G4V5G1_SCHMA Loading...

Mitochondrial import inner membrane translocase subunit

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.

AlphaFold DB , UniProt , Accession G4V5G1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 86 aa.

						>G4V5G1_SCHMA|G4V5G1
MSTKSDKAVERQMQMFEIEMMQQVFTSMTSSCLAKCIPSNYNDGDLTKGEAVCLDRCASKFMQAYMQTTKKLSTMASSDSKVVTGN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56	Low	82.8	Confident	215 Å²	215	113.5 Å²	113.5	100%	1.059	59%	0.592	S	S	*	*				0	-31.4	0	-77.9	154.8	79.3	0	0	112.5	T3	M1-T3 PolarHBondContact O-N 3.42Å
2	S	63.6	Low	83.8	Confident	88 Å²	88	115.5 Å²	115.5	62%	0.615	60%	0.596	S	S	*	*	H	α-helix	trans	-59.3	-41	-178.5	-39.1	0	0	0	0	115.1	K4 S5 D6	S2-K4 VanDerWaalsContact C-N 3.29Å; S2-K4 PolarHBondContact O-N 3.18Å; S2-S5 WeakPolarHBondContact O-CB 3.42Å; S2-S5 PolarHBondContact O-N 3.35Å; S2-D6 PolarHBondContact O-N 3.18Å
3	T	74.4	Confident	84.6	Confident	102 Å²	102	116.3 Å²	116.3	63%	0.626	60%	0.598	S	S	*	*	H	α-helix	trans	-64.9	-24.8	-175.2	58.2	0	0	0	0	115.3	M1 D6 K7	M1-T3 PolarHBondContact O-N 3.42Å; T3-D6 WeakPolarHBondContact CA-OD2 3.47Å; T3-K7 PolarHBondContact O-N 3.02Å
4	K	77.8	Confident	85.5	Confident	176 Å²	176	114.8 Å²	114.8	77%	0.765	59%	0.587	S	S	*	*	H	α-helix	trans	-70.6	-36.6	174.3	-79.6	-169.3	178.2	-175.8	0	111.1	S2 A8	S2-K4 VanDerWaalsContact C-N 3.29Å; S2-K4 PolarHBondContact O-N 3.18Å; K4-A8 PolarHBondContact O-N 2.92Å
5	S	84.6	Confident	86.2	Confident	74 Å²	74	116.2 Å²	116.2	52%	0.517	59%	0.592	S	S	.	*	H	α-helix	trans	-69.2	-43.6	176.4	-59.4	0	0	0	0	110.9	S2 K7 A8 V9	S2-S5 WeakPolarHBondContact O-CB 3.42Å; S2-S5 PolarHBondContact O-N 3.35Å; S5-K7 PolarHBondContact O-N 3.14Å; S5-A8 WeakPolarHBondContact O-CB 3.4Å; S5-A8 PolarHBondContact O-N 3.32Å; S5-V9 WeakPolarHBondContact O-CG2 3.47Å; S5-V9 PolarHBondContact O-N 3.41Å
6	D	88.6	Confident	86.8	Confident	101 Å²	101	116.6 Å²	116.6	54%	0.54	59%	0.589	S	S	.	*	H	α-helix	trans	-57.6	-46.5	179.4	-56.5	-35.4	0	0	0	111.9	S2 T3 A8 V9 E10	S2-D6 PolarHBondContact O-N 3.18Å; T3-D6 WeakPolarHBondContact CA-OD2 3.47Å; D6-A8 VanDerWaalsContact C-N 3.32Å; D6-A8 PolarHBondContact O-N 2.93Å; D6-V9 PolarHBondContact O-N 3.04Å; D6-E10 PolarHBondContact O-N 3.24Å
7	K	91.9	Very high	87.4	Confident	131 Å²	131	116.9 Å²	116.9	57%	0.57	59%	0.588	S	S	*	*	H	α-helix	trans	-66.2	-30.9	175.9	-72.2	-173.9	176	-174.4	0	113.7	T3 S5 R11	T3-K7 PolarHBondContact O-N 3.02Å; S5-K7 PolarHBondContact O-N 3.14Å; K7-R11 WeakPolarHBondContact O-CG 3.41Å; K7-R11 PolarHBondContact O-N 3.36Å; K7-R11 VanDerWaalsContact O-N 3.14Å
8	A	92.6	Very high	88	Confident	45 Å²	45	116.8 Å²	116.8	37%	0.372	59%	0.588	S	S	.	*	H	α-helix	trans	-71.3	-40.9	176.8	0	0	0	0	0	110.8	K4 S5 D6 R11 Q12	K4-A8 PolarHBondContact O-N 2.92Å; S5-A8 WeakPolarHBondContact O-CB 3.4Å; S5-A8 PolarHBondContact O-N 3.32Å; D6-A8 VanDerWaalsContact C-N 3.32Å; D6-A8 PolarHBondContact O-N 2.93Å; A8-R11 PolarHBondContact O-N 3.21Å; A8-Q12 WeakPolarHBondContact O-CB 3.46Å; A8-Q12 PolarHBondContact O-N 2.99Å
9	V	92.5	Very high	88.5	Confident	67 Å²	67	116.4 Å²	116.4	41%	0.406	58%	0.584	S	S	.	*	H	α-helix	trans	-63.6	-45.7	173.9	174.2	0	0	0	0	110.7	S5 D6 R11 Q12 M13	S5-V9 WeakPolarHBondContact O-CG2 3.47Å; S5-V9 PolarHBondContact O-N 3.41Å; D6-V9 PolarHBondContact O-N 3.04Å; V9-R11 PolarHBondContact O-N 3.4Å; V9-Q12 WeakPolarHBondContact O-CB 3.37Å; V9-Q12 PolarHBondContact O-N 2.93Å; V9-Q12 VanDerWaalsContact O-N 3.12Å; V9-M13 HydrophobicContact CG1-CE 3.66Å; V9-M13 HydrophobicContact CG1-SD 4.24Å; V9-M13 WeakPolarHBondContact O-CG 3.37Å; V9-M13 PolarHBondContact O-N 3.12Å
10	E	93.6	Very high	88.8	Confident	108 Å²	108	114.3 Å²	114.3	51%	0.505	57%	0.573	S	S	.	*	H	α-helix	trans	-57.6	-47.6	176.8	-174.5	-175.5	175.5	0	0	112	D6 Q12 M13 Q14	D6-E10 PolarHBondContact O-N 3.24Å; E10-Q12 VanDerWaalsContact C-N 3.3Å; E10-Q12 PolarHBondContact O-N 3.43Å; E10-M13 PolarHBondContact O-N 3.49Å; E10-Q14 WeakPolarHBondContact O-CG 3.3Å; E10-Q14 PolarHBondContact O-N 2.95Å
11	R	94.8	Very high	89.2	Confident	141 Å²	141	115 Å²	115	53%	0.532	58%	0.576	S	S	.	*	H	α-helix	trans	-62.1	-38.2	175.5	-75.5	-167.9	-61.2	-97.4	-1.1	112.5	K7 A8 V9 M13 Q14 M15	K7-R11 WeakPolarHBondContact O-CG 3.41Å; K7-R11 PolarHBondContact O-N 3.36Å; K7-R11 VanDerWaalsContact O-N 3.14Å; A8-R11 PolarHBondContact O-N 3.21Å; V9-R11 PolarHBondContact O-N 3.4Å; R11-M13 VanDerWaalsContact C-N 3.34Å; R11-Q14 PolarHBondContact O-N 3.4Å; R11-M15 VanDerWaalsContact O-CG 3.3Å; R11-M15 WeakPolarHBondContact O-CG 3.37Å; R11-M15 PolarHBondContact O-N 2.94Å
