G4M1B5_SCHMA Loading...

Sec61 gamma subunit, putative

AlphaFold DB , UniProt , Accession G4M1B5, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 68 aa.

						>G4M1B5_SCHMA|G4M1B5
MDRVSTLAEPLVRFSKDSVHFINRCTKPDRKEFKKNAIATAIGFLAMGVLGFIIKLIFVPINSIIVGN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62.1	Low	78.6	Confident	200 Å²	200	115.2 Å²	115.2	99%	0.985	61%	0.609	S	S	*	*				0	14.6	0	-104.7	133.5	72.5	0	0	111.8	S5	M1-S5 PolarHBondContact O-OG 3.35Å
2	D	72	Confident	79.7	Confident	124 Å²	124	111.8 Å²	111.8	66%	0.663	60%	0.596	S	S	*	*	H	α-helix	trans	-93.5	-22.6	-160.3	-46.8	-77.4	0	0	0	113.4	V4 T6	D2-V4 VanDerWaalsContact C-N 3.34Å; D2-T6 WeakPolarHBondContact O-CB 3.48Å; D2-T6 WeakPolarHBondContact O-CG2 3.4Å; D2-T6 PolarHBondContact O-N 3.44Å; D2-T6 VanDerWaalsContact O-N 3.09Å; D2-T6 PolarHBondContact O-OG1 3.49Å
3	R	68.7	Low	80.6	Confident	212 Å²	212	116.2 Å²	116.2	80%	0.8	60%	0.599	S	S	*	*	H	α-helix	trans	-68.5	-32.4	175.2	-62.3	-65.9	-178.7	158.8	-0.4	112.7	T6 L7	R3-T6 WeakPolarHBondContact CA-OG1 3.45Å; R3-T6 PolarHBondContact O-OG1 3Å; R3-T6 VanDerWaalsContact O-OG1 3.13Å; R3-L7 WeakPolarHBondContact O-CG 3.5Å; R3-L7 PolarHBondContact O-N 3.11Å
4	V	74.5	Confident	81.7	Confident	109 Å²	109	117.8 Å²	117.8	66%	0.661	60%	0.6	S	S	*	*	H	α-helix	trans	-76.1	-44.4	177.9	-178.6	0	0	0	0	109.8	D2 T6 L7 A8	D2-V4 VanDerWaalsContact C-N 3.34Å; V4-T6 PolarHBondContact O-N 3.2Å; V4-L7 PolarHBondContact O-N 3.37Å; V4-A8 WeakPolarHBondContact O-CB 3.42Å; V4-A8 PolarHBondContact O-N 3.44Å
5	S	74.4	Confident	82.6	Confident	63 Å²	63	113.9 Å²	113.9	44%	0.441	59%	0.588	S	S	.	*	H	α-helix	trans	-61.6	-41.9	178.2	-46.6	0	0	0	0	112.4	M1 L7 A8 E9	M1-S5 PolarHBondContact O-OG 3.35Å; S5-L7 VanDerWaalsContact C-N 3.32Å; S5-L7 PolarHBondContact O-N 2.92Å; S5-A8 PolarHBondContact O-N 3.02Å; S5-E9 PolarHBondContact O-N 3.28Å
6	T	76.8	Confident	83.3	Confident	91 Å²	91	115.8 Å²	115.8	56%	0.558	59%	0.59	S	S	*	*	H	α-helix	trans	-66.2	-29.4	177.7	43.2	0	0	0	0	113.7	D2 R3 V4 P10	D2-T6 WeakPolarHBondContact O-CB 3.48Å; D2-T6 WeakPolarHBondContact O-CG2 3.4Å; D2-T6 PolarHBondContact O-N 3.44Å; D2-T6 VanDerWaalsContact O-N 3.09Å; D2-T6 PolarHBondContact O-OG1 3.49Å; R3-T6 WeakPolarHBondContact CA-OG1 3.45Å; R3-T6 PolarHBondContact O-OG1 3Å; R3-T6 VanDerWaalsContact O-OG1 3.13Å; V4-T6 PolarHBondContact O-N 3.2Å; T6-P10 WeakPolarHBondContact O-CD 3.48Å
7	L	79.8	Confident	84.1	Confident	122 Å²	122	115.4 Å²	115.4	64%	0.639	59%	0.59	S	S	*	*	H	α-helix	trans	-84.8	-29.1	172.1	-68.3	173.5	0	0	0	112.7	R3 V4 S5 P10 L11	R3-L7 WeakPolarHBondContact O-CG 3.5Å; R3-L7 PolarHBondContact O-N 3.11Å; V4-L7 PolarHBondContact O-N 3.37Å; S5-L7 VanDerWaalsContact C-N 3.32Å; S5-L7 PolarHBondContact O-N 2.92Å; L7-P10 WeakPolarHBondContact O-CD 3.39Å; L7-P10 WeakPolarHBondContact O-CG 3.3Å; L7-L11 WeakPolarHBondContact O-CD1 3.33Å; L7-L11 WeakPolarHBondContact O-CG 3.33Å
8	A	86	Confident	84.8	Confident	39 Å²	39	111.4 Å²	111.4	32%	0.322	57%	0.574	S	S	.	*	H	α-helix	trans	-74.5	-39.3	-178.1	0	0	0	0	0	112.3	V4 S5 L11 V12	V4-A8 WeakPolarHBondContact O-CB 3.42Å; V4-A8 PolarHBondContact O-N 3.44Å; S5-A8 PolarHBondContact O-N 3.02Å; A8-L11 PolarHBondContact O-N 2.74Å; A8-V12 WeakPolarHBondContact O-CG2 3.41Å; A8-V12 PolarHBondContact O-N 3.47Å
9	E	86.5	Confident	85.4	Confident	116 Å²	116	110.1 Å²	110.1	54%	0.542	57%	0.571	S	S	.	*	H	α-helix	trans	-54.2	-51.4	178.7	-80.2	-173.2	-147.8	0	0	114.6	S5 L11 V12 R13	S5-E9 PolarHBondContact O-N 3.28Å; E9-L11 VanDerWaalsContact C-N 3.3Å; E9-L11 PolarHBondContact O-N 2.87Å; E9-V12 PolarHBondContact O-N 3.48Å; E9-R13 WeakPolarHBondContact O-CG 3.18Å; E9-R13 PolarHBondContact O-N 3.43Å
10	P	91.3	Very high	85.9	Confident	73 Å²	73	111.5 Å²	111.5	47%	0.474	58%	0.575	S	S	.	*	H	α-helix	trans	-63.9	-35.1	177.7	23.5	-33.1	0	0	0	112.3	T6 L7 R13 F14	T6-P10 WeakPolarHBondContact O-CD 3.48Å; L7-P10 WeakPolarHBondContact O-CD 3.39Å; L7-P10 WeakPolarHBondContact O-CG 3.3Å; P10-R13 PolarHBondContact O-N 3.28Å; P10-F14 VanDerWaalsContact O-CB 3.3Å; P10-F14 WeakPolarHBondContact O-CB 3.36Å; P10-F14 PolarHBondContact O-N 3.15Å
