Å; A49-L52 PolarHBondContact O-N 2.99Å; A49-M53 VanDerWaalsContact O-CG 3.3Å; A49-M53 WeakPolarHBondContact O-CG 3.33Å; A49-M53 PolarHBondContact O-N 3.39Å
50	T	96.8	Very high	92.6	Very high	67 Å²	67	88.7 Å²	88.7	41%	0.411	45%	0.45	S	S	.	.	H	α-helix	trans	-59.7	-47	174.6	-60.5	0	0	0	0	111.3	E46 L48 L52 M53 Q54	E46-T50 PolarHBondContact O-N 3.15Å; E46-T50 PolarHBondContact O-OG1 3Å; E46-T50 VanDerWaalsContact O-OG1 3.14Å; L48-T50 VanDerWaalsContact C-N 3.34Å; L48-T50 PolarHBondContact O-N 3.06Å; T50-L52 PolarHBondContact O-N 2.68Å; T50-M53 PolarHBondContact O-N 3.2Å; T50-Q54 HydrophobicContact CG2-CG 4.45Å; T50-Q54 WeakPolarHBondContact O-CG 3.49Å; T50-Q54 PolarHBondContact O-N 3.09Å
51	F	97	Very high	91.1	Very high	25 Å²	25	85.1 Å²	85.1	11%	0.11	45%	0.446	C	S	.	.	H	α-helix	trans	-58	-48.1	177.9	-179.2	-87.3	0	0	0	111.9	V28 K31 G32 M35 A47 L48 M53 Q54 H55	V28-F51 HydrophobicContact CG2-CE1 4.21Å; K31-F51 HydrophobicContact CB-CE1 3.94Å; K31-F51 HydrophobicContact CB-CZ 3.83Å; G32-F51 VanDerWaalsContact CA-CD1 3.43Å; G32-F51 VanDerWaalsContact CA-CE1 3.44Å; G32-F51 VanDerWaalsContact N-CE1 3.32Å; M35-F51 HydrophobicContact CB-CE2 4.43Å; M35-F51 HydrophobicContact CE-CB 3.44Å; M35-F51 VanDerWaalsContact CE-CB 3.44Å; M35-F51 HydrophobicContact CE-CD2 3.45Å; M35-F51 VanDerWaalsContact CE-CD2 3.45Å; M35-F51 HydrophobicContact CE-CE2 4.43Å; M35-F51 HydrophobicContact CE-CG 3.65Å; M35-F51 HydrophobicContact CG-CD2 4.46Å; A47-F51 VanDerWaalsContact O-CB 3.29Å; A47-F51 WeakPolarHBondContact O-CB 3.32Å; A47-F51 PolarHBondContact O-N 3.34Å; L48-F51 WeakPolarHBondContact O-CB 3.42Å; L48-F51 PolarHBondContact O-N 2.84Å; F51-M53 VanDerWaalsContact C-N 3.33Å; F51-M53 PolarHBondContact O-N 2.86Å; F51-Q54 PolarHBondContact O-N 3.37Å; F51-H55 AromaticContact CD2-CE1 3.51Å; F51-H55 AromaticContact CD2-ND1 3.66Å; F51-H55 AromaticContact CE2-CE1 3.38Å; F51-H55 WeakPolarHBondContact CE2-CE1 3.31Å; F51-H55 AromaticContact CE2-ND1 3.65Å; F51-H55 AromaticContact CE2-NE2 3.8Å; F51-H55 AromaticContact CG-ND1 3.89Å; F51-H55 AromaticContact CZ-CE1 3.95Å; F51-H55 AromaticContact CZ-ND1 3.85Å; F51-H55 PolarHBondContact O-N 2.96Å; F51-H55 VanDerWaalsContact O-N 3.08Å; F51-H55 PolarHBondContact O-ND1 3.4Å