12	Q	94.8	Very high	91.2	Very high	138 Å²	138	109.9 Å²	109.9	65%	0.645	55%	0.55	S	S	*	.	H	α-helix	trans	-64.9	-40.4	176.7	-175.2	172.2	51.4	0	0	111.4	A8 V9 E10 M15 F16	A8-Q12 WeakPolarHBondContact O-CB 3.46Å; A8-Q12 PolarHBondContact O-N 2.99Å; V9-Q12 WeakPolarHBondContact O-CB 3.37Å; V9-Q12 PolarHBondContact O-N 2.93Å; V9-Q12 VanDerWaalsContact O-N 3.12Å; E10-Q12 VanDerWaalsContact C-N 3.3Å; E10-Q12 PolarHBondContact O-N 3.43Å; Q12-M15 PolarHBondContact O-N 3.38Å; Q12-F16 WeakPolarHBondContact O-CB 3.46Å; Q12-F16 PolarHBondContact O-N 2.89Å
13	M	95.2	Very high	92.8	Very high	126 Å²	126	111 Å²	111	62%	0.621	55%	0.545	S	S	*	.	H	α-helix	trans	-63.7	-42.8	174.5	-69.9	177.2	175	0	0	111.8	V9 E10 R11 F16 E17	V9-M13 HydrophobicContact CG1-CE 3.66Å; V9-M13 HydrophobicContact CG1-SD 4.24Å; V9-M13 WeakPolarHBondContact O-CG 3.37Å; V9-M13 PolarHBondContact O-N 3.12Å; E10-M13 PolarHBondContact O-N 3.49Å; R11-M13 VanDerWaalsContact C-N 3.34Å; M13-F16 PolarHBondContact O-N 3.12Å; M13-E17 PolarHBondContact O-N 3.38Å
14	Q	96.3	Very high	93.9	Very high	95 Å²	95	107.3 Å²	107.3	44%	0.444	52%	0.522	S	S	.	.	H	α-helix	trans	-61.3	-44.4	175.3	-71.5	171.9	-23.3	0	0	112	E10 R11 F16 E17 I18	E10-Q14 WeakPolarHBondContact O-CG 3.3Å; E10-Q14 PolarHBondContact O-N 2.95Å; R11-Q14 PolarHBondContact O-N 3.4Å; Q14-F16 VanDerWaalsContact C-N 3.31Å; Q14-F16 PolarHBondContact O-N 3.47Å; Q14-E17 PolarHBondContact O-N 2.93Å; Q14-I18 WeakPolarHBondContact O-CG1 3.41Å; Q14-I18 PolarHBondContact O-N 3.27Å; Q14-I18 VanDerWaalsContact O-N 3.12Å
15	M	96.4	Very high	94.9	Very high	136 Å²	136	104.6 Å²	104.6	67%	0.67	51%	0.511	S	S	*	.	H	α-helix	trans	-62.2	-41.6	176	-73.9	179.6	62.1	0	0	111.8	R11 Q12 I18 E19	R11-M15 VanDerWaalsContact O-CG 3.3Å; R11-M15 WeakPolarHBondContact O-CG 3.37Å; R11-M15 PolarHBondContact O-N 2.94Å; Q12-M15 PolarHBondContact O-N 3.38Å; M15-I18 PolarHBondContact O-N 3.32Å; M15-E19 WeakPolarHBondContact O-CB 3.43Å; M15-E19 PolarHBondContact O-N 2.93Å
16	F	96.2	Very high	95.6	Very high	122 Å²	122	104.5 Å²	104.5	54%	0.535	51%	0.507	S	S	.	.	H	α-helix	trans	-63.6	-42.8	177.7	-178.9	-108.1	0	0	0	112.1	Q12 M13 Q14 I18 E19 M20	Q12-F16 WeakPolarHBondContact O-CB 3.46Å; Q12-F16 PolarHBondContact O-N 2.89Å; M13-F16 PolarHBondContact O-N 3.12Å; Q14-F16 VanDerWaalsContact C-N 3.31Å; Q14-F16 PolarHBondContact O-N 3.47Å; F16-I18 VanDerWaalsContact C-N 3.35Å; F16-I18 PolarHBondContact O-N 3.17Å; F16-E19 PolarHBondContact O-N 3.27Å; F16-M20 HydrophobicContact CD1-CG 4.38Å; F16-M20 HydrophobicContact CD1-SD 3.82Å; F16-M20 HydrophobicContact CE1-CG 4.03Å; F16-M20 HydrophobicContact CE1-SD 3.17Å; F16-M20 WeakPolarHBondContact CE1-SD 3.35Å; F16-M20 HydrophobicContact CE2-CG 4.19Å; F16-M20 HydrophobicContact CE2-SD 4.31Å; F16-M20 HydrophobicContact CZ-CG 3.91Å; F16-M20 HydrophobicContact CZ-SD 3.46Å; F16-M20 WeakPolarHBondContact CZ-SD 3.46Å; F16-M20 WeakPolarHBondContact O-CG 3.46Å; F16-M20 PolarHBondContact O-N 2.92Å
17	E	96.5	Very high	96	Very high	123 Å²	123	103 Å²	103	58%	0.575	50%	0.504	S	S	*	.	H	α-helix	trans	-58.5	-46.3	175.3	-175.4	177.8	-174	0	0	111.6	M13 Q14 M20 M21	M13-E17 PolarHBondContact O-N 3.38Å; Q14-E17 PolarHBondContact O-N 2.93Å; E17-M20 PolarHBondContact O-N 3.25Å; E17-M21 WeakPolarHBondContact O-CG 3.17Å; E17-M21 PolarHBondContact O-N 2.92Å
18	I	97.6	Very high	96.3	Very high	115 Å²	115	98.3 Å²	98.3	59%	0.59	49%	0.485	S	S	*	.	H	α-helix	trans	-62.4	-44.7	177	-66.6	165.7	0	0	0	111.1	Q14 M15 F16 M20 M21 Q22	Q14-I18 WeakPolarHBondContact O-CG1 3.41Å; Q14-I18 PolarHBondContact O-N 3.27Å; Q14-I18 VanDerWaalsContact O-N 3.12Å; M15-I18 PolarHBondContact O-N 3.32Å; F16-I18 VanDerWaalsContact C-N 3.35Å; F16-I18 PolarHBondContact O-N 3.17Å; I18-M20 PolarHBondContact O-N 3.05Å; I18-M21 PolarHBondContact O-N 3.23Å; I18-Q22 WeakPolarHBondContact O-CB 3.36Å; I18-Q22 PolarHBondContact O-N 3.02Å
19	E	97.9	Very high	96.6	Very high	109 Å²	109	98.7 Å²	98.7	51%	0.509	48%	0.482	S	S	.	.	H	α-helix	trans	-61.5	-44.4	179.4	-172.9	-179	171.5	0	0	111.4	M15 F16 M21 Q22 Q23	M15-E19 WeakPolarHBondContact O-CB 3.43Å; M15-E19 PolarHBondContact O-N 2.93Å; F16-E19 PolarHBondContact O-N 3.27Å; E19-M21 PolarHBondContact O-N 3.45Å; E19-Q22 PolarHBondContact O-N 3.05Å; E19-Q23 VanDerWaalsContact O-CG 3.29Å; E19-Q23 WeakPolarHBondContact O-CG 3.29Å; E19-Q23 PolarHBondContact O-N 3.37Å; E19-Q23 PolarHBondContact OE1-NE2 2.95Å
