G4M232_SCHMA Loading...

Smp_205700

AlphaFold DB , UniProt , Accession G4M232, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 77 aa.

						>G4M232_SCHMA|G4M232
MFQMNRFLIKGLMMMMMMMMMMVMMMMMIFEIHWLLMKSLVNLRKIFHVNEIVVKHVMLLVFTMHTFAQRRSYFNYE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	69.3	Low	87.2	Confident	203 Å²	203	126.7 Å²	126.7	100%	1	61%	0.607	S	S	*	*				0	-53	0	-103.6	-179.6	-180	0	0	113.9	Q3 M4 N5	M1-Q3 PolarHBondContact O-N 3.31Å; M1-M4 PolarHBondContact O-N 3.16Å; M1-N5 PolarHBondContact O-N 3.18Å; M1-N5 VanDerWaalsContact O-N 3.16Å
2	F	80.5	Confident	87.9	Confident	150 Å²	150	125.4 Å²	125.4	66%	0.658	61%	0.605	S	S	*	*	H	α-helix	trans	-60.3	-38.9	-172.3	-165.9	-108.5	0	0	0	115.4	N5 R6	F2-N5 PolarHBondContact O-N 2.92Å; F2-R6 PolarHBondContact O-N 3.5Å; F2-R6 VanDerWaalsContact O-N 3.1Å
3	Q	82.8	Confident	88.4	Confident	172 Å²	172	123.2 Å²	123.2	80%	0.804	60%	0.595	S	S	*	*	H	α-helix	trans	-64.1	-41.2	176.3	-74.6	-174.5	-10.4	0	0	112.6	M1 R6 F7	M1-Q3 PolarHBondContact O-N 3.31Å; Q3-R6 PolarHBondContact O-N 3.04Å; Q3-F7 PolarHBondContact O-N 3.26Å; Q3-F7 VanDerWaalsContact O-N 3.1Å
4	M	84	Confident	88.8	Confident	129 Å²	129	123.3 Å²	123.3	64%	0.635	60%	0.596	S	S	*	*	H	α-helix	trans	-63.6	-42.9	177.8	-162.9	172.9	103.2	0	0	111	M1 R6 F7 L8	M1-M4 PolarHBondContact O-N 3.16Å; M4-R6 VanDerWaalsContact C-N 3.34Å; M4-R6 PolarHBondContact O-N 3.38Å; M4-F7 PolarHBondContact O-N 3.1Å; M4-L8 WeakPolarHBondContact O-CG 3.44Å; M4-L8 PolarHBondContact O-N 3.43Å
5	N	90.2	Very high	89.3	Confident	79 Å²	79	123.4 Å²	123.4	42%	0.422	60%	0.598	S	S	.	*	H	α-helix	trans	-61.3	-41.1	175.7	-68.4	3.6	0	0	0	111.9	M1 F2 F7 L8 I9	M1-N5 PolarHBondContact O-N 3.18Å; M1-N5 VanDerWaalsContact O-N 3.16Å; F2-N5 PolarHBondContact O-N 2.92Å; N5-F7 PolarHBondContact O-N 3.47Å; N5-L8 PolarHBondContact O-N 2.95Å; N5-I9 WeakPolarHBondContact O-CD1 3.23Å; N5-I9 VanDerWaalsContact O-CG1 3.23Å; N5-I9 WeakPolarHBondContact O-CG1 3.47Å; N5-I9 PolarHBondContact O-N 3.31Å
6	R	90.5	Very high	89.7	Confident	144 Å²	144	122.1 Å²	122.1	54%	0.543	59%	0.592	S	S	.	*	H	α-helix	trans	-64.1	-39.7	177.6	-171.5	-175	-67.5	-163.2	-4.3	112.3	F2 Q3 M4 K10	F2-R6 PolarHBondContact O-N 3.5Å; F2-R6 VanDerWaalsContact O-N 3.1Å; Q3-R6 PolarHBondContact O-N 3.04Å; M4-R6 VanDerWaalsContact C-N 3.34Å; M4-R6 PolarHBondContact O-N 3.38Å; R6-K10 WeakPolarHBondContact O-CG 3.43Å; R6-K10 PolarHBondContact O-N 3.49Å
7	F	92.4	Very high	90	Very high	159 Å²	159	121.3 Å²	121.3	70%	0.697	59%	0.589	S	S	*	*	H	α-helix	trans	-65	-45.3	176.8	-174.1	-96.8	0	0	0	111.3	Q3 M4 N5 I9 K10 G11	Q3-F7 PolarHBondContact O-N 3.26Å; Q3-F7 VanDerWaalsContact O-N 3.1Å; M4-F7 PolarHBondContact O-N 3.1Å; N5-F7 PolarHBondContact O-N 3.47Å; F7-I9 PolarHBondContact O-N 3.42Å; F7-K10 PolarHBondContact O-N 3.27Å; F7-G11 PolarHBondContact O-N 3.1Å
8	L	92.3	Very high	90.4	Very high	93 Å²	93	119.9 Å²	119.9	49%	0.487	58%	0.582	S	S	.	*	H	α-helix	trans	-60.9	-44.8	176.3	-70.6	171.8	0	0	0	112.3	M4 N5 K10 G11 L12	M4-L8 WeakPolarHBondContact O-CG 3.44Å; M4-L8 PolarHBondContact O-N 3.43Å; N5-L8 PolarHBondContact O-N 2.95Å; L8-K10 PolarHBondContact O-N 3.32Å; L8-G11 PolarHBondContact O-N 3.49Å; L8-L12 WeakPolarHBondContact O-CB 3.43Å; L8-L12 WeakPolarHBondContact O-CG 3.46Å; L8-L12 PolarHBondContact O-N 3.28Å
9	I	92.6	Very high	90.7	Very high	100 Å²	100	119.4 Å²	119.4	51%	0.513	58%	0.58	S	S	.	*	H	α-helix	trans	-61.3	-45.5	176.9	-67.6	163.5	0	0	0	110.8	N5 F7 G11 L12 M13	N5-I9 WeakPolarHBondContact O-CD1 3.23Å; N5-I9 VanDerWaalsContact O-CG1 3.23Å; N5-I9 WeakPolarHBondContact O-CG1 3.47Å; N5-I9 PolarHBondContact O-N 3.31Å; F7-I9 PolarHBondContact O-N 3.42Å; I9-G11 PolarHBondContact O-N 3.05Å; I9-L12 PolarHBondContact O-N 3.29Å; I9-M13 HydrophobicContact CG2-CG 4.43Å; I9-M13 HydrophobicContact CG2-SD 4.44Å; I9-M13 WeakPolarHBondContact O-CG 3.43Å; I9-M13 PolarHBondContact O-N 3.41Å
10	K	91.3	Very high	90.9	Very high	131 Å²	131	119.2 Å²	119.2	57%	0.57	58%	0.579	S	S	*	*	H	α-helix	trans	-62.3	-43	177.3	-76.9	-176.7	174.5	-170	0	112.2	R6 F7 L8 M13 M14	R6-K10 WeakPolarHBondContact O-CG 3.43Å; R6-K10 PolarHBondContact O-N 3.49Å; F7-K10 PolarHBondContact O-N 3.27Å; L8-K10 PolarHBondContact O-N 3.32Å; K10-M13 PolarHBondContact O-N 3.42Å; K10-M14 WeakPolarHBondContact O-CB 3.41Å; K10-M14 PolarHBondContact O-N 2.96Å
11	G	93.5	Very high	91.2	Very high	34 Å²	34	119 Å²	119	35%	0.351	58%	0.579	S	S	.	*	H	α-helix	trans	-60.9	-46.5	176.3	0	0	0	0	0	112.1	F7 L8 I9 M14 M15	F7-G11 PolarHBondContact O-N 3.1Å; L8-G11 PolarHBondContact O-N 3.49Å; I9-G11 PolarHBondContact O-N 3.05Å; G11-M14 PolarHBondContact O-N 2.95Å; G11-M15 WeakPolarHBondContact O-CG 3.4Å; G11-M15 PolarHBondContact O-N 3.38Å