11	L	92.6	Very high	86.5	Confident	118 Å²	118	112.6 Å²	112.6	62%	0.618	58%	0.576	S	S	*	*	H	α-helix	trans	-67.3	-39.5	176.8	-67.2	173.9	0	0	0	112.3	L7 A8 E9 F14 S15	L7-L11 WeakPolarHBondContact O-CD1 3.33Å; L7-L11 WeakPolarHBondContact O-CG 3.33Å; A8-L11 PolarHBondContact O-N 2.74Å; E9-L11 VanDerWaalsContact C-N 3.3Å; E9-L11 PolarHBondContact O-N 2.87Å; L11-F14 PolarHBondContact O-N 3.21Å; L11-S15 WeakPolarHBondContact O-CB 3.16Å; L11-S15 PolarHBondContact O-N 3.32Å; L11-S15 PolarHBondContact O-OG 3.42Å
12	V	91.9	Very high	88.1	Confident	75 Å²	75	107.9 Å²	107.9	46%	0.455	55%	0.553	S	S	.	*	H	α-helix	trans	-68.4	-38.6	176.3	172.2	0	0	0	0	111.3	A8 E9 S15 K16	A8-V12 WeakPolarHBondContact O-CG2 3.41Å; A8-V12 PolarHBondContact O-N 3.47Å; E9-V12 PolarHBondContact O-N 3.48Å; V12-S15 PolarHBondContact O-OG 2.92Å; V12-K16 WeakPolarHBondContact O-CG 3.38Å; V12-K16 PolarHBondContact O-N 3.47Å
13	R	92	Very high	89.2	Confident	168 Å²	168	107.3 Å²	107.3	63%	0.634	55%	0.55	S	S	*	*	H	α-helix	trans	-64	-48.8	173.2	-70.3	180	-177.4	-150.5	3.8	110.8	E9 P10 S15 K16 D17	E9-R13 WeakPolarHBondContact O-CG 3.18Å; E9-R13 PolarHBondContact O-N 3.43Å; P10-R13 PolarHBondContact O-N 3.28Å; R13-S15 VanDerWaalsContact C-N 3.32Å; R13-S15 PolarHBondContact O-N 2.93Å; R13-K16 PolarHBondContact O-N 2.9Å; R13-K16 VanDerWaalsContact O-N 3.15Å; R13-D17 VanDerWaalsContact O-CG 3.3Å; R13-D17 PolarHBondContact O-N 3Å
14	F	95.1	Very high	90.5	Very high	139 Å²	139	107.5 Å²	107.5	61%	0.61	55%	0.551	S	S	*	*	H	α-helix	trans	-58	-40.7	177.9	179.4	-98.6	0	0	0	113.1	P10 L11 D17 S18	P10-F14 VanDerWaalsContact O-CB 3.3Å; P10-F14 WeakPolarHBondContact O-CB 3.36Å; P10-F14 PolarHBondContact O-N 3.15Å; L11-F14 PolarHBondContact O-N 3.21Å; F14-D17 PolarHBondContact O-N 2.95Å; F14-S18 VanDerWaalsContact O-CB 3.31Å; F14-S18 WeakPolarHBondContact O-CB 3.39Å; F14-S18 PolarHBondContact O-N 3.32Å; F14-S18 PolarHBondContact O-OG 3.2Å
15	S	94.9	Very high	91.5	Very high	60 Å²	60	105 Å²	105	42%	0.42	54%	0.537	S	S	.	.	H	α-helix	trans	-66.5	-40.7	177.7	68	0	0	0	0	112.1	L11 V12 R13 S18 V19	L11-S15 WeakPolarHBondContact O-CB 3.16Å; L11-S15 PolarHBondContact O-N 3.32Å; L11-S15 PolarHBondContact O-OG 3.42Å; V12-S15 PolarHBondContact O-OG 2.92Å; R13-S15 VanDerWaalsContact C-N 3.32Å; R13-S15 PolarHBondContact O-N 2.93Å; S15-S18 PolarHBondContact O-N 2.89Å; S15-V19 WeakPolarHBondContact O-CG2 3.31Å; S15-V19 PolarHBondContact O-N 3.02Å; S15-V19 VanDerWaalsContact O-N 3.1Å
16	K	95	Very high	92.4	Very high	144 Å²	144	108.5 Å²	108.5	63%	0.626	56%	0.557	S	S	*	*	H	α-helix	trans	-62.8	-45.1	173.5	-71.9	-179.9	-178.1	-177	0	112	V12 R13 S18 V19 H20	V12-K16 WeakPolarHBondContact O-CG 3.38Å; V12-K16 PolarHBondContact O-N 3.47Å; R13-K16 PolarHBondContact O-N 2.9Å; R13-K16 VanDerWaalsContact O-N 3.15Å; K16-S18 VanDerWaalsContact C-N 3.32Å; K16-S18 PolarHBondContact O-N 3.4Å; K16-V19 PolarHBondContact O-N 3.44Å; K16-H20 PolarHBondContact O-N 3.22Å
17	D	96	Very high	93.2	Very high	109 Å²	109	111.4 Å²	111.4	58%	0.583	56%	0.561	S	S	*	*	H	α-helix	trans	-64.6	-38.6	178.9	-66.5	-24.8	0	0	0	111.3	R13 F14 V19 H20 F21	R13-D17 VanDerWaalsContact O-CG 3.3Å; R13-D17 PolarHBondContact O-N 3Å; F14-D17 PolarHBondContact O-N 2.95Å; D17-V19 PolarHBondContact O-N 3.4Å; D17-H20 PolarHBondContact O-N 2.8Å; D17-F21 WeakPolarHBondContact O-CB 3.41Å; D17-F21 PolarHBondContact O-N 3.4Å
18	S	97	Very high	93.8	Very high	43 Å²	43	109.7 Å²	109.7	30%	0.301	56%	0.558	S	S	.	*	H	α-helix	trans	-61.9	-42.5	175.3	-62.2	0	0	0	0	112	F14 S15 K16 F21 I22	F14-S18 VanDerWaalsContact O-CB 3.31Å; F14-S18 WeakPolarHBondContact O-CB 3.39Å; F14-S18 PolarHBondContact O-N 3.32Å; F14-S18 PolarHBondContact O-OG 3.2Å; S15-S18 PolarHBondContact O-N 2.89Å; K16-S18 VanDerWaalsContact C-N 3.32Å; K16-S18 PolarHBondContact O-N 3.4Å; S18-F21 PolarHBondContact O-N 3.4Å; S18-I22 WeakPolarHBondContact O-CG1 3.37Å; S18-I22 PolarHBondContact O-N 3.43Å