20	M	95.8	Very high	96.9	Very high	73 Å²	73	99.2 Å²	99.2	36%	0.36	49%	0.489	S	S	.	.	H	α-helix	trans	-59.8	-46.4	175.4	-72.6	-175	72	0	0	111.7	F16 E17 I18 Q22 Q23 V24	F16-M20 HydrophobicContact CD1-CG 4.38Å; F16-M20 HydrophobicContact CD1-SD 3.82Å; F16-M20 HydrophobicContact CE1-CG 4.03Å; F16-M20 HydrophobicContact CE1-SD 3.17Å; F16-M20 WeakPolarHBondContact CE1-SD 3.35Å; F16-M20 HydrophobicContact CE2-CG 4.19Å; F16-M20 HydrophobicContact CE2-SD 4.31Å; F16-M20 HydrophobicContact CZ-CG 3.91Å; F16-M20 HydrophobicContact CZ-SD 3.46Å; F16-M20 WeakPolarHBondContact CZ-SD 3.46Å; F16-M20 WeakPolarHBondContact O-CG 3.46Å; F16-M20 PolarHBondContact O-N 2.92Å; E17-M20 PolarHBondContact O-N 3.25Å; I18-M20 PolarHBondContact O-N 3.05Å; M20-Q22 VanDerWaalsContact C-N 3.31Å; M20-Q22 PolarHBondContact O-N 3.3Å; M20-Q23 PolarHBondContact O-N 2.89Å; M20-V24 WeakPolarHBondContact O-CG2 3.35Å; M20-V24 PolarHBondContact O-N 3.43Å
21	M	96.6	Very high	97.1	Very high	129 Å²	129	95.6 Å²	95.6	64%	0.635	48%	0.476	S	S	*	.	H	α-helix	trans	-60.7	-42.3	177	-71.1	-177.4	72.1	0	0	111.6	E17 I18 E19 Q23 V24 F25	E17-M21 WeakPolarHBondContact O-CG 3.17Å; E17-M21 PolarHBondContact O-N 2.92Å; I18-M21 PolarHBondContact O-N 3.23Å; E19-M21 PolarHBondContact O-N 3.45Å; M21-Q23 PolarHBondContact O-N 3.48Å; M21-V24 PolarHBondContact O-N 3.28Å; M21-F25 WeakPolarHBondContact O-CB 3.37Å; M21-F25 PolarHBondContact O-N 3.48Å
22	Q	98.2	Very high	97.3	Very high	109 Å²	109	89.3 Å²	89.3	51%	0.509	45%	0.453	S	S	.	.	H	α-helix	trans	-63	-42.2	177.8	-177.3	60.3	42	0	0	111.9	I18 E19 M20 F25 T26	I18-Q22 WeakPolarHBondContact O-CB 3.36Å; I18-Q22 PolarHBondContact O-N 3.02Å; E19-Q22 PolarHBondContact O-N 3.05Å; M20-Q22 VanDerWaalsContact C-N 3.31Å; M20-Q22 PolarHBondContact O-N 3.3Å; Q22-F25 PolarHBondContact O-N 2.88Å; Q22-T26 PolarHBondContact NE2-OG1 3.4Å; Q22-T26 VanDerWaalsContact O-CB 3.32Å; Q22-T26 WeakPolarHBondContact O-CB 3.34Å; Q22-T26 PolarHBondContact O-N 2.86Å; Q22-T26 PolarHBondContact O-OG1 3.4Å
23	Q	97.5	Very high	97.4	Very high	112 Å²	112	86.4 Å²	86.4	52%	0.523	44%	0.442	S	S	.	.	H	α-helix	trans	-62.5	-46	177.5	-73	173.1	-2.9	0	0	111.4	E19 M20 M21 T26 S27	E19-Q23 VanDerWaalsContact O-CG 3.29Å; E19-Q23 WeakPolarHBondContact O-CG 3.29Å; E19-Q23 PolarHBondContact O-N 3.37Å; E19-Q23 PolarHBondContact OE1-NE2 2.95Å; M20-Q23 PolarHBondContact O-N 2.89Å; M21-Q23 PolarHBondContact O-N 3.48Å; Q23-T26 PolarHBondContact O-N 3.19Å; Q23-S27 VanDerWaalsContact O-CB 3.26Å; Q23-S27 WeakPolarHBondContact O-CB 3.47Å; Q23-S27 PolarHBondContact O-N 3.22Å
24	V	97.5	Very high	97.5	Very high	24 Å²	24	84.5 Å²	84.5	15%	0.145	45%	0.446	C	S	.	.	H	α-helix	trans	-61.1	-47.4	176.6	174.9	0	0	0	0	110.7	M20 M21 S27 M28 F61 M62 Y65	M20-V24 WeakPolarHBondContact O-CG2 3.35Å; M20-V24 PolarHBondContact O-N 3.43Å; M21-V24 PolarHBondContact O-N 3.28Å; V24-S27 PolarHBondContact O-N 2.87Å; V24-M28 VanDerWaalsContact O-CB 3.27Å; V24-M28 WeakPolarHBondContact O-CB 3.49Å; V24-M28 PolarHBondContact O-N 2.83Å; V24-F61 HydrophobicContact CG1-CE1 4.13Å; V24-M62 HydrophobicContact CG1-SD 4.19Å; V24-Y65 HydrophobicContact CG1-CD1 4.48Å; V24-Y65 HydrophobicContact CG1-CG 4.48Å; V24-Y65 HydrophobicContact CG2-CD2 4.02Å; V24-Y65 HydrophobicContact CG2-CE1 4.13Å; V24-Y65 HydrophobicContact CG2-CE2 3.37Å; V24-Y65 VanDerWaalsContact CG2-CZ 3.43Å
25	F	98.2	Very high	97.5	Very high	119 Å²	119	87 Å²	87	52%	0.522	46%	0.456	S	S	.	.	H	α-helix	trans	-62.6	-46.1	179.8	-176.2	-104.4	0	0	0	112.1	M21 Q22 S27 M28 T29	M21-F25 WeakPolarHBondContact O-CB 3.37Å; M21-F25 PolarHBondContact O-N 3.48Å; Q22-F25 PolarHBondContact O-N 2.88Å; F25-S27 PolarHBondContact O-N 3.1Å; F25-M28 HydrophobicContact CD2-CE 4.15Å; F25-M28 PolarHBondContact O-N 3.03Å; F25-T29 WeakPolarHBondContact O-CB 3.26Å; F25-T29 PolarHBondContact O-N 2.98Å; F25-T29 PolarHBondContact O-OG1 3.49Å
26	T	98.3	Very high	97.6	Very high	72 Å²	72	81.1 Å²	81.1	44%	0.442	43%	0.428	S	S	.	.	H	α-helix	trans	-64.2	-43.5	-179.9	-53.2	0	0	0	0	111.3	Q22 Q23 S30	Q22-T26 PolarHBondContact NE2-OG1 3.4Å; Q22-T26 VanDerWaalsContact O-CB 3.32Å; Q22-T26 WeakPolarHBondContact O-CB 3.34Å; Q22-T26 PolarHBondContact O-N 2.86Å; Q22-T26 PolarHBondContact O-OG1 3.4Å; Q23-T26 PolarHBondContact O-N 3.19Å; T26-S30 WeakPolarHBondContact O-CB 3.32Å; T26-S30 PolarHBondContact O-N 3.14Å