12	L	94.8	Very high	92.5	Very high	111 Å²	111	114.4 Å²	114.4	58%	0.581	56%	0.556	S	S	*	*	H	α-helix	trans	-61.2	-46.5	175.8	-77.5	166.1	0	0	0	112.2	L8 I9 M14 M15 M16	L8-L12 WeakPolarHBondContact O-CB 3.43Å; L8-L12 WeakPolarHBondContact O-CG 3.46Å; L8-L12 PolarHBondContact O-N 3.28Å; I9-L12 PolarHBondContact O-N 3.29Å; L12-M14 VanDerWaalsContact C-N 3.31Å; L12-M14 PolarHBondContact O-N 2.91Å; L12-M15 PolarHBondContact O-N 2.92Å; L12-M16 WeakPolarHBondContact O-CG 3.38Å; L12-M16 PolarHBondContact O-N 2.88Å
13	M	94.4	Very high	93.2	Very high	97 Å²	97	111.6 Å²	111.6	48%	0.478	55%	0.551	S	S	.	*	H	α-helix	trans	-60.8	-41	176.8	-72.1	-167.7	-29.6	0	0	111.9	I9 K10 M16 M17	I9-M13 HydrophobicContact CG2-CG 4.43Å; I9-M13 HydrophobicContact CG2-SD 4.44Å; I9-M13 WeakPolarHBondContact O-CG 3.43Å; I9-M13 PolarHBondContact O-N 3.41Å; K10-M13 PolarHBondContact O-N 3.42Å; M13-M16 PolarHBondContact O-N 2.96Å; M13-M17 HydrophobicContact CB-CE 4.19Å; M13-M17 WeakPolarHBondContact O-CG 3.35Å; M13-M17 PolarHBondContact O-N 2.94Å
14	M	95.1	Very high	93.9	Very high	124 Å²	124	108.8 Å²	108.8	61%	0.611	54%	0.54	S	S	*	.	H	α-helix	trans	-65	-42.9	177.8	-168.3	171.2	-178.3	0	0	111.5	K10 G11 L12 M17 M18	K10-M14 WeakPolarHBondContact O-CB 3.41Å; K10-M14 PolarHBondContact O-N 2.96Å; G11-M14 PolarHBondContact O-N 2.95Å; L12-M14 VanDerWaalsContact C-N 3.31Å; L12-M14 PolarHBondContact O-N 2.91Å; M14-M17 PolarHBondContact O-N 3.5Å; M14-M18 WeakPolarHBondContact O-CG 3.37Å; M14-M18 PolarHBondContact O-N 3.37Å
15	M	95.6	Very high	94.4	Very high	125 Å²	125	107.6 Å²	107.6	62%	0.616	53%	0.534	S	S	*	.	H	α-helix	trans	-62.3	-43.4	173.9	-71.8	-175	79.4	0	0	112	G11 L12 M17 M18 M19	G11-M15 WeakPolarHBondContact O-CG 3.4Å; G11-M15 PolarHBondContact O-N 3.38Å; L12-M15 PolarHBondContact O-N 2.92Å; M15-M17 PolarHBondContact O-N 3.36Å; M15-M18 PolarHBondContact O-N 2.92Å; M15-M19 WeakPolarHBondContact O-CG 3.38Å; M15-M19 PolarHBondContact O-N 3.33Å
16	M	95.7	Very high	94.8	Very high	102 Å²	102	110.3 Å²	110.3	50%	0.502	55%	0.546	S	S	.	.	H	α-helix	trans	-61.4	-44.1	175.9	-73.8	-177	71.1	0	0	111.9	L12 M13 M19 M20	L12-M16 WeakPolarHBondContact O-CG 3.38Å; L12-M16 PolarHBondContact O-N 2.88Å; M13-M16 PolarHBondContact O-N 2.96Å; M16-M19 HydrophobicContact CG-CE 4.41Å; M16-M19 PolarHBondContact O-N 2.96Å; M16-M20 HydrophobicContact CE-CE 4.4Å; M16-M20 WeakPolarHBondContact O-CG 3.4Å; M16-M20 PolarHBondContact O-N 3.32Å
17	M	95.5	Very high	95.1	Very high	109 Å²	109	108.5 Å²	108.5	54%	0.537	55%	0.545	S	S	.	.	H	α-helix	trans	-62.1	-43.5	175.9	-78.6	-173.2	-92.6	0	0	111.9	M13 M14 M15 M20 M21	M13-M17 HydrophobicContact CB-CE 4.19Å; M13-M17 WeakPolarHBondContact O-CG 3.35Å; M13-M17 PolarHBondContact O-N 2.94Å; M14-M17 PolarHBondContact O-N 3.5Å; M15-M17 PolarHBondContact O-N 3.36Å; M17-M20 PolarHBondContact O-N 2.91Å; M17-M21 WeakPolarHBondContact O-CG 3.4Å; M17-M21 PolarHBondContact O-N 3.42Å
18	M	96.1	Very high	95.3	Very high	97 Å²	97	105.8 Å²	105.8	48%	0.478	54%	0.535	S	S	.	.	H	α-helix	trans	-61.8	-44.1	175.8	-73.3	-176.2	72.5	0	0	111.9	M14 M15 M21 M22	M14-M18 WeakPolarHBondContact O-CG 3.37Å; M14-M18 PolarHBondContact O-N 3.37Å; M15-M18 PolarHBondContact O-N 2.92Å; M18-M21 PolarHBondContact O-N 3.33Å; M18-M22 HydrophobicContact CE-CE 4.42Å; M18-M22 WeakPolarHBondContact O-CG 3.44Å; M18-M22 PolarHBondContact O-N 2.89Å
19	M	96.3	Very high	95.5	Very high	110 Å²	110	106.3 Å²	106.3	54%	0.542	54%	0.537	S	S	.	.	H	α-helix	trans	-62.4	-44.8	176	-72.9	-167.5	-61.2	0	0	111.7	M15 M16 M21 M22 V23	M15-M19 WeakPolarHBondContact O-CG 3.38Å; M15-M19 PolarHBondContact O-N 3.33Å; M16-M19 HydrophobicContact CG-CE 4.41Å; M16-M19 PolarHBondContact O-N 2.96Å; M19-M21 VanDerWaalsContact C-N 3.32Å; M19-M21 PolarHBondContact O-N 3.35Å; M19-M22 PolarHBondContact O-N 3.4Å; M19-V23 WeakPolarHBondContact O-CG2 3.4Å; M19-V23 PolarHBondContact O-N 3.46Å
20	M	96	Very high	95.7	Very high	114 Å²	114	108 Å²	108	56%	0.562	54%	0.541	S	S	*	.	H	α-helix	trans	-59.5	-43.1	176.3	-74.3	-174.4	-172.8	0	0	111.7	M16 M17 V23 M24	M16-M20 HydrophobicContact CE-CE 4.4Å; M16-M20 WeakPolarHBondContact O-CG 3.4Å; M16-M20 PolarHBondContact O-N 3.32Å; M17-M20 PolarHBondContact O-N 2.91Å; M20-V23 PolarHBondContact O-N 3.33Å; M20-M24 WeakPolarHBondContact O-CG 3.43Å; M20-M24 PolarHBondContact O-N 3.33Å
21	M	96.1	Very high	96	Very high	117 Å²	117	107.2 Å²	107.2	58%	0.576	54%	0.54	S	S	*	.	H	α-helix	trans	-63.7	-42.4	176.2	-71.9	-147.5	-65	0	0	112.3	M17 M18 M19 V23 M24 M25	M17-M21 WeakPolarHBondContact O-CG 3.4Å; M17-M21 PolarHBondContact O-N 3.42Å; M18-M21 PolarHBondContact O-N 3.33Å; M19-M21 VanDerWaalsContact C-N 3.32Å; M19-M21 PolarHBondContact O-N 3.35Å; M21-V23 VanDerWaalsContact C-N 3.33Å; M21-V23 PolarHBondContact O-N 2.92Å; M21-M24 HydrophobicContact CG-CE 4.27Å; M21-M24 PolarHBondContact O-N 3.22Å; M21-M25 WeakPolarHBondContact O-CG 3.33Å; M21-M25 PolarHBondContact O-N 2.94Å
22	M	96.4	Very high	96.1	Very high	106 Å²	106	111.3 Å²	111.3	52%	0.522	55%	0.552	S	S	.	*	H	α-helix	trans	-61.2	-42.4	175.4	-71.1	-173.4	-154.4	0	0	112	M18 M19 M25 M26	M18-M22 HydrophobicContact CE-CE 4.42Å; M18-M22 WeakPolarHBondContact O-CG 3.44Å; M18-M22 PolarHBondContact O-N 2.89Å; M19-M22 PolarHBondContact O-N 3.4Å; M22-M25 PolarHBondContact O-N 2.93Å; M22-M26 WeakPolarHBondContact O-CG 3.27Å; M22-M26 PolarHBondContact O-N 3.38Å