19	V	96.4	Very high	94.3	Very high	87 Å²	87	112.6 Å²	112.6	53%	0.527	57%	0.568	S	S	.	*	H	α-helix	trans	-66.5	-41.3	176.4	172.5	0	0	0	0	111	S15 K16 D17 F21 I22 N23	S15-V19 WeakPolarHBondContact O-CG2 3.31Å; S15-V19 PolarHBondContact O-N 3.02Å; S15-V19 VanDerWaalsContact O-N 3.1Å; K16-V19 PolarHBondContact O-N 3.44Å; D17-V19 PolarHBondContact O-N 3.4Å; V19-F21 VanDerWaalsContact C-N 3.31Å; V19-F21 PolarHBondContact O-N 3.24Å; V19-I22 PolarHBondContact O-N 3.09Å; V19-N23 PolarHBondContact O-N 3.3Å; V19-N23 VanDerWaalsContact O-N 3.07Å; V19-N23 PolarHBondContact O-ND2 3.39Å
20	H	95.7	Very high	94.8	Very high	138 Å²	138	117.6 Å²	117.6	64%	0.639	58%	0.582	S	S	*	*	H	α-helix	trans	-59.9	-43	175.4	-175.6	78.8	0	0	0	111.6	K16 D17 N23 R24	K16-H20 PolarHBondContact O-N 3.22Å; D17-H20 PolarHBondContact O-N 2.8Å; H20-N23 PolarHBondContact O-N 3.13Å; H20-R24 PolarHBondContact O-N 3.27Å; H20-R24 VanDerWaalsContact O-N 3.11Å
21	F	97.3	Very high	95	Very high	135 Å²	135	122.3 Å²	122.3	59%	0.592	60%	0.595	S	S	*	*	H	α-helix	trans	-59.5	-50.6	175.9	175.2	-101	0	0	0	112.3	D17 S18 V19 N23 R24 C25	D17-F21 WeakPolarHBondContact O-CB 3.41Å; D17-F21 PolarHBondContact O-N 3.4Å; S18-F21 PolarHBondContact O-N 3.4Å; V19-F21 VanDerWaalsContact C-N 3.31Å; V19-F21 PolarHBondContact O-N 3.24Å; F21-N23 PolarHBondContact O-N 2.73Å; F21-R24 WeakPolarHBondContact O-CB 3.49Å; F21-R24 PolarHBondContact O-N 3.32Å; F21-C25 PolarHBondContact O-N 3.07Å; F21-C25 PolarHBondContact O-SG 3.23Å; F21-C25 VanDerWaalsContact O-SG 3.35Å
22	I	96.1	Very high	95.1	Very high	100 Å²	100	122.2 Å²	122.2	51%	0.513	59%	0.591	S	S	.	*	H	α-helix	trans	-60.3	-36	179.1	-65.6	-63.7	0	0	0	111.9	S18 V19 R24 C25	S18-I22 WeakPolarHBondContact O-CG1 3.37Å; S18-I22 PolarHBondContact O-N 3.43Å; V19-I22 PolarHBondContact O-N 3.09Å; I22-R24 VanDerWaalsContact C-N 3.31Å; I22-R24 PolarHBondContact O-N 3.07Å; I22-C25 PolarHBondContact O-N 3.37Å
23	N	95	Very high	95.3	Very high	113 Å²	113	125.2 Å²	125.2	60%	0.604	60%	0.599	S	S	*	*	H	α-helix	trans	-72	-23	176.8	-71.4	-28.9	0	0	0	113.5	V19 H20 F21	V19-N23 PolarHBondContact O-N 3.3Å; V19-N23 VanDerWaalsContact O-N 3.07Å; V19-N23 PolarHBondContact O-ND2 3.39Å; H20-N23 PolarHBondContact O-N 3.13Å; F21-N23 PolarHBondContact O-N 2.73Å
24	R	96.2	Very high	95.5	Very high	215 Å²	215	123.9 Å²	123.9	81%	0.811	60%	0.597	S	S	*	*	H	α-helix	trans	-81.5	-23.9	175.6	-172.4	59.6	172.9	178.3	0.5	112.7	H20 F21 I22	H20-R24 PolarHBondContact O-N 3.27Å; H20-R24 VanDerWaalsContact O-N 3.11Å; F21-R24 WeakPolarHBondContact O-CB 3.49Å; F21-R24 PolarHBondContact O-N 3.32Å; I22-R24 VanDerWaalsContact C-N 3.31Å; I22-R24 PolarHBondContact O-N 3.07Å
25	C	95	Very high	95.6	Very high	56 Å²	56	125 Å²	125	38%	0.378	60%	0.602	S	S	.	*	S	Bend	trans	-64.7	139.4	178.3	-67.3	0	0	0	0	112	F21 I22 K27	F21-C25 PolarHBondContact O-N 3.07Å; F21-C25 PolarHBondContact O-SG 3.23Å; F21-C25 VanDerWaalsContact O-SG 3.35Å; I22-C25 PolarHBondContact O-N 3.37Å; C25-K27 PolarHBondContact O-N 3.1Å
26	T	94.4	Very high	95.7	Very high	138 Å²	138	127.1 Å²	127.1	85%	0.847	61%	0.608	S	S	*	*	P	Polyproline II helix	trans	-71.5	121.5	167.6	-172.8	0	0	0	0	109.2
27	K	93.9	Very high	95.8	Very high	151 Å²	151	122.3 Å²	122.3	66%	0.657	60%	0.595	S	S	*	*	P	Polyproline II helix	trans	-80.5	137.1	178.9	-61.8	-177.7	-176.1	-177.6	0	108.5	C25 D29	C25-K27 PolarHBondContact O-N 3.1Å; K27-D29 PolarHBondContact O-N 3.22Å
28	P	92.6	Very high	95.8	Very high	87 Å²	87	121.3 Å²	121.3	57%	0.565	59%	0.589	S	S	*	*	P	Polyproline II helix	trans	-61.9	134.5	-178.1	26.2	-34.2	0	0	0	110.1
29	D	96.2	Very high	95.9	Very high	100 Å²	100	122.3 Å²	122.3	54%	0.535	60%	0.6	S	S	.	*	P	Polyproline II helix	trans	-72.5	159.8	173.8	-176.8	39	0	0	0	110.7	K27 K31 E32 F33	K27-D29 PolarHBondContact O-N 3.22Å; D29-K31 PolarHBondContact O-N 3.02Å; D29-K31 VanDerWaalsContact O-N 3.15Å; D29-E32 PolarHBondContact O-N 2.91Å; D29-E32 VanDerWaalsContact O-N 3.09Å; D29-F33 PolarHBondContact O-N 3.4Å