27	S	98.2	Very high	97.6	Very high	68 Å²	68	76.2 Å²	76.2	48%	0.476	41%	0.407	S	S	.	.	H	α-helix	trans	-65	-43.3	177.3	-177.1	0	0	0	0	112.1	Q23 V24 F25 S31	Q23-S27 VanDerWaalsContact O-CB 3.26Å; Q23-S27 WeakPolarHBondContact O-CB 3.47Å; Q23-S27 PolarHBondContact O-N 3.22Å; V24-S27 PolarHBondContact O-N 2.87Å; F25-S27 PolarHBondContact O-N 3.1Å; S27-S31 WeakPolarHBondContact O-CB 3.39Å; S27-S31 PolarHBondContact O-N 2.87Å
28	M	98.5	Very high	97.4	Very high	33 Å²	33	73.7 Å²	73.7	16%	0.163	40%	0.401	C	S	.	.	H	α-helix	trans	-60.8	-51.6	176.1	-175.5	169.9	60.8	0	0	111.4	V24 F25 S30 S31 C32 A58 F61 M62	V24-M28 VanDerWaalsContact O-CB 3.27Å; V24-M28 WeakPolarHBondContact O-CB 3.49Å; V24-M28 PolarHBondContact O-N 2.83Å; F25-M28 HydrophobicContact CD2-CE 4.15Å; F25-M28 PolarHBondContact O-N 3.03Å; M28-S30 PolarHBondContact O-N 2.92Å; M28-S31 PolarHBondContact O-N 3.39Å; M28-C32 WeakPolarHBondContact O-CB 3.27Å; M28-C32 PolarHBondContact O-N 3.49Å; M28-C32 PolarHBondContact O-SG 2.72Å; M28-A58 HydrophobicContact SD-CB 4.07Å; M28-F61 HydrophobicContact CB-CD1 3.53Å; M28-F61 HydrophobicContact CB-CD2 4.22Å; M28-F61 HydrophobicContact CB-CE1 3.52Å; M28-F61 HydrophobicContact CB-CE2 4.2Å; M28-F61 HydrophobicContact CB-CG 3.91Å; M28-F61 HydrophobicContact CB-CZ 3.86Å; M28-F61 HydrophobicContact CG-CB 4Å; M28-F61 HydrophobicContact CG-CD1 3.58Å; M28-F61 HydrophobicContact CG-CD2 4.28Å; M28-F61 HydrophobicContact CG-CE1 4.13Å; M28-F61 HydrophobicContact CG-CG 3.68Å; M28-F61 HydrophobicContact SD-CB 4.34Å; M28-F61 HydrophobicContact SD-CD1 3.86Å; M28-F61 HydrophobicContact SD-CG 4.31Å; M28-M62 HydrophobicContact SD-CG 4.2Å; M28-M62 HydrophobicContact SD-SD 4.2Å
29	T	98.2	Very high	97	Very high	53 Å²	53	73.1 Å²	73.1	33%	0.325	41%	0.407	S	S	.	.	H	α-helix	trans	-58.9	-49.1	-180	-64.5	0	0	0	0	110.8	F25 S31 C32 L33	F25-T29 WeakPolarHBondContact O-CB 3.26Å; F25-T29 PolarHBondContact O-N 2.98Å; F25-T29 PolarHBondContact O-OG1 3.49Å; T29-S31 VanDerWaalsContact C-N 3.35Å; T29-S31 PolarHBondContact O-N 3.42Å; T29-C32 PolarHBondContact O-N 3.46Å; T29-L33 HydrophobicContact CG2-CD1 3.71Å; T29-L33 HydrophobicContact CG2-CG 4.19Å; T29-L33 WeakPolarHBondContact O-CB 3.44Å; T29-L33 VanDerWaalsContact O-CG 3.24Å; T29-L33 WeakPolarHBondContact O-CG 3.34Å; T29-L33 PolarHBondContact O-N 2.97Å
30	S	98.2	Very high	96.7	Very high	79 Å²	79	73.5 Å²	73.5	55%	0.552	41%	0.413	S	S	*	.	H	α-helix	trans	-58.4	-45.3	176.9	-180	0	0	0	0	112.2	T26 M28 A34	T26-S30 WeakPolarHBondContact O-CB 3.32Å; T26-S30 PolarHBondContact O-N 3.14Å; M28-S30 PolarHBondContact O-N 2.92Å; S30-A34 WeakPolarHBondContact O-CB 3.33Å; S30-A34 PolarHBondContact O-N 3.47Å; S30-A34 VanDerWaalsContact O-N 3.1Å
31	S	98.5	Very high	96.2	Very high	32 Å²	32	78 Å²	78	22%	0.224	43%	0.427	C	S	.	.	H	α-helix	trans	-64.2	-43.4	179	-165.1	0	0	0	0	112.7	S27 M28 T29 K35	S27-S31 WeakPolarHBondContact O-CB 3.39Å; S27-S31 PolarHBondContact O-N 2.87Å; M28-S31 PolarHBondContact O-N 3.39Å; T29-S31 VanDerWaalsContact C-N 3.35Å; T29-S31 PolarHBondContact O-N 3.42Å; S31-K35 WeakPolarHBondContact O-CB 3.26Å; S31-K35 WeakPolarHBondContact O-CD 3.36Å; S31-K35 VanDerWaalsContact O-CG 3.26Å; S31-K35 WeakPolarHBondContact O-CG 3.39Å; S31-K35 PolarHBondContact O-N 2.9Å; S31-K35 VanDerWaalsContact O-N 3.16Å; S31-K35 PolarHBondContact OG-NZ 2.77Å
32	C	98.6	Very high	95.6	Very high	8 Å²	8	79.2 Å²	79.2	5%	0.054	44%	0.436	C	S	.	.	H	α-helix	trans	-76.8	-36.2	-176.6	-66.1	0	0	0	0	112.7	M28 T29 K35 C36 L54 C57	M28-C32 WeakPolarHBondContact O-CB 3.27Å; M28-C32 PolarHBondContact O-N 3.49Å; M28-C32 PolarHBondContact O-SG 2.72Å; T29-C32 PolarHBondContact O-N 3.46Å; C32-K35 PolarHBondContact O-N 3.41Å; C32-C36 WeakPolarHBondContact O-CB 3.35Å; C32-C36 PolarHBondContact O-N 3.24Å; C32-L54 HydrophobicContact CB-CD2 4.05Å; C32-C57 WeakPolarHBondContact CA-SG 3.31Å; C32-C57 HydrophobicContact CB-CB 3.85Å; C32-C57 WeakPolarHBondContact CB-SG 3.24Å; C32-C57 VanDerWaalsContact SG-C 3.52Å; C32-C57 WeakPolarHBondContact SG-CB 3.46Å; C32-C57 CovalentContact SG-SG 2.05Å; C32-C57 PolarHBondContact SG-SG 2.91Å