23	V	96.1	Very high	96.2	Very high	91 Å²	91	111.3 Å²	111.3	55%	0.552	55%	0.549	S	S	*	.	H	α-helix	trans	-63	-46.1	176.6	172.2	0	0	0	0	110.7	M19 M20 M21 M25 M26 M27	M19-V23 WeakPolarHBondContact O-CG2 3.4Å; M19-V23 PolarHBondContact O-N 3.46Å; M20-V23 PolarHBondContact O-N 3.33Å; M21-V23 VanDerWaalsContact C-N 3.33Å; M21-V23 PolarHBondContact O-N 2.92Å; V23-M25 VanDerWaalsContact C-N 3.32Å; V23-M25 PolarHBondContact O-N 3.33Å; V23-M26 PolarHBondContact O-N 3.45Å; V23-M27 HydrophobicContact CG1-CG 4.43Å; V23-M27 VanDerWaalsContact O-CG 3.31Å; V23-M27 WeakPolarHBondContact O-CG 3.31Å; V23-M27 PolarHBondContact O-N 2.94Å
24	M	96.3	Very high	96.2	Very high	113 Å²	113	114.8 Å²	114.8	56%	0.557	56%	0.557	S	S	*	*	H	α-helix	trans	-59.8	-41.9	176.3	-73.1	-166.5	-67.8	0	0	112	M20 M21 M27 M28	M20-M24 WeakPolarHBondContact O-CG 3.43Å; M20-M24 PolarHBondContact O-N 3.33Å; M21-M24 HydrophobicContact CG-CE 4.27Å; M21-M24 PolarHBondContact O-N 3.22Å; M24-M27 PolarHBondContact O-N 2.92Å; M24-M28 WeakPolarHBondContact O-CG 3.4Å; M24-M28 PolarHBondContact O-N 3.28Å
25	M	96.4	Very high	96.3	Very high	104 Å²	104	114.2 Å²	114.2	51%	0.512	56%	0.556	S	S	.	*	H	α-helix	trans	-63.2	-44.1	175.5	-72.2	-164.1	-61.3	0	0	112.4	M21 M22 V23 M27 M28 I29	M21-M25 WeakPolarHBondContact O-CG 3.33Å; M21-M25 PolarHBondContact O-N 2.94Å; M22-M25 PolarHBondContact O-N 2.93Å; V23-M25 VanDerWaalsContact C-N 3.32Å; V23-M25 PolarHBondContact O-N 3.33Å; M25-M27 VanDerWaalsContact C-N 3.31Å; M25-M27 PolarHBondContact O-N 3.23Å; M25-M28 HydrophobicContact CG-CE 4.22Å; M25-M28 PolarHBondContact O-N 2.92Å; M25-I29 VanDerWaalsContact O-CG1 3.27Å; M25-I29 WeakPolarHBondContact O-CG1 3.29Å; M25-I29 PolarHBondContact O-N 3.19Å
26	M	96.8	Very high	96.3	Very high	136 Å²	136	112.5 Å²	112.5	67%	0.67	55%	0.549	S	S	*	.	H	α-helix	trans	-60.2	-42.1	176.2	-76.7	-74.8	174	0	0	111.7	M22 V23 I29 F30	M22-M26 WeakPolarHBondContact O-CG 3.27Å; M22-M26 PolarHBondContact O-N 3.38Å; V23-M26 PolarHBondContact O-N 3.45Å; M26-I29 PolarHBondContact O-N 3.44Å; M26-F30 WeakPolarHBondContact O-CB 3.42Å; M26-F30 PolarHBondContact O-N 3.36Å
27	M	96.6	Very high	96.2	Very high	106 Å²	106	112.4 Å²	112.4	52%	0.522	55%	0.548	S	S	.	.	H	α-helix	trans	-63.3	-45.1	176	-69	-64.9	-69.6	0	0	111.6	V23 M24 M25 I29 F30 E31	V23-M27 HydrophobicContact CG1-CG 4.43Å; V23-M27 VanDerWaalsContact O-CG 3.31Å; V23-M27 WeakPolarHBondContact O-CG 3.31Å; V23-M27 PolarHBondContact O-N 2.94Å; M24-M27 PolarHBondContact O-N 2.92Å; M25-M27 VanDerWaalsContact C-N 3.31Å; M25-M27 PolarHBondContact O-N 3.23Å; M27-I29 VanDerWaalsContact C-N 3.35Å; M27-I29 PolarHBondContact O-N 2.89Å; M27-F30 WeakPolarHBondContact O-CB 3.48Å; M27-F30 PolarHBondContact O-N 3.46Å; M27-E31 WeakPolarHBondContact O-CG 3.41Å; M27-E31 PolarHBondContact O-N 3.43Å
28	M	97.4	Very high	96.2	Very high	102 Å²	102	113.3 Å²	113.3	50%	0.502	55%	0.549	S	S	.	.	H	α-helix	trans	-61.5	-42.6	176.3	-74.1	-172.7	-76.8	0	0	112	M24 M25 F30 E31 I32	M24-M28 WeakPolarHBondContact O-CG 3.4Å; M24-M28 PolarHBondContact O-N 3.28Å; M25-M28 HydrophobicContact CG-CE 4.22Å; M25-M28 PolarHBondContact O-N 2.92Å; M28-F30 VanDerWaalsContact C-N 3.31Å; M28-F30 PolarHBondContact O-N 2.96Å; M28-E31 PolarHBondContact O-N 3.35Å; M28-I32 WeakPolarHBondContact O-CD1 3.34Å; M28-I32 VanDerWaalsContact O-CG1 3.25Å; M28-I32 WeakPolarHBondContact O-CG1 3.25Å; M28-I32 PolarHBondContact O-N 2.93Å
29	I	97	Very high	96.1	Very high	103 Å²	103	111 Å²	111	53%	0.528	54%	0.543	S	S	.	.	H	α-helix	trans	-61.5	-43.9	175.9	-67.8	164.4	0	0	0	110	M25 M26 M27 I32 H33	M25-I29 VanDerWaalsContact O-CG1 3.27Å; M25-I29 WeakPolarHBondContact O-CG1 3.29Å; M25-I29 PolarHBondContact O-N 3.19Å; M26-I29 PolarHBondContact O-N 3.44Å; M27-I29 VanDerWaalsContact C-N 3.35Å; M27-I29 PolarHBondContact O-N 2.89Å; I29-I32 PolarHBondContact O-N 2.87Å; I29-H33 VanDerWaalsContact O-CB 3.29Å; I29-H33 WeakPolarHBondContact O-CB 3.43Å; I29-H33 PolarHBondContact O-N 2.99Å
30	F	97.4	Very high	96	Very high	136 Å²	136	110 Å²	110	60%	0.596	54%	0.539	S	S	*	.	H	α-helix	trans	-62.9	-44	178	-176.7	-97.4	0	0	0	112.3	M26 M27 M28 H33 W34	M26-F30 WeakPolarHBondContact O-CB 3.42Å; M26-F30 PolarHBondContact O-N 3.36Å; M27-F30 WeakPolarHBondContact O-CB 3.48Å; M27-F30 PolarHBondContact O-N 3.46Å; M28-F30 VanDerWaalsContact C-N 3.31Å; M28-F30 PolarHBondContact O-N 2.96Å; F30-H33 PolarHBondContact O-N 3.35Å; F30-W34 WeakPolarHBondContact O-CB 3.44Å; F30-W34 PolarHBondContact O-N 3.35Å
31	E	96.8	Very high	95.8	Very high	115 Å²	115	108.6 Å²	108.6	54%	0.537	54%	0.536	S	S	.	.	H	α-helix	trans	-61.5	-45.5	176.7	-75.2	-178	174.4	0	0	112.1	M27 M28 H33 W34 L35	M27-E31 WeakPolarHBondContact O-CG 3.41Å; M27-E31 PolarHBondContact O-N 3.43Å; M28-E31 PolarHBondContact O-N 3.35Å; E31-H33 VanDerWaalsContact C-N 3.32Å; E31-H33 PolarHBondContact O-N 2.96Å; E31-W34 PolarHBondContact O-N 2.94Å; E31-L35 WeakPolarHBondContact O-CG 3.48Å; E31-L35 PolarHBondContact O-N 2.83Å