52	L	96.8	Very high	89.2	Confident	48 Å²	48	93.3 Å²	93.3	25%	0.251	48%	0.482	S	S	.	.	H	α-helix	trans	-59.8	-42.9	178.6	-67.1	179.1	0	0	0	111.6	V28 L29 L48 A49 T50 Q54 H55 K56	V28-L52 HydrophobicContact CB-CD2 4.14Å; V28-L52 HydrophobicContact CG1-CD2 3.63Å; V28-L52 HydrophobicContact CG2-CD2 3.65Å; L29-L52 HydrophobicContact CD2-CD1 4.08Å; L29-L52 HydrophobicContact CD2-CD2 4.24Å; L48-L52 HydrophobicContact CD1-CD1 4.5Å; L48-L52 HydrophobicContact CD1-CD2 4.47Å; L48-L52 HydrophobicContact CD1-CG 4.25Å; L48-L52 HydrophobicContact CG-CD1 4.15Å; L48-L52 HydrophobicContact CG-CG 4.32Å; L48-L52 VanDerWaalsContact O-CG 3.25Å; L48-L52 WeakPolarHBondContact O-CG 3.4Å; L48-L52 PolarHBondContact O-N 3.22Å; A49-L52 PolarHBondContact O-N 2.99Å; T50-L52 PolarHBondContact O-N 2.68Å; L52-Q54 VanDerWaalsContact C-N 3.34Å; L52-Q54 PolarHBondContact O-N 3.46Å; L52-H55 PolarHBondContact O-N 3.31Å; L52-K56 WeakPolarHBondContact O-CB 3.33Å; L52-K56 PolarHBondContact O-N 3.02Å
53	M	95	Very high	88.8	Confident	134 Å²	134	91.7 Å²	91.7	66%	0.66	47%	0.465	S	S	*	.	H	α-helix	trans	-67.6	-33.1	179.6	-69.1	-64.8	165.6	0	0	113.2	A49 T50 F51	A49-M53 VanDerWaalsContact O-CG 3.3Å; A49-M53 WeakPolarHBondContact O-CG 3.33Å; A49-M53 PolarHBondContact O-N 3.39Å; T50-M53 PolarHBondContact O-N 3.2Å; F51-M53 VanDerWaalsContact C-N 3.33Å; F51-M53 PolarHBondContact O-N 2.86Å
54	Q	94.1	Very high	88.3	Confident	132 Å²	132	91.6 Å²	91.6	62%	0.617	46%	0.464	S	S	*	.	H	α-helix	trans	-74.3	-33.9	178.2	-73.8	173.4	-16.8	0	0	112.9	T50 F51 L52	T50-Q54 HydrophobicContact CG2-CG 4.45Å; T50-Q54 WeakPolarHBondContact O-CG 3.49Å; T50-Q54 PolarHBondContact O-N 3.09Å; F51-Q54 PolarHBondContact O-N 3.37Å; L52-Q54 VanDerWaalsContact C-N 3.34Å; L52-Q54 PolarHBondContact O-N 3.46Å
55	H	92.5	Very high	87.8	Confident	46 Å²	46	93.3 Å²	93.3	21%	0.213	47%	0.468	C	S	.	.	H	α-helix	trans	-106.5	5.2	-172.7	-58.1	79.8	0	0	0	113.6	V28 F51 L52 E57 E58	V28-H55 HydrophobicContact CG2-CB 4.4Å; F51-H55 AromaticContact CD2-CE1 3.51Å; F51-H55 AromaticContact CD2-ND1 3.66Å; F51-H55 AromaticContact CE2-CE1 3.38Å; F51-H55 WeakPolarHBondContact CE2-CE1 3.31Å; F51-H55 AromaticContact CE2-ND1 3.65Å; F51-H55 AromaticContact CE2-NE2 3.8Å; F51-H55 AromaticContact CG-ND1 3.89Å; F51-H55 AromaticContact CZ-CE1 3.95Å; F51-H55 AromaticContact CZ-ND1 3.85Å; F51-H55 PolarHBondContact O-N 2.96Å; F51-H55 VanDerWaalsContact O-N 3.08Å; F51-H55 PolarHBondContact O-ND1 3.4Å; L52-H55 PolarHBondContact O-N 3.31Å; H55-E57 VanDerWaalsContact C-N 3.26Å; H55-E57 PolarHBondContact O-N 3.05Å; H55-E58 IonicContact CD2-OE1 3.58Å; H55-E58 IonicContact CD2-OE2 3.39Å; H55-E58 PolarHBondContact CD2-OE2 2.8Å; H55-E58 PolarHBondContact O-N 2.63Å