33	L	96.8	Very high	94.9	Very high	78 Å²	78	79.3 Å²	79.3	41%	0.408	44%	0.44	S	S	.	.	H	α-helix	trans	-60	-48.3	170.9	-70.8	176.3	0	0	0	110.8	T29 K35 C36 I37	T29-L33 HydrophobicContact CG2-CD1 3.71Å; T29-L33 HydrophobicContact CG2-CG 4.19Å; T29-L33 WeakPolarHBondContact O-CB 3.44Å; T29-L33 VanDerWaalsContact O-CG 3.24Å; T29-L33 WeakPolarHBondContact O-CG 3.34Å; T29-L33 PolarHBondContact O-N 2.97Å; L33-K35 VanDerWaalsContact C-N 3.26Å; L33-K35 PolarHBondContact O-N 3Å; L33-C36 PolarHBondContact O-N 3.16Å; L33-I37 HydrophobicContact CD2-CG1 3.77Å; L33-I37 WeakPolarHBondContact O-CB 3.35Å; L33-I37 PolarHBondContact O-N 2.85Å
34	A	97.1	Very high	94.5	Very high	86 Å²	86	77.8 Å²	77.8	71%	0.711	46%	0.455	S	S	*	.	H	α-helix	trans	-63.3	-28.8	179.3	0	0	0	0	0	113.9	S30	S30-A34 WeakPolarHBondContact O-CB 3.33Å; S30-A34 PolarHBondContact O-N 3.47Å; S30-A34 VanDerWaalsContact O-N 3.1Å
35	K	98	Very high	94.3	Very high	148 Å²	148	82.8 Å²	82.8	64%	0.643	48%	0.48	S	S	*	.	H	α-helix	trans	-88	-35.7	-179.5	-75.6	169	-179.8	159.2	0	113.7	S31 C32 L33	S31-K35 WeakPolarHBondContact O-CB 3.26Å; S31-K35 WeakPolarHBondContact O-CD 3.36Å; S31-K35 VanDerWaalsContact O-CG 3.26Å; S31-K35 WeakPolarHBondContact O-CG 3.39Å; S31-K35 PolarHBondContact O-N 2.9Å; S31-K35 VanDerWaalsContact O-N 3.16Å; S31-K35 PolarHBondContact OG-NZ 2.77Å; C32-K35 PolarHBondContact O-N 3.41Å; L33-K35 VanDerWaalsContact C-N 3.26Å; L33-K35 PolarHBondContact O-N 3Å
36	C	97.9	Very high	94.1	Very high	12 Å²	12	82 Å²	82	8%	0.081	48%	0.481	C	S	.	.	H	α-helix	trans	-109	-26.2	-166.7	-63.7	0	0	0	0	113.3	C32 L33 E50 C53 L54	C32-C36 WeakPolarHBondContact O-CB 3.35Å; C32-C36 PolarHBondContact O-N 3.24Å; L33-C36 PolarHBondContact O-N 3.16Å; C36-E50 WeakPolarHBondContact O-CG 3.04Å; C36-C53 WeakPolarHBondContact CA-SG 3.44Å; C36-C53 HydrophobicContact CB-CB 3.64Å; C36-C53 WeakPolarHBondContact CB-SG 3.44Å; C36-C53 WeakPolarHBondContact SG-CB 3.25Å; C36-C53 PolarHBondContact SG-O 2.89Å; C36-C53 VanDerWaalsContact SG-O 3.38Å; C36-C53 CovalentContact SG-SG 2.05Å; C36-C53 PolarHBondContact SG-SG 2.8Å; C36-L54 HydrophobicContact CB-CD2 3.82Å; C36-L54 HydrophobicContact CB-CG 4.07Å
37	I	95.7	Very high	93.9	Very high	18 Å²	18	81.9 Å²	81.9	9%	0.092	48%	0.481	C	S	.	.	S	Bend	trans	-108.8	114	-176.1	-52	-56.4	0	0	0	109.2	L33 Y41 L46 E50 L54	L33-I37 HydrophobicContact CD2-CG1 3.77Å; L33-I37 WeakPolarHBondContact O-CB 3.35Å; L33-I37 PolarHBondContact O-N 2.85Å; I37-Y41 HydrophobicContact CG2-CD1 4.28Å; I37-Y41 HydrophobicContact CG2-CE1 3.41Å; I37-Y41 VanDerWaalsContact CG2-CE1 3.41Å; I37-Y41 WeakPolarHBondContact CG2-OH 3.36Å; I37-L46 HydrophobicContact CD1-CD2 3.62Å; I37-E50 HydrophobicContact CD1-CB 3.93Å; I37-E50 HydrophobicContact CD1-CG 4Å; I37-L54 HydrophobicContact CD1-CD1 4.26Å
38	P	92.6	Very high	93.8	Very high	71 Å²	71	87.3 Å²	87.3	46%	0.461	50%	0.496	S	S	.	.			trans	-58.4	147	174.6	-21.9	33.3	0	0	0	111.4	N40 E50	P38-N40 PolarHBondContact O-N 3.25Å; P38-E50 WeakPolarHBondContact CD-OE1 3.49Å
39	S	89.9	Confident	93.7	Very high	102 Å²	102	88.2 Å²	88.2	71%	0.713	51%	0.513	S	S	*	.	S	Bend	trans	-61.5	-26.3	175.3	59.5	0	0	0	0	113.1	Y41	S39-Y41 WeakPolarHBondContact O-CD2 3.35Å; S39-Y41 PolarHBondContact O-N 3.17Å
40	N	89.7	Confident	93.6	Very high	117 Å²	117	87.3 Å²	87.3	63%	0.626	51%	0.505	S	S	*	.	S	Bend	trans	-92.4	94.8	178.3	-62.9	-11.5	0	0	0	108.7	P38 N42	P38-N40 PolarHBondContact O-N 3.25Å; N40-N42 PolarHBondContact O-N 2.94Å; N40-N42 PolarHBondContact O-ND2 3.39Å; N40-N42 VanDerWaalsContact O-ND2 3.07Å
41	Y	86.1	Confident	93.6	Very high	168 Å²	168	85.2 Å²	85.2	66%	0.659	49%	0.493	S	S	*	.			trans	-72.5	111.4	173.2	-67.4	-94.3	0	0	0	109.1	I37 S39	I37-Y41 HydrophobicContact CG2-CD1 4.28Å; I37-Y41 HydrophobicContact CG2-CE1 3.41Å; I37-Y41 VanDerWaalsContact CG2-CE1 3.41Å; I37-Y41 WeakPolarHBondContact CG2-OH 3.36Å; S39-Y41 WeakPolarHBondContact O-CD2 3.35Å; S39-Y41 PolarHBondContact O-N 3.17Å
42	N	83.7	Confident	93.6	Very high	155 Å²	155	86.8 Å²	86.8	83%	0.829	50%	0.501	S	S	*	.			trans	-103.1	-15.9	177.6	-60.6	-69.9	0	0	0	112.4	N40	N40-N42 PolarHBondContact O-N 2.94Å; N40-N42 PolarHBondContact O-ND2 3.39Å; N40-N42 VanDerWaalsContact O-ND2 3.07Å
43	D	83.1	Confident	93.6	Very high	110 Å²	110	88.5 Å²	88.5	59%	0.588	51%	0.513	S	S	*	.			trans	-139.7	154.1	-177.1	-154.3	-29.6	0	0	0	109.1	D45	D43-D45 PolarHBondContact OD1-N 3.22Å