32	I	96.6	Very high	95.7	Very high	119 Å²	119	106.6 Å²	106.6	61%	0.61	53%	0.528	S	S	*	.	H	α-helix	trans	-61.3	-45	175.8	-66.9	165.1	0	0	0	110.1	M28 I29 W34 L35 L36	M28-I32 WeakPolarHBondContact O-CD1 3.34Å; M28-I32 VanDerWaalsContact O-CG1 3.25Å; M28-I32 WeakPolarHBondContact O-CG1 3.25Å; M28-I32 PolarHBondContact O-N 2.93Å; I29-I32 PolarHBondContact O-N 2.87Å; I32-W34 VanDerWaalsContact C-N 3.35Å; I32-W34 PolarHBondContact O-N 3.47Å; I32-L35 PolarHBondContact O-N 2.97Å; I32-L36 WeakPolarHBondContact O-CB 3.34Å; I32-L36 PolarHBondContact O-N 3.25Å
33	H	95.4	Very high	95.5	Very high	112 Å²	112	105.4 Å²	105.4	52%	0.519	52%	0.524	S	S	.	.	H	α-helix	trans	-62.5	-42.6	179.1	-155.9	82.6	0	0	0	111.5	I29 F30 E31 L36 M37	I29-H33 VanDerWaalsContact O-CB 3.29Å; I29-H33 WeakPolarHBondContact O-CB 3.43Å; I29-H33 PolarHBondContact O-N 2.99Å; F30-H33 PolarHBondContact O-N 3.35Å; E31-H33 VanDerWaalsContact C-N 3.32Å; E31-H33 PolarHBondContact O-N 2.96Å; H33-L36 PolarHBondContact O-N 3.01Å; H33-M37 WeakPolarHBondContact O-CG 3.32Å; H33-M37 PolarHBondContact O-N 3.44Å
34	W	95.6	Very high	95.4	Very high	170 Å²	170	110.7 Å²	110.7	64%	0.644	53%	0.533	S	S	*	.	H	α-helix	trans	-62.7	-45.3	176	176.9	-107.2	0	0	0	112.6	F30 E31 I32 L36 M37 K38	F30-W34 WeakPolarHBondContact O-CB 3.44Å; F30-W34 PolarHBondContact O-N 3.35Å; E31-W34 PolarHBondContact O-N 2.94Å; I32-W34 VanDerWaalsContact C-N 3.35Å; I32-W34 PolarHBondContact O-N 3.47Å; W34-L36 VanDerWaalsContact C-N 3.31Å; W34-L36 PolarHBondContact O-N 2.85Å; W34-M37 PolarHBondContact O-N 3.38Å; W34-K38 PolarHBondContact O-N 3.33Å
35	L	95.5	Very high	95.3	Very high	111 Å²	111	111.4 Å²	111.4	58%	0.581	53%	0.534	S	S	*	.	H	α-helix	trans	-62.3	-39	176.7	-73.3	172.8	0	0	0	111.9	E31 I32 K38 S39	E31-L35 WeakPolarHBondContact O-CG 3.48Å; E31-L35 PolarHBondContact O-N 2.83Å; I32-L35 PolarHBondContact O-N 2.97Å; L35-K38 PolarHBondContact O-N 3.48Å; L35-S39 PolarHBondContact O-N 3.28Å
36	L	95.8	Very high	95.1	Very high	90 Å²	90	111 Å²	111	47%	0.471	53%	0.532	S	S	.	.	H	α-helix	trans	-63.5	-45.2	174.5	-176.4	66.9	0	0	0	111.5	I32 H33 W34 K38 S39 L40	I32-L36 WeakPolarHBondContact O-CB 3.34Å; I32-L36 PolarHBondContact O-N 3.25Å; H33-L36 PolarHBondContact O-N 3.01Å; W34-L36 VanDerWaalsContact C-N 3.31Å; W34-L36 PolarHBondContact O-N 2.85Å; L36-K38 VanDerWaalsContact C-N 3.28Å; L36-K38 PolarHBondContact O-N 2.95Å; L36-S39 PolarHBondContact O-N 3.17Å; L36-S39 VanDerWaalsContact O-N 3.17Å; L36-S39 PolarHBondContact O-OG 3.44Å; L36-L40 HydrophobicContact CG-CD1 4.41Å; L36-L40 WeakPolarHBondContact O-CG 3.42Å; L36-L40 PolarHBondContact O-N 3.36Å
37	M	95.4	Very high	94.9	Very high	100 Å²	100	111.3 Å²	111.3	49%	0.493	53%	0.53	S	S	.	.	H	α-helix	trans	-61.4	-39.5	177.3	-68.8	-61.3	-83.2	0	0	111.7	H33 W34 L40 V41	H33-M37 WeakPolarHBondContact O-CG 3.32Å; H33-M37 PolarHBondContact O-N 3.44Å; W34-M37 PolarHBondContact O-N 3.38Å; M37-L40 PolarHBondContact O-N 3.46Å; M37-L40 HydrophobicContact SD-CD1 4.17Å; M37-V41 WeakPolarHBondContact O-CG2 3.36Å; M37-V41 PolarHBondContact O-N 3.14Å; M37-V41 VanDerWaalsContact O-N 3.12Å
38	K	94.8	Very high	94.7	Very high	127 Å²	127	111.6 Å²	111.6	55%	0.552	53%	0.53	S	S	*	.	H	α-helix	trans	-64.2	-41.1	174.8	-173.6	175.6	179.8	-179.9	0	112.3	W34 L35 L36 V41 N42	W34-K38 PolarHBondContact O-N 3.33Å; L35-K38 PolarHBondContact O-N 3.48Å; L36-K38 VanDerWaalsContact C-N 3.28Å; L36-K38 PolarHBondContact O-N 2.95Å; K38-V41 PolarHBondContact O-N 2.85Å; K38-N42 PolarHBondContact O-N 2.98Å; K38-N42 VanDerWaalsContact O-N 3.15Å
39	S	93.7	Very high	94.5	Very high	50 Å²	50	110.7 Å²	110.7	35%	0.35	53%	0.53	S	S	.	.	H	α-helix	trans	-67.5	-38.4	178.1	73.6	0	0	0	0	111.9	L35 L36 V41 N42 L43	L35-S39 PolarHBondContact O-N 3.28Å; L36-S39 PolarHBondContact O-N 3.17Å; L36-S39 VanDerWaalsContact O-N 3.17Å; L36-S39 PolarHBondContact O-OG 3.44Å; S39-V41 PolarHBondContact O-N 3.15Å; S39-N42 WeakPolarHBondContact O-CB 3.47Å; S39-N42 PolarHBondContact O-N 2.95Å; S39-N42 VanDerWaalsContact O-N 3.14Å; S39-L43 WeakPolarHBondContact O-CG 3.46Å; S39-L43 PolarHBondContact O-N 3.29Å
40	L	93.3	Very high	94.3	Very high	89 Å²	89	109.8 Å²	109.8	47%	0.466	53%	0.526	S	S	.	.	H	α-helix	trans	-61.3	-41.6	174.3	-70.4	174	0	0	0	112.4	L36 M37 N42 L43 R44	L36-L40 HydrophobicContact CG-CD1 4.41Å; L36-L40 WeakPolarHBondContact O-CG 3.42Å; L36-L40 PolarHBondContact O-N 3.36Å; M37-L40 PolarHBondContact O-N 3.46Å; M37-L40 HydrophobicContact SD-CD1 4.17Å; L40-N42 VanDerWaalsContact C-N 3.3Å; L40-N42 PolarHBondContact O-N 3.41Å; L40-L43 HydrophobicContact CD2-CD1 4.34Å; L40-L43 PolarHBondContact O-N 3.12Å; L40-R44 PolarHBondContact O-N 3.43Å