30	R	95.4	Very high	95.9	Very high	221 Å²	221	123 Å²	123	83%	0.834	61%	0.605	S	S	*	*	H	α-helix	trans	-55.9	-34.8	-179.4	-67.3	-171.5	-179.6	-109.3	2.8	112.3	K34	R30-K34 VanDerWaalsContact O-CB 3.3Å; R30-K34 WeakPolarHBondContact O-CB 3.48Å; R30-K34 PolarHBondContact O-N 3.1Å
31	K	95.8	Very high	96	Very high	172 Å²	172	119.3 Å²	119.3	75%	0.748	60%	0.598	S	S	*	*	H	α-helix	trans	-67.3	-43.7	178.1	-172.3	178.4	178.7	-177.7	0	111.9	D29 K35	D29-K31 PolarHBondContact O-N 3.02Å; D29-K31 VanDerWaalsContact O-N 3.15Å; K31-K35 PolarHBondContact O-N 3.4Å; K31-K35 VanDerWaalsContact O-N 3.12Å
32	E	95	Very high	96.1	Very high	115 Å²	115	118.1 Å²	118.1	54%	0.537	60%	0.596	S	S	.	*	H	α-helix	trans	-68	-45.3	178	-63.5	-174.8	148.1	0	0	111.3	D29 K34 K35 N36	D29-E32 PolarHBondContact O-N 2.91Å; D29-E32 VanDerWaalsContact O-N 3.09Å; E32-K34 VanDerWaalsContact C-N 3.32Å; E32-K34 PolarHBondContact O-N 3.09Å; E32-K35 PolarHBondContact O-N 3.12Å; E32-N36 PolarHBondContact O-N 3.15Å
33	F	96.3	Very high	96.1	Very high	139 Å²	139	114.9 Å²	114.9	61%	0.61	59%	0.588	S	S	*	*	H	α-helix	trans	-58	-45.6	176.1	-176.5	-96.5	0	0	0	111.3	D29 K35 N36 A37	D29-F33 PolarHBondContact O-N 3.4Å; F33-K35 PolarHBondContact O-N 2.99Å; F33-N36 PolarHBondContact O-N 3.46Å; F33-A37 HydrophobicContact CE1-CB 4.37Å; F33-A37 WeakPolarHBondContact O-CB 3.3Å; F33-A37 PolarHBondContact O-N 3.39Å
34	K	97.1	Very high	96.3	Very high	140 Å²	140	117.6 Å²	117.6	61%	0.609	60%	0.595	S	S	*	*	H	α-helix	trans	-61.7	-42.3	178.1	-174	176.6	-179.5	179.9	0	112.1	R30 E32 A37 I38	R30-K34 VanDerWaalsContact O-CB 3.3Å; R30-K34 WeakPolarHBondContact O-CB 3.48Å; R30-K34 PolarHBondContact O-N 3.1Å; E32-K34 VanDerWaalsContact C-N 3.32Å; E32-K34 PolarHBondContact O-N 3.09Å; K34-A37 PolarHBondContact O-N 3.49Å; K34-I38 HydrophobicContact CG-CD1 3.82Å; K34-I38 HydrophobicContact CG-CG1 4.46Å; K34-I38 WeakPolarHBondContact O-CB 3.21Å; K34-I38 VanDerWaalsContact O-CG1 3.24Å; K34-I38 WeakPolarHBondContact O-CG1 3.24Å; K34-I38 PolarHBondContact O-N 3.45Å
35	K	96.6	Very high	96.3	Very high	162 Å²	162	113 Å²	113	70%	0.704	59%	0.586	S	S	*	*	H	α-helix	trans	-60.6	-48.8	177.2	-179.4	179.7	174.3	-175.9	0	111.3	K31 E32 F33 I38 A39	K31-K35 PolarHBondContact O-N 3.4Å; K31-K35 VanDerWaalsContact O-N 3.12Å; E32-K35 PolarHBondContact O-N 3.12Å; F33-K35 PolarHBondContact O-N 2.99Å; K35-I38 PolarHBondContact O-N 3.49Å; K35-A39 PolarHBondContact O-N 3.01Å; K35-A39 VanDerWaalsContact O-N 3.1Å
36	N	96.1	Very high	96.4	Very high	104 Å²	104	112.5 Å²	112.5	56%	0.556	59%	0.585	S	S	*	*	H	α-helix	trans	-66.5	-43.5	179.7	-71.2	0.6	0	0	0	111.4	E32 F33 I38 A39 T40	E32-N36 PolarHBondContact O-N 3.15Å; F33-N36 PolarHBondContact O-N 3.46Å; N36-I38 PolarHBondContact O-N 3.11Å; N36-A39 PolarHBondContact O-N 3.26Å; N36-T40 PolarHBondContact O-N 3.03Å; N36-T40 PolarHBondContact O-OG1 2.92Å
37	A	97.4	Very high	96.6	Very high	43 Å²	43	112.5 Å²	112.5	36%	0.355	58%	0.578	S	S	.	*	H	α-helix	trans	-59.9	-42.8	178	0	0	0	0	0	112.3	F33 K34 A41	F33-A37 HydrophobicContact CE1-CB 4.37Å; F33-A37 WeakPolarHBondContact O-CB 3.3Å; F33-A37 PolarHBondContact O-N 3.39Å; K34-A37 PolarHBondContact O-N 3.49Å; A37-A41 VanDerWaalsContact O-CB 3.24Å; A37-A41 WeakPolarHBondContact O-CB 3.33Å; A37-A41 PolarHBondContact O-N 3.26Å
38	I	97.3	Very high	96.7	Very high	89 Å²	89	107.3 Å²	107.3	46%	0.456	57%	0.567	S	S	.	*	H	α-helix	trans	-64.8	-45.6	176.4	-69	167.6	0	0	0	110.9	K34 K35 N36 T40 A41 I42	K34-I38 HydrophobicContact CG-CD1 3.82Å; K34-I38 HydrophobicContact CG-CG1 4.46Å; K34-I38 WeakPolarHBondContact O-CB 3.21Å; K34-I38 VanDerWaalsContact O-CG1 3.24Å; K34-I38 WeakPolarHBondContact O-CG1 3.24Å; K34-I38 PolarHBondContact O-N 3.45Å; K35-I38 PolarHBondContact O-N 3.49Å; N36-I38 PolarHBondContact O-N 3.11Å; I38-T40 PolarHBondContact O-N 3.36Å; I38-A41 PolarHBondContact O-N 2.88Å; I38-I42 HydrophobicContact CG2-CD1 3.9Å; I38-I42 WeakPolarHBondContact O-CG1 3.24Å; I38-I42 PolarHBondContact O-N 3.48Å