44	G	89.6	Confident	93.7	Very high	81 Å²	81	86.9 Å²	86.9	84%	0.835	50%	0.504	S	S	*	.	S	Bend	trans	-84.1	-20	174.5	0	0	0	0	0	112.9
45	D	93.5	Very high	93.8	Very high	128 Å²	128	88.4 Å²	88.4	68%	0.684	50%	0.5	S	S	*	.	S	Bend	trans	-99.6	150.1	179.3	-71.4	-37.4	0	0	0	112.1	D43 T47	D43-D45 PolarHBondContact OD1-N 3.22Å; D45-T47 PolarHBondContact O-N 3.49Å
46	L	94	Very high	93.8	Very high	103 Å²	103	89.9 Å²	89.9	54%	0.539	50%	0.502	S	S	.	.	P	Polyproline II helix	trans	-70.9	125.9	171.7	-66	175.6	0	0	0	110.1	I37 E50 L54	I37-L46 HydrophobicContact CD1-CD2 3.62Å; L46-E50 HydrophobicContact CB-CB 4.46Å; L46-E50 HydrophobicContact CD2-CB 4.07Å; L46-L54 HydrophobicContact CD1-CD1 3.83Å; L46-L54 HydrophobicContact CD2-CD1 4.27Å
47	T	94.9	Very high	93.8	Very high	70 Å²	70	90 Å²	90	43%	0.429	50%	0.503	S	S	.	.	P	Polyproline II helix	trans	-62.9	157.2	165.8	66.8	0	0	0	0	110.4	D45 G49 E50 A51	D45-T47 PolarHBondContact O-N 3.49Å; T47-G49 PolarHBondContact O-N 3Å; T47-G49 VanDerWaalsContact O-N 3.13Å; T47-E50 WeakPolarHBondContact CB-OE2 3.31Å; T47-E50 WeakPolarHBondContact CG2-OE2 3.05Å; T47-E50 PolarHBondContact N-OE2 3.24Å; T47-E50 PolarHBondContact O-N 2.9Å; T47-E50 VanDerWaalsContact O-N 3.12Å; T47-E50 VanDerWaalsContact OG1-CD 3.25Å; T47-E50 VanDerWaalsContact OG1-CG 3.25Å; T47-E50 WeakPolarHBondContact OG1-CG 3.36Å; T47-E50 PolarHBondContact OG1-N 2.67Å; T47-E50 PolarHBondContact OG1-OE2 3.48Å; T47-A51 PolarHBondContact O-N 3.38Å
48	K	96	Very high	94	Very high	182 Å²	182	90.8 Å²	90.8	79%	0.791	51%	0.511	S	S	*	.	H	α-helix	trans	-53.9	-35	173.4	-176	-179.7	178.7	-178.5	0	112.3	V52	K48-V52 WeakPolarHBondContact O-CB 3.42Å; K48-V52 VanDerWaalsContact O-CG2 3.3Å; K48-V52 WeakPolarHBondContact O-CG2 3.37Å; K48-V52 PolarHBondContact O-N 2.67Å; K48-V52 VanDerWaalsContact O-N 3.16Å
49	G	96	Very high	94.3	Very high	51 Å²	51	90.4 Å²	90.4	53%	0.526	51%	0.511	S	S	.	.	H	α-helix	trans	-66.8	-46.5	178.2	0	0	0	0	0	112.3	T47 C53	T47-G49 PolarHBondContact O-N 3Å; T47-G49 VanDerWaalsContact O-N 3.13Å; G49-C53 VanDerWaalsContact O-CB 3.29Å; G49-C53 WeakPolarHBondContact O-CB 3.45Å; G49-C53 PolarHBondContact O-N 3.43Å
50	E	96.7	Very high	94.7	Very high	34 Å²	34	92 Å²	92	16%	0.159	51%	0.505	C	S	.	.	H	α-helix	trans	-63.5	-46.6	177.9	-70.8	161.4	149.5	0	0	111.3	C36 I37 P38 L46 T47 V52 C53 L54	C36-E50 WeakPolarHBondContact O-CG 3.04Å; I37-E50 HydrophobicContact CD1-CB 3.93Å; I37-E50 HydrophobicContact CD1-CG 4Å; P38-E50 WeakPolarHBondContact CD-OE1 3.49Å; L46-E50 HydrophobicContact CB-CB 4.46Å; L46-E50 HydrophobicContact CD2-CB 4.07Å; T47-E50 WeakPolarHBondContact CB-OE2 3.31Å; T47-E50 WeakPolarHBondContact CG2-OE2 3.05Å; T47-E50 PolarHBondContact N-OE2 3.24Å; T47-E50 PolarHBondContact O-N 2.9Å; T47-E50 VanDerWaalsContact O-N 3.12Å; T47-E50 VanDerWaalsContact OG1-CD 3.25Å; T47-E50 VanDerWaalsContact OG1-CG 3.25Å; T47-E50 WeakPolarHBondContact OG1-CG 3.36Å; T47-E50 PolarHBondContact OG1-N 2.67Å; T47-E50 PolarHBondContact OG1-OE2 3.48Å; E50-V52 PolarHBondContact O-N 3.45Å; E50-C53 WeakPolarHBondContact O-CB 3.44Å; E50-C53 PolarHBondContact O-N 2.88Å; E50-L54 VanDerWaalsContact O-CG 3.31Å; E50-L54 WeakPolarHBondContact O-CG 3.45Å; E50-L54 PolarHBondContact O-N 2.87Å
51	A	97.2	Very high	95.1	Very high	36 Å²	36	88.1 Å²	88.1	30%	0.298	48%	0.483	S	S	.	.	H	α-helix	trans	-57.4	-50.8	177.4	0	0	0	0	0	112.1	T47 C53 L54 D55	T47-A51 PolarHBondContact O-N 3.38Å; A51-C53 VanDerWaalsContact C-N 3.3Å; A51-C53 PolarHBondContact O-N 2.91Å; A51-L54 PolarHBondContact O-N 3.46Å; A51-D55 PolarHBondContact O-N 3.49Å; A51-D55 VanDerWaalsContact O-N 3.1Å
52	V	98.5	Very high	95.7	Very high	65 Å²	65	83.7 Å²	83.7	39%	0.394	47%	0.469	S	S	.	.	H	α-helix	trans	-65.3	-34.2	178.6	172.8	0	0	0	0	111.9	K48 E50 R56	K48-V52 WeakPolarHBondContact O-CB 3.42Å; K48-V52 VanDerWaalsContact O-CG2 3.3Å; K48-V52 WeakPolarHBondContact O-CG2 3.37Å; K48-V52 PolarHBondContact O-N 2.67Å; K48-V52 VanDerWaalsContact O-N 3.16Å; E50-V52 PolarHBondContact O-N 3.45Å; V52-R56 VanDerWaalsContact O-CG 3.31Å; V52-R56 WeakPolarHBondContact O-CG 3.3Å; V52-R56 PolarHBondContact O-N 3.26Å