41	V	93.4	Very high	94.1	Very high	83 Å²	83	108 Å²	108	50%	0.503	52%	0.52	S	S	.	.	H	α-helix	trans	-62.1	-39.6	174.3	171.3	0	0	0	0	111.2	M37 K38 S39 R44 K45	M37-V41 WeakPolarHBondContact O-CG2 3.36Å; M37-V41 PolarHBondContact O-N 3.14Å; M37-V41 VanDerWaalsContact O-N 3.12Å; K38-V41 PolarHBondContact O-N 2.85Å; S39-V41 PolarHBondContact O-N 3.15Å; V41-R44 WeakPolarHBondContact O-CB 3.47Å; V41-R44 PolarHBondContact O-N 3.06Å; V41-K45 PolarHBondContact O-N 3.41Å
42	N	93.3	Very high	94	Very high	75 Å²	75	105.8 Å²	105.8	40%	0.401	51%	0.511	S	S	.	.	H	α-helix	trans	-67.7	-41	176.1	-72.7	-16.4	0	0	0	112.1	K38 S39 L40 R44 K45 I46	K38-N42 PolarHBondContact O-N 2.98Å; K38-N42 VanDerWaalsContact O-N 3.15Å; S39-N42 WeakPolarHBondContact O-CB 3.47Å; S39-N42 PolarHBondContact O-N 2.95Å; S39-N42 VanDerWaalsContact O-N 3.14Å; L40-N42 VanDerWaalsContact C-N 3.3Å; L40-N42 PolarHBondContact O-N 3.41Å; N42-R44 VanDerWaalsContact C-N 3.3Å; N42-R44 PolarHBondContact O-N 3.06Å; N42-K45 WeakPolarHBondContact O-CB 3.49Å; N42-K45 PolarHBondContact O-N 3.43Å; N42-K45 VanDerWaalsContact O-N 3.09Å; N42-I46 WeakPolarHBondContact O-CG1 3.46Å; N42-I46 PolarHBondContact O-N 3.39Å
43	L	92.9	Very high	93.9	Very high	82 Å²	82	103.9 Å²	103.9	43%	0.429	51%	0.505	S	S	.	.	H	α-helix	trans	-58.7	-43.2	173.5	-74.3	172.3	0	0	0	111.1	S39 L40 K45 I46 F47	S39-L43 WeakPolarHBondContact O-CG 3.46Å; S39-L43 PolarHBondContact O-N 3.29Å; L40-L43 HydrophobicContact CD2-CD1 4.34Å; L40-L43 PolarHBondContact O-N 3.12Å; L43-K45 VanDerWaalsContact C-N 3.26Å; L43-K45 PolarHBondContact O-N 2.88Å; L43-I46 HydrophobicContact CD2-CD1 4.47Å; L43-I46 WeakPolarHBondContact O-CB 3.13Å; L43-I46 PolarHBondContact O-N 3.3Å; L43-F47 HydrophobicContact CB-CE2 4.39Å; L43-F47 WeakPolarHBondContact O-CD2 3.39Å; L43-F47 PolarHBondContact O-N 3.27Å
44	R	93.9	Very high	93.9	Very high	201 Å²	201	102.5 Å²	102.5	76%	0.758	50%	0.504	S	S	*	.	H	α-helix	trans	-57.2	-39.3	174.8	-173.5	179.6	178.5	-173.2	-0.3	112.3	L40 V41 N42 F47 H48	L40-R44 PolarHBondContact O-N 3.43Å; V41-R44 WeakPolarHBondContact O-CB 3.47Å; V41-R44 PolarHBondContact O-N 3.06Å; N42-R44 VanDerWaalsContact C-N 3.3Å; N42-R44 PolarHBondContact O-N 3.06Å; R44-F47 PolarHBondContact O-N 3.3Å; R44-H48 WeakPolarHBondContact O-CB 3.34Å; R44-H48 PolarHBondContact O-N 2.89Å
45	K	92.6	Very high	93.8	Very high	129 Å²	129	99.8 Å²	99.8	56%	0.561	50%	0.497	S	S	*	.	H	α-helix	trans	-64.7	-41.9	174.8	-67.4	176.6	-179.4	177.5	0	111.7	V41 N42 L43 H48 V49	V41-K45 PolarHBondContact O-N 3.41Å; N42-K45 WeakPolarHBondContact O-CB 3.49Å; N42-K45 PolarHBondContact O-N 3.43Å; N42-K45 VanDerWaalsContact O-N 3.09Å; L43-K45 VanDerWaalsContact C-N 3.26Å; L43-K45 PolarHBondContact O-N 2.88Å; K45-H48 PolarHBondContact O-N 3.31Å; K45-V49 WeakPolarHBondContact O-CG2 3.41Å; K45-V49 PolarHBondContact O-N 3.4Å
46	I	93.5	Very high	93.8	Very high	95 Å²	95	100.6 Å²	100.6	49%	0.487	50%	0.497	S	S	.	.	H	α-helix	trans	-61.9	-45.7	176.4	-62.8	170.7	0	0	0	110.2	N42 L43 H48 V49 N50	N42-I46 WeakPolarHBondContact O-CG1 3.46Å; N42-I46 PolarHBondContact O-N 3.39Å; L43-I46 HydrophobicContact CD2-CD1 4.47Å; L43-I46 WeakPolarHBondContact O-CB 3.13Å; L43-I46 PolarHBondContact O-N 3.3Å; I46-H48 VanDerWaalsContact C-N 3.32Å; I46-H48 PolarHBondContact O-N 3.09Å; I46-V49 PolarHBondContact O-N 2.68Å; I46-N50 WeakPolarHBondContact O-CB 3.38Å; I46-N50 VanDerWaalsContact O-CG 3.27Å; I46-N50 PolarHBondContact O-N 2.98Å
47	F	93	Very high	93.7	Very high	143 Å²	143	100.3 Å²	100.3	63%	0.627	50%	0.499	S	S	*	.	H	α-helix	trans	-59.4	-42	175.4	-77.3	-64.7	0	0	0	112.4	L43 R44 N50 E51	L43-F47 HydrophobicContact CB-CE2 4.39Å; L43-F47 WeakPolarHBondContact O-CD2 3.39Å; L43-F47 PolarHBondContact O-N 3.27Å; R44-F47 PolarHBondContact O-N 3.3Å; F47-N50 PolarHBondContact O-N 2.87Å; F47-E51 WeakPolarHBondContact O-CB 3.46Å; F47-E51 PolarHBondContact O-N 3.19Å
48	H	92.6	Very high	93.7	Very high	111 Å²	111	101 Å²	101	51%	0.514	50%	0.503	S	S	.	.	H	α-helix	trans	-64.3	-43	177.9	-173	-89.8	0	0	0	112.5	R44 K45 I46 N50 E51 I52	R44-H48 WeakPolarHBondContact O-CB 3.34Å; R44-H48 PolarHBondContact O-N 2.89Å; K45-H48 PolarHBondContact O-N 3.31Å; I46-H48 VanDerWaalsContact C-N 3.32Å; I46-H48 PolarHBondContact O-N 3.09Å; H48-N50 VanDerWaalsContact C-N 3.35Å; H48-E51 PolarHBondContact O-N 3.02Å; H48-I52 WeakPolarHBondContact O-CG1 3.5Å; H48-I52 PolarHBondContact O-N 3.47Å; H48-I52 VanDerWaalsContact O-N 3.09Å
49	V	93	Very high	93.7	Very high	83 Å²	83	100.4 Å²	100.4	50%	0.503	51%	0.505	S	S	.	.	H	α-helix	trans	-63.4	-44	174.5	174.4	0	0	0	0	110.4	K45 I46 E51 I52 V53	K45-V49 WeakPolarHBondContact O-CG2 3.41Å; K45-V49 PolarHBondContact O-N 3.4Å; I46-V49 PolarHBondContact O-N 2.68Å; V49-E51 VanDerWaalsContact C-N 3.32Å; V49-E51 PolarHBondContact O-N 3.38Å; V49-I52 WeakPolarHBondContact O-CB 3.48Å; V49-I52 PolarHBondContact O-N 3.48Å; V49-V53 HydrophobicContact CG1-CG2 4.44Å; V49-V53 WeakPolarHBondContact O-CG2 3.19Å; V49-V53 PolarHBondContact O-N 3.39Å