56	K	86.8	Confident	87.2	Confident	106 Å²	106	90.4 Å²	90.4	46%	0.461	45%	0.452	S	S	.	.	H	α-helix	trans	-57.5	-38.3	180	68.8	-178.7	-176.7	169	0	112.9	L52 E58 I59 E60	L52-K56 WeakPolarHBondContact O-CB 3.33Å; L52-K56 PolarHBondContact O-N 3.02Å; K56-E58 VanDerWaalsContact C-N 3.34Å; K56-I59 PolarHBondContact O-N 2.98Å; K56-E60 PolarHBondContact O-N 2.71Å
57	E	82.3	Confident	86.5	Confident	122 Å²	122	88.5 Å²	88.5	57%	0.57	45%	0.445	S	S	*	.	H	α-helix	trans	-73.6	-27.6	-177.4	-63.9	-177.6	-175.7	0	0	111.9	H55 I59 N61	H55-E57 VanDerWaalsContact C-N 3.26Å; H55-E57 PolarHBondContact O-N 3.05Å; E57-I59 VanDerWaalsContact C-N 3.28Å; E57-I59 PolarHBondContact O-N 3.33Å; E57-N61 PolarHBondContact O-N 3.46Å; E57-N61 PolarHBondContact O-ND2 2.88Å
58	E	79.8	Confident	85.8	Confident	107 Å²	107	92.8 Å²	92.8	50%	0.5	46%	0.461	S	S	.	.	H	α-helix	trans	-68	-33.1	176.3	-62.7	178.6	-173.2	0	0	111.4	H55 K56 E62	H55-E58 IonicContact CD2-OE1 3.58Å; H55-E58 IonicContact CD2-OE2 3.39Å; H55-E58 PolarHBondContact CD2-OE2 2.8Å; H55-E58 PolarHBondContact O-N 2.63Å; K56-E58 VanDerWaalsContact C-N 3.34Å; E58-E62 WeakPolarHBondContact O-CG 3.4Å
59	I	74	Confident	84.9	Confident	30 Å²	30	97 Å²	97	15%	0.154	48%	0.482	C	S	.	.	H	α-helix	trans	-79.6	-37.5	-179.9	-62.5	-90.2	0	0	0	111.2	P27 V28 K56 E57 N61	P27-I59 HydrophobicContact CB-CD1 4.05Å; V28-I59 HydrophobicContact CB-CD1 3.6Å; V28-I59 HydrophobicContact CB-CG1 3.78Å; V28-I59 HydrophobicContact CG2-CD1 4.24Å; V28-I59 HydrophobicContact CG2-CG1 4.03Å; K56-I59 PolarHBondContact O-N 2.98Å; E57-I59 VanDerWaalsContact C-N 3.28Å; E57-I59 PolarHBondContact O-N 3.33Å; I59-N61 PolarHBondContact O-N 3.41Å
60	E	73.1	Confident	83.9	Confident	153 Å²	153	100.7 Å²	100.7	72%	0.715	49%	0.488	S	S	*	.	H	α-helix	trans	-69.4	-19.4	-180	-74.2	-179.5	-179.4	0	0	113.1	K56	K56-E60 PolarHBondContact O-N 2.71Å
61	N	65.5	Low	82.9	Confident	138 Å²	138	103.5 Å²	103.5	74%	0.738	49%	0.494	S	S	*	.	T	Hydrogen-bonded Turn	trans	-104	1.8	-176.4	-68.5	-52.3	0	0	0	114.5	E57 I59	E57-N61 PolarHBondContact O-N 3.46Å; E57-N61 PolarHBondContact O-ND2 2.88Å; I59-N61 PolarHBondContact O-N 3.41Å
62	E	57.5	Low	81.6	Confident	201 Å²	201	110.6 Å²	110.6	94%	0.939	53%	0.529	S	S	*	.			trans	-91.9	0	172.5	-78.8	-179.3	145.2	0	0	111.8	E58	E58-E62 WeakPolarHBondContact O-CG 3.4Å

Retrieved 62 of 62 residues in 12.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).