53	C	98.6	Very high	96.4	Very high	44 Å²	44	79.6 Å²	79.6	30%	0.297	44%	0.444	S	S	.	.	H	α-helix	trans	-64.2	-47.3	174.3	-177.5	0	0	0	0	111.1	C36 G49 E50 A51 D55 R56 C57	C36-C53 WeakPolarHBondContact CA-SG 3.44Å; C36-C53 HydrophobicContact CB-CB 3.64Å; C36-C53 WeakPolarHBondContact CB-SG 3.44Å; C36-C53 WeakPolarHBondContact SG-CB 3.25Å; C36-C53 PolarHBondContact SG-O 2.89Å; C36-C53 VanDerWaalsContact SG-O 3.38Å; C36-C53 CovalentContact SG-SG 2.05Å; C36-C53 PolarHBondContact SG-SG 2.8Å; G49-C53 VanDerWaalsContact O-CB 3.29Å; G49-C53 WeakPolarHBondContact O-CB 3.45Å; G49-C53 PolarHBondContact O-N 3.43Å; E50-C53 WeakPolarHBondContact O-CB 3.44Å; E50-C53 PolarHBondContact O-N 2.88Å; A51-C53 VanDerWaalsContact C-N 3.3Å; A51-C53 PolarHBondContact O-N 2.91Å; C53-D55 PolarHBondContact O-N 3.02Å; C53-R56 PolarHBondContact O-N 3.47Å; C53-C57 WeakPolarHBondContact O-CB 3.45Å; C53-C57 PolarHBondContact O-N 3.39Å
54	L	98.5	Very high	97.1	Very high	43 Å²	43	76.6 Å²	76.6	23%	0.225	44%	0.435	C	S	.	.	H	α-helix	trans	-58.7	-46.8	179.8	-72.3	173	0	0	0	111.5	C32 C36 I37 L46 E50 A51 R56 C57 A58	C32-L54 HydrophobicContact CB-CD2 4.05Å; C36-L54 HydrophobicContact CB-CD2 3.82Å; C36-L54 HydrophobicContact CB-CG 4.07Å; I37-L54 HydrophobicContact CD1-CD1 4.26Å; L46-L54 HydrophobicContact CD1-CD1 3.83Å; L46-L54 HydrophobicContact CD2-CD1 4.27Å; E50-L54 VanDerWaalsContact O-CG 3.31Å; E50-L54 WeakPolarHBondContact O-CG 3.45Å; E50-L54 PolarHBondContact O-N 2.87Å; A51-L54 PolarHBondContact O-N 3.46Å; L54-R56 PolarHBondContact O-N 3.47Å; L54-C57 PolarHBondContact O-N 2.98Å; L54-A58 WeakPolarHBondContact O-CB 3.43Å; L54-A58 PolarHBondContact O-N 2.95Å
55	D	98.6	Very high	97.5	Very high	119 Å²	119	76.5 Å²	76.5	64%	0.636	41%	0.41	S	S	*	.	H	α-helix	trans	-58.7	-47.3	177.3	-71.1	-25.9	0	0	0	112.2	A51 C53 S59	A51-D55 PolarHBondContact O-N 3.49Å; A51-D55 VanDerWaalsContact O-N 3.1Å; C53-D55 PolarHBondContact O-N 3.02Å; D55-S59 WeakPolarHBondContact O-CB 3.45Å; D55-S59 PolarHBondContact O-N 2.88Å; D55-S59 VanDerWaalsContact O-N 3.12Å
56	R	98.8	Very high	97.6	Very high	179 Å²	179	75.7 Å²	75.7	68%	0.675	40%	0.404	S	S	*	.	H	α-helix	trans	-66	-40.5	177.9	-71.8	176.2	-177.7	-94.6	-0.6	111.6	V52 C53 L54 S59 K60	V52-R56 VanDerWaalsContact O-CG 3.31Å; V52-R56 WeakPolarHBondContact O-CG 3.3Å; V52-R56 PolarHBondContact O-N 3.26Å; C53-R56 PolarHBondContact O-N 3.47Å; L54-R56 PolarHBondContact O-N 3.47Å; R56-S59 PolarHBondContact O-N 3.32Å; R56-K60 WeakPolarHBondContact O-CB 3.22Å; R56-K60 WeakPolarHBondContact O-CG 3.28Å; R56-K60 PolarHBondContact O-N 3.45Å
57	C	98.8	Very high	97.8	Very high	14 Å²	14	77.2 Å²	77.2	10%	0.095	41%	0.408	C	S	.	.	H	α-helix	trans	-63	-49.9	179.7	179.2	0	0	0	0	110.9	C32 C53 L54 S59 K60 F61	C32-C57 WeakPolarHBondContact CA-SG 3.31Å; C32-C57 HydrophobicContact CB-CB 3.85Å; C32-C57 WeakPolarHBondContact CB-SG 3.24Å; C32-C57 VanDerWaalsContact SG-C 3.52Å; C32-C57 WeakPolarHBondContact SG-CB 3.46Å; C32-C57 CovalentContact SG-SG 2.05Å; C32-C57 PolarHBondContact SG-SG 2.91Å; C53-C57 WeakPolarHBondContact O-CB 3.45Å; C53-C57 PolarHBondContact O-N 3.39Å; L54-C57 PolarHBondContact O-N 2.98Å; C57-S59 PolarHBondContact O-N 3.34Å; C57-K60 PolarHBondContact O-N 3.49Å; C57-F61 VanDerWaalsContact O-CB 3.31Å; C57-F61 WeakPolarHBondContact O-CB 3.26Å; C57-F61 PolarHBondContact O-N 3.4Å
58	A	98.7	Very high	97.8	Very high	34 Å²	34	78.3 Å²	78.3	28%	0.281	42%	0.415	S	S	.	.	H	α-helix	trans	-59.5	-45.5	177.7	0	0	0	0	0	111.6	M28 L54 K60 F61 M62	M28-A58 HydrophobicContact SD-CB 4.07Å; L54-A58 WeakPolarHBondContact O-CB 3.43Å; L54-A58 PolarHBondContact O-N 2.95Å; A58-K60 PolarHBondContact O-N 3.1Å; A58-F61 PolarHBondContact O-N 2.9Å; A58-M62 WeakPolarHBondContact O-CG 3.37Å; A58-M62 PolarHBondContact O-N 2.78Å
59	S	98.6	Very high	97.7	Very high	64 Å²	64	72.3 Å²	72.3	45%	0.448	39%	0.393	S	S	.	.	H	α-helix	trans	-58.7	-44.7	176.3	-176	0	0	0	0	112.5	D55 R56 C57 Q63	D55-S59 WeakPolarHBondContact O-CB 3.45Å; D55-S59 PolarHBondContact O-N 2.88Å; D55-S59 VanDerWaalsContact O-N 3.12Å; R56-S59 PolarHBondContact O-N 3.32Å; C57-S59 PolarHBondContact O-N 3.34Å; S59-Q63 VanDerWaalsContact O-CG 3.3Å; S59-Q63 WeakPolarHBondContact O-CG 3.43Å; S59-Q63 PolarHBondContact O-N 2.95Å; S59-Q63 VanDerWaalsContact O-N 3.09Å; S59-Q63 PolarHBondContact O-NE2 3.07Å; S59-Q63 PolarHBondContact OG-NE2 2.87Å; S59-Q63 VanDerWaalsContact OG-NE2 3.09Å