39	A	97.5	Very high	96.9	Very high	64 Å²	64	106.8 Å²	106.8	53%	0.529	56%	0.562	S	S	.	*	H	α-helix	trans	-59.7	-46.2	178.2	0	0	0	0	0	111.8	K35 N36 I42 G43	K35-A39 PolarHBondContact O-N 3.01Å; K35-A39 VanDerWaalsContact O-N 3.1Å; N36-A39 PolarHBondContact O-N 3.26Å; A39-I42 PolarHBondContact O-N 3.42Å; A39-G43 PolarHBondContact O-N 2.83Å; A39-G43 VanDerWaalsContact O-N 3.11Å
40	T	97.7	Very high	97	Very high	102 Å²	102	107 Å²	107	63%	0.626	56%	0.563	S	S	*	*	H	α-helix	trans	-64.4	-39.9	176.3	-55.2	0	0	0	0	111.9	N36 I38 I42 G43 F44	N36-T40 PolarHBondContact O-N 3.03Å; N36-T40 PolarHBondContact O-OG1 2.92Å; I38-T40 PolarHBondContact O-N 3.36Å; T40-I42 PolarHBondContact O-N 2.92Å; T40-G43 PolarHBondContact O-N 2.88Å; T40-F44 WeakPolarHBondContact O-CB 3.42Å; T40-F44 PolarHBondContact O-N 3Å
41	A	97.8	Very high	97	Very high	59 Å²	59	98.2 Å²	98.2	49%	0.488	54%	0.542	S	S	.	.	H	α-helix	trans	-63.2	-40.5	177.8	0	0	0	0	0	112.3	A37 I38 F44 L45	A37-A41 VanDerWaalsContact O-CB 3.24Å; A37-A41 WeakPolarHBondContact O-CB 3.33Å; A37-A41 PolarHBondContact O-N 3.26Å; I38-A41 PolarHBondContact O-N 2.88Å; A41-F44 PolarHBondContact O-N 3.32Å; A41-L45 WeakPolarHBondContact O-CB 3.43Å; A41-L45 PolarHBondContact O-N 2.98Å
42	I	97.9	Very high	97.1	Very high	110 Å²	110	96 Å²	96	56%	0.564	53%	0.532	S	S	*	.	H	α-helix	trans	-63.1	-44.5	174.7	-66.6	165.4	0	0	0	110.4	I38 A39 T40 L45 A46	I38-I42 HydrophobicContact CG2-CD1 3.9Å; I38-I42 WeakPolarHBondContact O-CG1 3.24Å; I38-I42 PolarHBondContact O-N 3.48Å; A39-I42 PolarHBondContact O-N 3.42Å; T40-I42 PolarHBondContact O-N 2.92Å; I42-L45 PolarHBondContact O-N 3.41Å; I42-A46 WeakPolarHBondContact O-CB 3.38Å; I42-A46 PolarHBondContact O-N 3.25Å
43	G	97.4	Very high	97.2	Very high	33 Å²	33	94.5 Å²	94.5	34%	0.34	53%	0.527	S	S	.	.	H	α-helix	trans	-61	-45	176.3	0	0	0	0	0	112.6	A39 T40 L45 A46 M47	A39-G43 PolarHBondContact O-N 2.83Å; A39-G43 VanDerWaalsContact O-N 3.11Å; T40-G43 PolarHBondContact O-N 2.88Å; G43-L45 VanDerWaalsContact C-N 3.35Å; G43-L45 PolarHBondContact O-N 3.45Å; G43-A46 PolarHBondContact O-N 3.48Å; G43-M47 VanDerWaalsContact O-CG 3.31Å; G43-M47 WeakPolarHBondContact O-CG 3.3Å; G43-M47 PolarHBondContact O-N 3.01Å
44	F	97.9	Very high	97.2	Very high	170 Å²	170	92.3 Å²	92.3	75%	0.746	52%	0.521	S	S	*	.	H	α-helix	trans	-61.2	-43.5	175.9	-174.8	-96.9	0	0	0	111.8	T40 A41 G48	T40-F44 WeakPolarHBondContact O-CB 3.42Å; T40-F44 PolarHBondContact O-N 3Å; A41-F44 PolarHBondContact O-N 3.32Å; F44-G48 PolarHBondContact O-N 2.96Å
45	L	97.5	Very high	97.1	Very high	118 Å²	118	92.6 Å²	92.6	62%	0.618	52%	0.522	S	S	*	.	H	α-helix	trans	-64.4	-44.2	177.3	-173.3	65.9	0	0	0	111.6	A41 I42 G43 G48 V49	A41-L45 WeakPolarHBondContact O-CB 3.43Å; A41-L45 PolarHBondContact O-N 2.98Å; I42-L45 PolarHBondContact O-N 3.41Å; G43-L45 VanDerWaalsContact C-N 3.35Å; G43-L45 PolarHBondContact O-N 3.45Å; L45-G48 PolarHBondContact O-N 3.35Å; L45-V49 HydrophobicContact CD1-CG2 4.27Å; L45-V49 HydrophobicContact CG-CG2 4.35Å; L45-V49 WeakPolarHBondContact O-CB 3.31Å; L45-V49 VanDerWaalsContact O-CG2 3.24Å; L45-V49 WeakPolarHBondContact O-CG2 3.24Å; L45-V49 PolarHBondContact O-N 3.41Å
46	A	97.4	Very high	97.1	Very high	45 Å²	45	89.4 Å²	89.4	37%	0.372	51%	0.512	S	S	.	.	H	α-helix	trans	-61.9	-46.8	178.3	0	0	0	0	0	111.9	I42 G43 V49 L50	I42-A46 WeakPolarHBondContact O-CB 3.38Å; I42-A46 PolarHBondContact O-N 3.25Å; G43-A46 PolarHBondContact O-N 3.48Å; A46-V49 PolarHBondContact O-N 2.9Å; A46-L50 WeakPolarHBondContact O-CB 3.31Å; A46-L50 VanDerWaalsContact O-CG 3.3Å; A46-L50 WeakPolarHBondContact O-CG 3.41Å; A46-L50 PolarHBondContact O-N 2.87Å