50	N	92.3	Very high	93.7	Very high	84 Å²	84	102.5 Å²	102.5	45%	0.449	51%	0.512	S	S	.	.	H	α-helix	trans	-60.2	-41.6	177	-74.2	-8.2	0	0	0	111.9	I46 F47 H48 I52 V53 V54	I46-N50 WeakPolarHBondContact O-CB 3.38Å; I46-N50 VanDerWaalsContact O-CG 3.27Å; I46-N50 PolarHBondContact O-N 2.98Å; F47-N50 PolarHBondContact O-N 2.87Å; H48-N50 VanDerWaalsContact C-N 3.35Å; N50-I52 VanDerWaalsContact C-N 3.35Å; N50-I52 PolarHBondContact O-N 3.19Å; N50-V53 PolarHBondContact O-N 3.27Å; N50-V54 WeakPolarHBondContact O-CG2 3.46Å; N50-V54 PolarHBondContact O-N 3.4Å
51	E	93.5	Very high	93.8	Very high	98 Å²	98	102.4 Å²	102.4	46%	0.458	51%	0.514	S	S	.	.	H	α-helix	trans	-61	-43.3	175.8	-169.5	-169	159.9	0	0	111.7	F47 H48 V49 V54 K55	F47-E51 WeakPolarHBondContact O-CB 3.46Å; F47-E51 PolarHBondContact O-N 3.19Å; H48-E51 PolarHBondContact O-N 3.02Å; V49-E51 VanDerWaalsContact C-N 3.32Å; V49-E51 PolarHBondContact O-N 3.38Å; E51-V54 PolarHBondContact O-N 3.37Å; E51-K55 WeakPolarHBondContact O-CG 3.41Å; E51-K55 PolarHBondContact O-N 2.95Å; E51-K55 WeakPolarHBondContact OE1-CE 3.37Å; E51-K55 IonicContact OE1-NZ 2.68Å; E51-K55 PolarHBondContact OE1-NZ 2.92Å
52	I	94.7	Very high	93.9	Very high	70 Å²	70	104.8 Å²	104.8	36%	0.359	52%	0.518	S	S	.	.	H	α-helix	trans	-61	-46.3	175.6	-68.1	167.5	0	0	0	110.4	H48 V49 N50 V54 K55 H56	H48-I52 WeakPolarHBondContact O-CG1 3.5Å; H48-I52 PolarHBondContact O-N 3.47Å; H48-I52 VanDerWaalsContact O-N 3.09Å; V49-I52 WeakPolarHBondContact O-CB 3.48Å; V49-I52 PolarHBondContact O-N 3.48Å; N50-I52 VanDerWaalsContact C-N 3.35Å; N50-I52 PolarHBondContact O-N 3.19Å; I52-V54 PolarHBondContact O-N 3.26Å; I52-K55 PolarHBondContact O-N 2.98Å; I52-H56 VanDerWaalsContact CG2-CE1 3.46Å; I52-H56 WeakPolarHBondContact CG2-CE1 3.37Å; I52-H56 WeakPolarHBondContact CG2-ND1 3.49Å; I52-H56 PolarHBondContact O-N 3Å; I52-H56 PolarHBondContact O-ND1 3.09Å
53	V	93.9	Very high	93.9	Very high	78 Å²	78	104.5 Å²	104.5	47%	0.473	52%	0.519	S	S	.	.	H	α-helix	trans	-60.4	-45.8	178.9	172.7	0	0	0	0	110.6	V49 N50 K55 H56 V57	V49-V53 HydrophobicContact CG1-CG2 4.44Å; V49-V53 WeakPolarHBondContact O-CG2 3.19Å; V49-V53 PolarHBondContact O-N 3.39Å; N50-V53 PolarHBondContact O-N 3.27Å; V53-K55 VanDerWaalsContact C-N 3.33Å; V53-K55 PolarHBondContact O-N 3.41Å; V53-H56 PolarHBondContact O-N 3.28Å; V53-H56 VanDerWaalsContact O-N 3.15Å; V53-V57 HydrophobicContact CG1-CG2 4.32Å; V53-V57 WeakPolarHBondContact O-CG2 3.38Å; V53-V57 PolarHBondContact O-N 2.88Å
54	V	95	Very high	93.9	Very high	83 Å²	83	106.5 Å²	106.5	50%	0.503	53%	0.528	S	S	.	.	H	α-helix	trans	-59.6	-43.6	177.7	175.4	0	0	0	0	111.2	N50 E51 I52 H56 V57 M58	N50-V54 WeakPolarHBondContact O-CG2 3.46Å; N50-V54 PolarHBondContact O-N 3.4Å; E51-V54 PolarHBondContact O-N 3.37Å; I52-V54 PolarHBondContact O-N 3.26Å; V54-H56 VanDerWaalsContact C-N 3.35Å; V54-H56 PolarHBondContact O-N 2.88Å; V54-V57 PolarHBondContact O-N 3.23Å; V54-M58 HydrophobicContact CG1-CE 4.14Å; V54-M58 WeakPolarHBondContact O-CG 3.47Å; V54-M58 PolarHBondContact O-N 3.33Å
55	K	94.5	Very high	93.8	Very high	114 Å²	114	101.9 Å²	101.9	50%	0.496	52%	0.515	S	S	.	.	H	α-helix	trans	-59.8	-42.8	175.1	-75.2	174.2	-178.7	164.6	0	112.4	E51 I52 V53 M58 L59	E51-K55 WeakPolarHBondContact O-CG 3.41Å; E51-K55 PolarHBondContact O-N 2.95Å; E51-K55 WeakPolarHBondContact OE1-CE 3.37Å; E51-K55 IonicContact OE1-NZ 2.68Å; E51-K55 PolarHBondContact OE1-NZ 2.92Å; I52-K55 PolarHBondContact O-N 2.98Å; V53-K55 VanDerWaalsContact C-N 3.33Å; V53-K55 PolarHBondContact O-N 3.41Å; K55-M58 HydrophobicContact CG-CE 4.25Å; K55-M58 PolarHBondContact O-N 2.9Å; K55-L59 WeakPolarHBondContact O-CB 3.49Å; K55-L59 PolarHBondContact O-N 3.15Å
56	H	94.4	Very high	93.8	Very high	128 Å²	128	98 Å²	98	59%	0.593	50%	0.502	S	S	*	.	H	α-helix	trans	-66.5	-41.6	178	-76.5	78.8	0	0	0	112.2	I52 V53 V54 L59 L60	I52-H56 VanDerWaalsContact CG2-CE1 3.46Å; I52-H56 WeakPolarHBondContact CG2-CE1 3.37Å; I52-H56 WeakPolarHBondContact CG2-ND1 3.49Å; I52-H56 PolarHBondContact O-N 3Å; I52-H56 PolarHBondContact O-ND1 3.09Å; V53-H56 PolarHBondContact O-N 3.28Å; V53-H56 VanDerWaalsContact O-N 3.15Å; V54-H56 VanDerWaalsContact C-N 3.35Å; V54-H56 PolarHBondContact O-N 2.88Å; H56-L59 PolarHBondContact O-N 3.01Å; H56-L60 WeakPolarHBondContact O-CB 3.45Å; H56-L60 PolarHBondContact O-N 3.35Å
57	V	94.5	Very high	93.6	Very high	84 Å²	84	99 Å²	99	51%	0.509	50%	0.503	S	S	.	.	H	α-helix	trans	-62.6	-44.5	175.9	174.6	0	0	0	0	110.5	V53 V54 L59 L60 V61	V53-V57 HydrophobicContact CG1-CG2 4.32Å; V53-V57 WeakPolarHBondContact O-CG2 3.38Å; V53-V57 PolarHBondContact O-N 2.88Å; V54-V57 PolarHBondContact O-N 3.23Å; V57-L59 VanDerWaalsContact C-N 3.31Å; V57-L59 PolarHBondContact O-N 2.78Å; V57-L60 PolarHBondContact O-N 2.93Å; V57-V61 HydrophobicContact CG1-CG2 4.41Å; V57-V61 WeakPolarHBondContact O-CG2 3.37Å; V57-V61 PolarHBondContact O-N 3.43Å
58	M	94.9	Very high	93.4	Very high	115 Å²	115	94.8 Å²	94.8	57%	0.567	49%	0.494	S	S	*	.	H	α-helix	trans	-59.8	-42.1	175.7	-72.9	-169.5	-63.7	0	0	112.1	V54 K55 V61 F62	V54-M58 HydrophobicContact CG1-CE 4.14Å; V54-M58 WeakPolarHBondContact O-CG 3.47Å; V54-M58 PolarHBondContact O-N 3.33Å; K55-M58 HydrophobicContact CG-CE 4.25Å; K55-M58 PolarHBondContact O-N 2.9Å; M58-V61 PolarHBondContact O-N 2.91Å; M58-F62 WeakPolarHBondContact O-CB 3.33Å; M58-F62 PolarHBondContact O-N 3.44Å