47	M	97.1	Very high	97.1	Very high	138 Å²	138	88.9 Å²	88.9	68%	0.68	51%	0.508	S	S	*	.	H	α-helix	trans	-65.1	-39	177.1	-65.4	-62.8	152.8	0	0	111.9	G43 G51	G43-M47 VanDerWaalsContact O-CG 3.31Å; G43-M47 WeakPolarHBondContact O-CG 3.3Å; G43-M47 PolarHBondContact O-N 3.01Å; M47-G51 PolarHBondContact O-N 3.18Å
48	G	96.8	Very high	97	Very high	43 Å²	43	92.6 Å²	92.6	44%	0.443	52%	0.517	S	S	.	.	H	α-helix	trans	-65	-45.3	175.8	0	0	0	0	0	113	F44 L45 G51 F52	F44-G48 PolarHBondContact O-N 2.96Å; L45-G48 PolarHBondContact O-N 3.35Å; G48-G51 PolarHBondContact O-N 3.43Å; G48-F52 WeakPolarHBondContact O-CB 3.47Å; G48-F52 PolarHBondContact O-N 2.94Å
49	V	97.4	Very high	96.8	Very high	76 Å²	76	92.8 Å²	92.8	46%	0.461	52%	0.522	S	S	.	.	H	α-helix	trans	-64.3	-46.1	177.2	171.2	0	0	0	0	110.6	L45 A46 G51 F52 I53	L45-V49 HydrophobicContact CD1-CG2 4.27Å; L45-V49 HydrophobicContact CG-CG2 4.35Å; L45-V49 WeakPolarHBondContact O-CB 3.31Å; L45-V49 VanDerWaalsContact O-CG2 3.24Å; L45-V49 WeakPolarHBondContact O-CG2 3.24Å; L45-V49 PolarHBondContact O-N 3.41Å; A46-V49 PolarHBondContact O-N 2.9Å; V49-G51 VanDerWaalsContact C-N 3.33Å; V49-G51 PolarHBondContact O-N 2.94Å; V49-F52 PolarHBondContact O-N 2.84Å; V49-I53 HydrophobicContact CG1-CG1 4.28Å; V49-I53 VanDerWaalsContact O-CG1 3.31Å; V49-I53 WeakPolarHBondContact O-CG1 3.34Å; V49-I53 PolarHBondContact O-N 3.34Å
50	L	97.4	Very high	96.6	Very high	103 Å²	103	92.9 Å²	92.9	54%	0.539	52%	0.517	S	S	.	.	H	α-helix	trans	-56.9	-47.4	175.7	-75.7	168.3	0	0	0	111.3	A46 F52 I53 I54	A46-L50 WeakPolarHBondContact O-CB 3.31Å; A46-L50 VanDerWaalsContact O-CG 3.3Å; A46-L50 WeakPolarHBondContact O-CG 3.41Å; A46-L50 PolarHBondContact O-N 2.87Å; L50-F52 VanDerWaalsContact C-N 3.34Å; L50-F52 PolarHBondContact O-N 2.96Å; L50-I53 PolarHBondContact O-N 3.37Å; L50-I54 WeakPolarHBondContact O-CB 3.27Å; L50-I54 VanDerWaalsContact O-CG1 3.23Å; L50-I54 WeakPolarHBondContact O-CG1 3.45Å; L50-I54 PolarHBondContact O-N 3.16Å
51	G	96.7	Very high	96.5	Very high	38 Å²	38	91.1 Å²	91.1	39%	0.392	50%	0.503	S	S	.	.	H	α-helix	trans	-61.7	-38.8	176.8	0	0	0	0	0	113.4	M47 G48 V49 K55	M47-G51 PolarHBondContact O-N 3.18Å; G48-G51 PolarHBondContact O-N 3.43Å; V49-G51 VanDerWaalsContact C-N 3.33Å; V49-G51 PolarHBondContact O-N 2.94Å; G51-K55 VanDerWaalsContact O-CB 3.27Å; G51-K55 WeakPolarHBondContact O-CB 3.23Å; G51-K55 PolarHBondContact O-N 2.92Å
52	F	97.3	Very high	96.3	Very high	125 Å²	125	93.1 Å²	93.1	55%	0.548	51%	0.505	S	S	.	.	H	α-helix	trans	-65.9	-46	176.6	-177.2	-107.5	0	0	0	112.1	G48 V49 L50 K55 L56	G48-F52 WeakPolarHBondContact O-CB 3.47Å; G48-F52 PolarHBondContact O-N 2.94Å; V49-F52 PolarHBondContact O-N 2.84Å; L50-F52 VanDerWaalsContact C-N 3.34Å; L50-F52 PolarHBondContact O-N 2.96Å; F52-K55 PolarHBondContact O-N 3.38Å; F52-L56 HydrophobicContact CD1-CD1 3.77Å; F52-L56 HydrophobicContact CD1-CG 4.26Å; F52-L56 HydrophobicContact CE1-CD1 3.26Å; F52-L56 HydrophobicContact CE1-CG 3.95Å; F52-L56 HydrophobicContact CE2-CD1 4.43Å; F52-L56 HydrophobicContact CE2-CD2 4.36Å; F52-L56 HydrophobicContact CE2-CG 4.28Å; F52-L56 HydrophobicContact CZ-CD1 3.64Å; F52-L56 HydrophobicContact CZ-CD2 4.08Å; F52-L56 HydrophobicContact CZ-CG 3.95Å; F52-L56 WeakPolarHBondContact O-CB 3.41Å; F52-L56 WeakPolarHBondContact O-CG 3.47Å; F52-L56 PolarHBondContact O-N 3.08Å
53	I	96.6	Very high	96.1	Very high	84 Å²	84	91 Å²	91	43%	0.431	50%	0.5	S	S	.	.	H	α-helix	trans	-63.5	-46.6	178.4	-64.1	-66	0	0	0	111	V49 L50 K55 L56 I57	V49-I53 HydrophobicContact CG1-CG1 4.28Å; V49-I53 VanDerWaalsContact O-CG1 3.31Å; V49-I53 WeakPolarHBondContact O-CG1 3.34Å; V49-I53 PolarHBondContact O-N 3.34Å; L50-I53 PolarHBondContact O-N 3.37Å; I53-K55 VanDerWaalsContact C-N 3.34Å; I53-K55 PolarHBondContact O-N 3.37Å; I53-L56 PolarHBondContact O-N 3.27Å; I53-I57 HydrophobicContact CG2-CD1 3.98Å; I53-I57 WeakPolarHBondContact O-CG1 3.26Å; I53-I57 PolarHBondContact O-N 3.37Å; I53-I57 VanDerWaalsContact O-N 3.08Å
54	I	96.6	Very high	95.9	Very high	93 Å²	93	96 Å²	96	48%	0.477	52%	0.518	S	S	.	.	H	α-helix	trans	-54.2	-53.2	174	-74.9	171.1	0	0	0	109.3	L50 L56 I57 F58	L50-I54 WeakPolarHBondContact O-CB 3.27Å; L50-I54 VanDerWaalsContact O-CG1 3.23Å; L50-I54 WeakPolarHBondContact O-CG1 3.45Å; L50-I54 PolarHBondContact O-N 3.16Å; I54-L56 PolarHBondContact O-N 2.86Å; I54-I57 PolarHBondContact O-N 3.45Å; I54-I57 VanDerWaalsContact O-N 3.16Å; I54-F58 HydrophobicContact CB-CD2 4.5Å; I54-F58 HydrophobicContact CG2-CD2 3.53Å; I54-F58 HydrophobicContact CG2-CE2 3.68Å; I54-F58 WeakPolarHBondContact O-CD2 3.32Å; I54-F58 PolarHBondContact O-N 3.29Å
55	K	95.8	Very high	95.6	Very high	145 Å²	145	94 Å²	94	63%	0.63	51%	0.514	S	S	*	.	H	α-helix	trans	-59.4	-43.3	-179.9	-174	170.7	-177.4	171.2	0	112.5	G51 F52 I53 I57 F58 V59	G51-K55 VanDerWaalsContact O-CB 3.27Å; G51-K55 WeakPolarHBondContact O-CB 3.23Å; G51-K55 PolarHBondContact O-N 2.92Å; F52-K55 PolarHBondContact O-N 3.38Å; I53-K55 VanDerWaalsContact C-N 3.34Å; I53-K55 PolarHBondContact O-N 3.37Å; K55-I57 VanDerWaalsContact C-N 3.28Å; K55-I57 PolarHBondContact O-N 3.3Å; K55-F58 PolarHBondContact O-N 2.94Å; K55-V59 HydrophobicContact CG-CG2 4.37Å; K55-V59 VanDerWaalsContact O-CG2 3.3Å; K55-V59 WeakPolarHBondContact O-CG2 3.15Å; K55-V59 PolarHBondContact O-N 3.43Å
56	L	96.1	Very high	95.3	Very high	96 Å²	96	92.8 Å²	92.8	50%	0.503	51%	0.511	S	S	.	.	H	α-helix	trans	-60.5	-36.3	178	-78.1	-177.4	0	0	0	112.9	F52 I53 I54 P60	F52-L56 HydrophobicContact CD1-CD1 3.77Å; F52-L56 HydrophobicContact CD1-CG 4.26Å; F52-L56 HydrophobicContact CE1-CD1 3.26Å; F52-L56 HydrophobicContact CE1-CG 3.95Å; F52-L56 HydrophobicContact CE2-CD1 4.43Å; F52-L56 HydrophobicContact CE2-CD2 4.36Å; F52-L56 HydrophobicContact CE2-CG 4.28Å; F52-L56 HydrophobicContact CZ-CD1 3.64Å; F52-L56 HydrophobicContact CZ-CD2 4.08Å; F52-L56 HydrophobicContact CZ-CG 3.95Å; F52-L56 WeakPolarHBondContact O-CB 3.41Å; F52-L56 WeakPolarHBondContact O-CG 3.47Å; F52-L56 PolarHBondContact O-N 3.08Å; I53-L56 PolarHBondContact O-N 3.27Å; I54-L56 PolarHBondContact O-N 2.86Å; L56-P60 WeakPolarHBondContact O-CD 3.36Å
57	I	95.4	Very high	94.3	Very high	92 Å²	92	93.7 Å²	93.7	47%	0.472	53%	0.525	S	S	.	.	H	α-helix	trans	-75.8	-40.5	177.4	-67.5	167.9	0	0	0	110.8	I53 I54 K55 P60 I61	I53-I57 HydrophobicContact CG2-CD1 3.98Å; I53-I57 WeakPolarHBondContact O-CG1 3.26Å; I53-I57 PolarHBondContact O-N 3.37Å; I53-I57 VanDerWaalsContact O-N 3.08Å; I54-I57 PolarHBondContact O-N 3.45Å; I54-I57 VanDerWaalsContact O-N 3.16Å; K55-I57 VanDerWaalsContact C-N 3.28Å; K55-I57 PolarHBondContact O-N 3.3Å; I57-P60 VanDerWaalsContact O-CD 3.26Å; I57-P60 WeakPolarHBondContact O-CD 3.2Å; I57-P60 WeakPolarHBondContact O-CG 3.4Å; I57-I61 HydrophobicContact CG2-CD1 3.45Å; I57-I61 VanDerWaalsContact CG2-CD1 3.45Å; I57-I61 HydrophobicContact CG2-CG1 4.43Å; I57-I61 WeakPolarHBondContact O-CD1 3.25Å; I57-I61 WeakPolarHBondContact O-CG1 3.5Å; I57-I61 PolarHBondContact O-N 3.04Å
58	F	94.8	Very high	92.5	Very high	122 Å²	122	96.5 Å²	96.5	54%	0.535	54%	0.542	S	S	.	.	H	α-helix	trans	-73.5	-28	-176.6	-82	-70.8	0	0	0	114.2	I54 K55 I61 N62	I54-F58 HydrophobicContact CB-CD2 4.5Å; I54-F58 HydrophobicContact CG2-CD2 3.53Å; I54-F58 HydrophobicContact CG2-CE2 3.68Å; I54-F58 WeakPolarHBondContact O-CD2 3.32Å; I54-F58 PolarHBondContact O-N 3.29Å; K55-F58 PolarHBondContact O-N 2.94Å; F58-I61 PolarHBondContact O-N 3.24Å; F58-N62 VanDerWaalsContact O-CB 3.25Å; F58-N62 WeakPolarHBondContact O-CB 2.99Å; F58-N62 PolarHBondContact O-N 3.41Å
59	V	93.6	Very high	92.3	Very high	93 Å²	93	99.2 Å²	99.2	56%	0.564	55%	0.547	S	S	*	.	H	α-helix	trans	-57.3	-55.6	176.5	168.2	0	0	0	0	112.9	K55 N62 S63	K55-V59 HydrophobicContact CG-CG2 4.37Å; K55-V59 VanDerWaalsContact O-CG2 3.3Å; K55-V59 WeakPolarHBondContact O-CG2 3.15Å; K55-V59 PolarHBondContact O-N 3.43Å; V59-N62 PolarHBondContact O-N 3.31Å; V59-S63 PolarHBondContact O-N 2.97Å