59	L	94.4	Very high	93.3	Very high	113 Å²	113	93.9 Å²	93.9	59%	0.592	49%	0.49	S	S	*	.	H	α-helix	trans	-64.8	-41.3	177.3	-172.1	139.7	0	0	0	111.6	K55 H56 V57 F62 T63	K55-L59 WeakPolarHBondContact O-CB 3.49Å; K55-L59 PolarHBondContact O-N 3.15Å; H56-L59 PolarHBondContact O-N 3.01Å; V57-L59 VanDerWaalsContact C-N 3.31Å; V57-L59 PolarHBondContact O-N 2.78Å; L59-F62 PolarHBondContact O-N 3.42Å; L59-T63 HydrophobicContact CD2-CG2 4.21Å; L59-T63 WeakPolarHBondContact O-CG2 3.39Å; L59-T63 PolarHBondContact O-N 3.26Å; L59-T63 PolarHBondContact O-OG1 3.46Å
60	L	94.8	Very high	92.9	Very high	95 Å²	95	98.4 Å²	98.4	50%	0.497	50%	0.498	S	S	.	.	H	α-helix	trans	-64	-40.7	175.4	-175.5	142.3	0	0	0	112.1	H56 V57 F62 T63 M64	H56-L60 WeakPolarHBondContact O-CB 3.45Å; H56-L60 PolarHBondContact O-N 3.35Å; V57-L60 PolarHBondContact O-N 2.93Å; L60-F62 VanDerWaalsContact C-N 3.33Å; L60-T63 WeakPolarHBondContact CA-OG1 3.3Å; L60-T63 PolarHBondContact O-N 3.18Å; L60-T63 PolarHBondContact O-OG1 3.46Å; L60-M64 HydrophobicContact CD2-CE 4.26Å; L60-M64 HydrophobicContact CD2-CG 4.19Å; L60-M64 WeakPolarHBondContact O-CB 3.14Å; L60-M64 WeakPolarHBondContact O-CG 3.36Å; L60-M64 PolarHBondContact O-N 2.86Å
61	V	94.8	Very high	92.5	Very high	86 Å²	86	102 Å²	102	52%	0.521	51%	0.506	S	S	.	.	H	α-helix	trans	-63.8	-41.9	174.1	171.5	0	0	0	0	110.5	V57 M58 M64 H65	V57-V61 HydrophobicContact CG1-CG2 4.41Å; V57-V61 WeakPolarHBondContact O-CG2 3.37Å; V57-V61 PolarHBondContact O-N 3.43Å; M58-V61 PolarHBondContact O-N 2.91Å; V61-M64 PolarHBondContact O-N 3.36Å; V61-H65 VanDerWaalsContact O-CB 3.3Å; V61-H65 WeakPolarHBondContact O-CB 3.38Å; V61-H65 PolarHBondContact O-N 3.26Å
62	F	95	Very high	91.8	Very high	134 Å²	134	100.4 Å²	100.4	59%	0.588	51%	0.505	S	S	*	.	H	α-helix	trans	-64.3	-42.5	177.4	-176.3	-98.3	0	0	0	112.5	M58 L59 L60 H65 T66	M58-F62 WeakPolarHBondContact O-CB 3.33Å; M58-F62 PolarHBondContact O-N 3.44Å; L59-F62 PolarHBondContact O-N 3.42Å; L60-F62 VanDerWaalsContact C-N 3.33Å; F62-H65 PolarHBondContact O-N 3.44Å; F62-T66 HydrophobicContact CD1-CG2 4.33Å; F62-T66 HydrophobicContact CE1-CG2 3.91Å; F62-T66 HydrophobicContact CE2-CG2 4.32Å; F62-T66 HydrophobicContact CZ-CG2 3.9Å; F62-T66 WeakPolarHBondContact O-CG2 3.28Å; F62-T66 PolarHBondContact O-N 2.89Å; F62-T66 PolarHBondContact O-OG1 3.31Å
63	T	94.2	Very high	91	Very high	69 Å²	69	105.3 Å²	105.3	42%	0.423	52%	0.521	S	S	.	.	H	α-helix	trans	-67.1	-40.5	176	56.4	0	0	0	0	111.9	L59 L60 T66 F67	L59-T63 HydrophobicContact CD2-CG2 4.21Å; L59-T63 WeakPolarHBondContact O-CG2 3.39Å; L59-T63 PolarHBondContact O-N 3.26Å; L59-T63 PolarHBondContact O-OG1 3.46Å; L60-T63 WeakPolarHBondContact CA-OG1 3.3Å; L60-T63 PolarHBondContact O-N 3.18Å; L60-T63 PolarHBondContact O-OG1 3.46Å; T63-T66 WeakPolarHBondContact CA-OG1 3.38Å; T63-T66 PolarHBondContact O-OG1 3.24Å; T63-F67 VanDerWaalsContact O-CB 3.28Å; T63-F67 WeakPolarHBondContact O-CB 3.45Å; T63-F67 PolarHBondContact O-N 2.93Å
64	M	93.3	Very high	90.1	Very high	124 Å²	124	108.5 Å²	108.5	61%	0.611	53%	0.528	S	S	*	.	H	α-helix	trans	-59.8	-45.2	172.1	-72.8	-89.3	-174.6	0	0	111.7	L60 V61 F67 A68	L60-M64 HydrophobicContact CD2-CE 4.26Å; L60-M64 HydrophobicContact CD2-CG 4.19Å; L60-M64 WeakPolarHBondContact O-CB 3.14Å; L60-M64 WeakPolarHBondContact O-CG 3.36Å; L60-M64 PolarHBondContact O-N 2.86Å; V61-M64 PolarHBondContact O-N 3.36Å; M64-F67 PolarHBondContact O-N 2.95Å; M64-A68 WeakPolarHBondContact O-CB 3.09Å; M64-A68 PolarHBondContact O-N 2.89Å
65	H	92	Very high	89.1	Confident	103 Å²	103	111.4 Å²	111.4	48%	0.477	54%	0.541	S	S	.	.	H	α-helix	trans	-64.4	-47.9	-179.7	-176.7	-91.8	0	0	0	112	V61 F62 F67 A68 Q69	V61-H65 VanDerWaalsContact O-CB 3.3Å; V61-H65 WeakPolarHBondContact O-CB 3.38Å; V61-H65 PolarHBondContact O-N 3.26Å; F62-H65 PolarHBondContact O-N 3.44Å; H65-F67 VanDerWaalsContact C-N 3.32Å; H65-F67 PolarHBondContact O-N 2.96Å; H65-A68 PolarHBondContact O-N 2.92Å; H65-Q69 PolarHBondContact CE1-NE2 3.27Å; H65-Q69 PolarHBondContact ND1-OE1 2.97Å; H65-Q69 WeakPolarHBondContact O-CG 3.45Å; H65-Q69 PolarHBondContact O-N 2.94Å
66	T	90.6	Very high	87.8	Confident	49 Å²	49	115.9 Å²	115.9	30%	0.301	56%	0.556	S	S	.	*	H	α-helix	trans	-62.8	-38.3	176.6	49.3	0	0	0	0	112.4	F62 T63 R70	F62-T66 HydrophobicContact CD1-CG2 4.33Å; F62-T66 HydrophobicContact CE1-CG2 3.91Å; F62-T66 HydrophobicContact CE2-CG2 4.32Å; F62-T66 HydrophobicContact CZ-CG2 3.9Å; F62-T66 WeakPolarHBondContact O-CG2 3.28Å; F62-T66 PolarHBondContact O-N 2.89Å; F62-T66 PolarHBondContact O-OG1 3.31Å; T63-T66 WeakPolarHBondContact CA-OG1 3.38Å; T63-T66 PolarHBondContact O-OG1 3.24Å; T66-R70 WeakPolarHBondContact O-CG 3.41Å; T66-R70 PolarHBondContact O-N 3.28Å