60	P	94.2	Very high	92	Very high	65 Å²	65	100.4 Å²	100.4	42%	0.422	55%	0.552	S	S	.	*	H	α-helix	trans	-68.4	-37.4	177.6	26.7	-34.3	0	0	0	112.1	L56 I57 N62 S63 I64	L56-P60 WeakPolarHBondContact O-CD 3.36Å; I57-P60 VanDerWaalsContact O-CD 3.26Å; I57-P60 WeakPolarHBondContact O-CD 3.2Å; I57-P60 WeakPolarHBondContact O-CG 3.4Å; P60-N62 VanDerWaalsContact C-N 3.31Å; P60-N62 PolarHBondContact O-N 3.46Å; P60-S63 WeakPolarHBondContact O-CB 3.3Å; P60-S63 PolarHBondContact O-N 2.93Å; P60-S63 VanDerWaalsContact O-N 3.17Å; P60-I64 WeakPolarHBondContact O-CG1 3.32Å; P60-I64 PolarHBondContact O-N 3.17Å
61	I	94.8	Very high	91.7	Very high	66 Å²	66	100.3 Å²	100.3	34%	0.338	55%	0.553	S	S	.	*	H	α-helix	trans	-59.5	-44.1	177	-69.5	175.2	0	0	0	110.7	I57 F58 S63 I64 I65	I57-I61 HydrophobicContact CG2-CD1 3.45Å; I57-I61 VanDerWaalsContact CG2-CD1 3.45Å; I57-I61 HydrophobicContact CG2-CG1 4.43Å; I57-I61 WeakPolarHBondContact O-CD1 3.25Å; I57-I61 WeakPolarHBondContact O-CG1 3.5Å; I57-I61 PolarHBondContact O-N 3.04Å; F58-I61 PolarHBondContact O-N 3.24Å; I61-S63 VanDerWaalsContact C-N 3.32Å; I61-S63 PolarHBondContact O-N 3.46Å; I61-I64 PolarHBondContact O-N 2.84Å; I61-I65 HydrophobicContact CG2-CD1 3.52Å; I61-I65 HydrophobicContact CG2-CG1 4.25Å; I61-I65 WeakPolarHBondContact O-CB 3.29Å; I61-I65 VanDerWaalsContact O-CG1 3.29Å; I61-I65 WeakPolarHBondContact O-CG1 3.24Å; I61-I65 PolarHBondContact O-N 3.46Å
62	N	93.8	Very high	91.4	Very high	101 Å²	101	103.9 Å²	103.9	54%	0.54	56%	0.562	S	S	.	*	H	α-helix	trans	-65.8	-36.3	178.2	-168.7	57.3	0	0	0	111.8	F58 V59 P60 I65 V66	F58-N62 VanDerWaalsContact O-CB 3.25Å; F58-N62 WeakPolarHBondContact O-CB 2.99Å; F58-N62 PolarHBondContact O-N 3.41Å; V59-N62 PolarHBondContact O-N 3.31Å; P60-N62 VanDerWaalsContact C-N 3.31Å; P60-N62 PolarHBondContact O-N 3.46Å; N62-I65 PolarHBondContact O-N 3.2Å; N62-V66 VanDerWaalsContact O-CB 3.32Å; N62-V66 WeakPolarHBondContact O-CB 3.32Å; N62-V66 VanDerWaalsContact O-CG2 3.24Å; N62-V66 WeakPolarHBondContact O-CG2 3.44Å; N62-V66 PolarHBondContact O-N 3.46Å
63	S	93.1	Very high	91.1	Very high	65 Å²	65	102.6 Å²	102.6	46%	0.455	56%	0.563	S	S	.	*	H	α-helix	trans	-62.7	-42.1	173.4	-162.8	0	0	0	0	112	V59 P60 I61 G67	V59-S63 PolarHBondContact O-N 2.97Å; P60-S63 WeakPolarHBondContact O-CB 3.3Å; P60-S63 PolarHBondContact O-N 2.93Å; P60-S63 VanDerWaalsContact O-N 3.17Å; I61-S63 VanDerWaalsContact C-N 3.32Å; I61-S63 PolarHBondContact O-N 3.46Å; S63-G67 PolarHBondContact O-N 3.42Å
64	I	92.7	Very high	90.7	Very high	138 Å²	138	103.9 Å²	103.9	71%	0.708	57%	0.572	S	S	*	*	H	α-helix	trans	-67.8	-39.9	178.7	-65.6	162.7	0	0	0	111.3	P60 I61	P60-I64 WeakPolarHBondContact O-CG1 3.32Å; P60-I64 PolarHBondContact O-N 3.17Å; I61-I64 PolarHBondContact O-N 2.84Å
65	I	91.5	Very high	90.3	Very high	129 Å²	129	104.6 Å²	104.6	66%	0.662	58%	0.578	S	S	*	*	H	α-helix	trans	-76.1	-42	-177.3	-67.5	172.5	0	0	0	112.3	I61 N62 G67	I61-I65 HydrophobicContact CG2-CD1 3.52Å; I61-I65 HydrophobicContact CG2-CG1 4.25Å; I61-I65 WeakPolarHBondContact O-CB 3.29Å; I61-I65 VanDerWaalsContact O-CG1 3.29Å; I61-I65 WeakPolarHBondContact O-CG1 3.24Å; I61-I65 PolarHBondContact O-N 3.46Å; N62-I65 PolarHBondContact O-N 3.2Å; I65-G67 PolarHBondContact O-N 2.94Å
66	V	92.3	Very high	89.9	Confident	92 Å²	92	101.5 Å²	101.5	56%	0.558	57%	0.574	S	S	*	*	H	α-helix	trans	-69.9	-18.1	-179.1	175	0	0	0	0	111.5	N62	N62-V66 VanDerWaalsContact O-CB 3.32Å; N62-V66 WeakPolarHBondContact O-CB 3.32Å; N62-V66 VanDerWaalsContact O-CG2 3.24Å; N62-V66 WeakPolarHBondContact O-CG2 3.44Å; N62-V66 PolarHBondContact O-N 3.46Å
67	G	76.2	Confident	89.3	Confident	64 Å²	64	102 Å²	102	66%	0.66	58%	0.58	S	S	*	*	T	Hydrogen-bonded Turn	trans	73.4	33	171.8	0	0	0	0	0	113.9	S63 I65	S63-G67 PolarHBondContact O-N 3.42Å; I65-G67 PolarHBondContact O-N 2.94Å
68	N	59.6	Low	88.8	Confident	197 Å²	197	102.9 Å²	102.9	100%	1.053	59%	0.59	S	S	*	*			trans	-80	0	162.5	-117.4	84.2	0	0	0	110

Retrieved 68 of 68 residues in 24.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).