67	F	90.3	Very high	85.9	Confident	116 Å²	116	120.3 Å²	120.3	51%	0.509	58%	0.577	S	S	.	*	H	α-helix	trans	-66.3	-42.5	174.3	-174.8	-101.3	0	0	0	112.2	T63 M64 H65 R70 R71	T63-F67 VanDerWaalsContact O-CB 3.28Å; T63-F67 WeakPolarHBondContact O-CB 3.45Å; T63-F67 PolarHBondContact O-N 2.93Å; M64-F67 PolarHBondContact O-N 2.95Å; H65-F67 VanDerWaalsContact C-N 3.32Å; H65-F67 PolarHBondContact O-N 2.96Å; F67-R70 PolarHBondContact O-N 3.02Å; F67-R71 HydrophobicContact CE1-CG 4.28Å; F67-R71 VanDerWaalsContact CE1-CZ 3.47Å; F67-R71 VanDerWaalsContact CE1-NE 3.3Å; F67-R71 HydrophobicContact CZ-CG 4.47Å; F67-R71 PolarHBondContact O-N 3.13Å
68	A	89.2	Confident	85.5	Confident	53 Å²	53	122.1 Å²	122.1	44%	0.438	58%	0.58	S	S	.	*	H	α-helix	trans	-62.2	-45.6	175.8	0	0	0	0	0	111.6	M64 H65 R70 R71 S72	M64-A68 WeakPolarHBondContact O-CB 3.09Å; M64-A68 PolarHBondContact O-N 2.89Å; H65-A68 PolarHBondContact O-N 2.92Å; A68-R70 PolarHBondContact O-N 3.47Å; A68-R71 PolarHBondContact O-N 3Å; A68-S72 PolarHBondContact O-N 3.4Å; A68-S72 PolarHBondContact O-OG 2.99Å
69	Q	89.1	Confident	85	Confident	93 Å²	93	122.5 Å²	122.5	44%	0.435	58%	0.581	S	S	.	*	H	α-helix	trans	-58.5	-47.4	174.8	-74.4	-176.7	-42.7	0	0	111.6	H65 R71 S72 Y73	H65-Q69 PolarHBondContact CE1-NE2 3.27Å; H65-Q69 PolarHBondContact ND1-OE1 2.97Å; H65-Q69 WeakPolarHBondContact O-CG 3.45Å; H65-Q69 PolarHBondContact O-N 2.94Å; Q69-R71 VanDerWaalsContact C-N 3.34Å; Q69-R71 PolarHBondContact O-N 2.87Å; Q69-S72 WeakPolarHBondContact O-CB 3.18Å; Q69-S72 PolarHBondContact O-N 3.06Å; Q69-S72 VanDerWaalsContact O-N 3.13Å; Q69-Y73 WeakPolarHBondContact O-CD2 3.31Å; Q69-Y73 PolarHBondContact O-N 3.36Å
70	R	85.3	Confident	84.5	Confident	178 Å²	178	123 Å²	123	67%	0.672	58%	0.581	S	S	*	*	H	α-helix	trans	-59.1	-42.4	176.6	-78.6	-166.2	179.7	-154.1	1.3	112.6	T66 F67 A68 S72 Y73 F74	T66-R70 WeakPolarHBondContact O-CG 3.41Å; T66-R70 PolarHBondContact O-N 3.28Å; F67-R70 PolarHBondContact O-N 3.02Å; A68-R70 PolarHBondContact O-N 3.47Å; R70-S72 VanDerWaalsContact C-N 3.32Å; R70-S72 PolarHBondContact O-N 3.4Å; R70-Y73 PolarHBondContact O-N 3.01Å; R70-F74 VanDerWaalsContact O-CD2 3.31Å; R70-F74 WeakPolarHBondContact O-CD2 3.33Å; R70-F74 PolarHBondContact O-N 3.47Å
71	R	83.6	Confident	83.9	Confident	159 Å²	159	124.6 Å²	124.6	60%	0.6	59%	0.585	S	S	*	*	H	α-helix	trans	-61.2	-39.8	174.6	-86.7	-169.1	175.8	174	1.2	112.5	F67 A68 Q69 F74 N75	F67-R71 HydrophobicContact CE1-CG 4.28Å; F67-R71 VanDerWaalsContact CE1-CZ 3.47Å; F67-R71 VanDerWaalsContact CE1-NE 3.3Å; F67-R71 HydrophobicContact CZ-CG 4.47Å; F67-R71 PolarHBondContact O-N 3.13Å; A68-R71 PolarHBondContact O-N 3Å; Q69-R71 VanDerWaalsContact C-N 3.34Å; Q69-R71 PolarHBondContact O-N 2.87Å; R71-F74 PolarHBondContact O-N 3.39Å; R71-N75 PolarHBondContact O-N 3.19Å
72	S	79.6	Confident	83.2	Confident	64 Å²	64	127.1 Å²	127.1	45%	0.448	59%	0.589	S	S	.	*	H	α-helix	trans	-61.4	-47	174.8	-62.5	0	0	0	0	111.1	A68 Q69 R70 F74 N75 Y76	A68-S72 PolarHBondContact O-N 3.4Å; A68-S72 PolarHBondContact O-OG 2.99Å; Q69-S72 WeakPolarHBondContact O-CB 3.18Å; Q69-S72 PolarHBondContact O-N 3.06Å; Q69-S72 VanDerWaalsContact O-N 3.13Å; R70-S72 VanDerWaalsContact C-N 3.32Å; R70-S72 PolarHBondContact O-N 3.4Å; S72-F74 PolarHBondContact O-N 3.33Å; S72-N75 PolarHBondContact O-N 3.17Å; S72-Y76 WeakPolarHBondContact O-CD2 3.48Å; S72-Y76 PolarHBondContact O-N 3.44Å
73	Y	77.1	Confident	82.4	Confident	174 Å²	174	126.6 Å²	126.6	68%	0.682	59%	0.59	S	S	*	*	H	α-helix	trans	-58.1	-45.6	177.2	-80.5	-75.7	0	0	0	113.1	Q69 R70 N75 Y76	Q69-Y73 WeakPolarHBondContact O-CD2 3.31Å; Q69-Y73 PolarHBondContact O-N 3.36Å; R70-Y73 PolarHBondContact O-N 3.01Å; Y73-N75 VanDerWaalsContact C-N 3.27Å; Y73-N75 PolarHBondContact O-N 3.2Å; Y73-Y76 PolarHBondContact O-N 3.49Å
74	F	74.5	Confident	81.6	Confident	145 Å²	145	130.7 Å²	130.7	64%	0.636	60%	0.601	S	S	*	*	H	α-helix	trans	-66.5	-23.8	178	-84.8	-70.1	0	0	0	114.4	R70 R71 S72 Y76	R70-F74 VanDerWaalsContact O-CD2 3.31Å; R70-F74 WeakPolarHBondContact O-CD2 3.33Å; R70-F74 PolarHBondContact O-N 3.47Å; R71-F74 PolarHBondContact O-N 3.39Å; S72-F74 PolarHBondContact O-N 3.33Å; F74-Y76 VanDerWaalsContact C-N 3.34Å
75	N	74.6	Confident	80.7	Confident	143 Å²	143	131.2 Å²	131.2	77%	0.765	60%	0.601	S	S	*	*	H	α-helix	trans	-84.1	-9.6	176.7	-78.9	-2.6	0	0	0	113.1	R71 S72 Y73	R71-N75 PolarHBondContact O-N 3.19Å; S72-N75 PolarHBondContact O-N 3.17Å; Y73-N75 VanDerWaalsContact C-N 3.27Å; Y73-N75 PolarHBondContact O-N 3.2Å
76	Y	68.2	Low	79.8	Confident	209 Å²	209	133.6 Å²	133.6	82%	0.82	61%	0.611	S	S	*	*	H	α-helix	trans	-98.4	-10.9	176.3	-78.6	-70.9	0	0	0	113.4	S72 Y73 F74	S72-Y76 WeakPolarHBondContact O-CD2 3.48Å; S72-Y76 PolarHBondContact O-N 3.44Å; Y73-Y76 PolarHBondContact O-N 3.49Å; F74-Y76 VanDerWaalsContact C-N 3.34Å
77	E	54.9	Low	78.8	Confident	220 Å²	220	141.3 Å²	141.3	100%	1.028	64%	0.639	S	S	*	*			trans	-91.8	0	166.8	-72.4	-174.6	155.5	0	0	110.8

Retrieved 77 of 77 residues in 39.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).