60	K	98.8	Very high	97.6	Very high	134 Å²	134	77.1 Å²	77.1	58%	0.583	40%	0.4	S	S	*	.	H	α-helix	trans	-71.4	-37.1	178.4	-73	-65.6	-179	-171.3	0	112.8	R56 C57 A58 M62 Q63 A64	R56-K60 WeakPolarHBondContact O-CB 3.22Å; R56-K60 WeakPolarHBondContact O-CG 3.28Å; R56-K60 PolarHBondContact O-N 3.45Å; C57-K60 PolarHBondContact O-N 3.49Å; A58-K60 PolarHBondContact O-N 3.1Å; K60-M62 VanDerWaalsContact C-N 3.35Å; K60-Q63 PolarHBondContact O-N 2.99Å; K60-A64 WeakPolarHBondContact O-CB 3.37Å; K60-A64 PolarHBondContact O-N 2.9Å
61	F	98.8	Very high	97.6	Very high	37 Å²	37	81.6 Å²	81.6	16%	0.162	42%	0.419	C	S	.	.	H	α-helix	trans	-59.5	-48	175.4	-174.3	-83.4	0	0	0	110.4	V24 M28 C57 A58 Q63 A64 Y65	V24-F61 HydrophobicContact CG1-CE1 4.13Å; M28-F61 HydrophobicContact CB-CD1 3.53Å; M28-F61 HydrophobicContact CB-CD2 4.22Å; M28-F61 HydrophobicContact CB-CE1 3.52Å; M28-F61 HydrophobicContact CB-CE2 4.2Å; M28-F61 HydrophobicContact CB-CG 3.91Å; M28-F61 HydrophobicContact CB-CZ 3.86Å; M28-F61 HydrophobicContact CG-CB 4Å; M28-F61 HydrophobicContact CG-CD1 3.58Å; M28-F61 HydrophobicContact CG-CD2 4.28Å; M28-F61 HydrophobicContact CG-CE1 4.13Å; M28-F61 HydrophobicContact CG-CG 3.68Å; M28-F61 HydrophobicContact SD-CB 4.34Å; M28-F61 HydrophobicContact SD-CD1 3.86Å; M28-F61 HydrophobicContact SD-CG 4.31Å; C57-F61 VanDerWaalsContact O-CB 3.31Å; C57-F61 WeakPolarHBondContact O-CB 3.26Å; C57-F61 PolarHBondContact O-N 3.4Å; A58-F61 PolarHBondContact O-N 2.9Å; F61-Q63 PolarHBondContact O-N 3.44Å; F61-A64 PolarHBondContact O-N 3.23Å; F61-Y65 WeakPolarHBondContact O-CB 3.46Å; F61-Y65 PolarHBondContact O-N 3.49Å
62	M	98.3	Very high	97.4	Very high	74 Å²	74	85 Å²	85	37%	0.365	43%	0.431	S	S	.	.	H	α-helix	trans	-65.5	-39.8	178.1	-68.1	-56.5	-65.8	0	0	112.6	V24 M28 A58 K60 A64 Y65 M66	V24-M62 HydrophobicContact CG1-SD 4.19Å; M28-M62 HydrophobicContact SD-CG 4.2Å; M28-M62 HydrophobicContact SD-SD 4.2Å; A58-M62 WeakPolarHBondContact O-CG 3.37Å; A58-M62 PolarHBondContact O-N 2.78Å; K60-M62 VanDerWaalsContact C-N 3.35Å; M62-A64 VanDerWaalsContact C-N 3.35Å; M62-A64 PolarHBondContact O-N 2.05Å; M62-Y65 HydrophobicContact CE-CD1 4.32Å; M62-Y65 PolarHBondContact O-N 3.3Å; M62-M66 WeakPolarHBondContact O-CB 3.36Å; M62-M66 VanDerWaalsContact O-CG 3.31Å; M62-M66 WeakPolarHBondContact O-CG 3.43Å; M62-M66 PolarHBondContact O-N 3.4Å
63	Q	98.4	Very high	97.1	Very high	69 Å²	69	85 Å²	85	32%	0.322	44%	0.435	S	S	.	.	H	α-helix	trans	-57.7	-47.4	172.4	-74.9	167.2	53.5	0	0	111.5	S59 K60 F61 Q67	S59-Q63 VanDerWaalsContact O-CG 3.3Å; S59-Q63 WeakPolarHBondContact O-CG 3.43Å; S59-Q63 PolarHBondContact O-N 2.95Å; S59-Q63 VanDerWaalsContact O-N 3.09Å; S59-Q63 PolarHBondContact O-NE2 3.07Å; S59-Q63 PolarHBondContact OG-NE2 2.87Å; S59-Q63 VanDerWaalsContact OG-NE2 3.09Å; K60-Q63 PolarHBondContact O-N 2.99Å; F61-Q63 PolarHBondContact O-N 3.44Å; Q63-Q67 WeakPolarHBondContact O-CB 3.31Å; Q63-Q67 VanDerWaalsContact O-CG 3.25Å; Q63-Q67 WeakPolarHBondContact O-CG 3.22Å; Q63-Q67 PolarHBondContact O-N 3.43Å
64	A	97.9	Very high	96.8	Very high	48 Å²	48	86.1 Å²	86.1	40%	0.397	44%	0.44	S	S	.	.	H	α-helix	trans	-64.6	-45.9	178.1	0	0	0	0	0	111.6	K60 F61 M62 M66 Q67 T68	K60-A64 WeakPolarHBondContact O-CB 3.37Å; K60-A64 PolarHBondContact O-N 2.9Å; F61-A64 PolarHBondContact O-N 3.23Å; M62-A64 VanDerWaalsContact C-N 3.35Å; M62-A64 PolarHBondContact O-N 2.05Å; A64-M66 PolarHBondContact O-N 3.35Å; A64-Q67 PolarHBondContact O-N 3.19Å; A64-T68 WeakPolarHBondContact O-CB 3.47Å; A64-T68 PolarHBondContact O-N 3.24Å; A64-T68 PolarHBondContact O-OG1 3.46Å; A64-T68 VanDerWaalsContact O-OG1 3.07Å
65	Y	97.1	Very high	96.5	Very high	78 Å²	78	87.7 Å²	87.7	31%	0.306	45%	0.447	S	S	.	.	H	α-helix	trans	-57	-47.4	176.9	173	-103.2	0	0	0	112	V24 F61 M62 T68 T69	V24-Y65 HydrophobicContact CG1-CD1 4.48Å; V24-Y65 HydrophobicContact CG1-CG 4.48Å; V24-Y65 HydrophobicContact CG2-CD2 4.02Å; V24-Y65 HydrophobicContact CG2-CE1 4.13Å; V24-Y65 HydrophobicContact CG2-CE2 3.37Å; V24-Y65 VanDerWaalsContact CG2-CZ 3.43Å; F61-Y65 WeakPolarHBondContact O-CB 3.46Å; F61-Y65 PolarHBondContact O-N 3.49Å; M62-Y65 HydrophobicContact CE-CD1 4.32Å; M62-Y65 PolarHBondContact O-N 3.3Å; Y65-T68 PolarHBondContact O-N 3.19Å; Y65-T69 WeakPolarHBondContact O-CB 3.34Å; Y65-T69 PolarHBondContact O-N 3.09Å; Y65-T69 PolarHBondContact O-OG1 2.92Å
66	M	96.6	Very high	96.1	Very high	112 Å²	112	85.3 Å²	85.3	55%	0.552	44%	0.444	S	S	*	.	H	α-helix	trans	-64.2	-42.3	177.4	-72.3	-173.6	-66.7	0	0	112.3	M62 A64 T69 K70	M62-M66 WeakPolarHBondContact O-CB 3.36Å; M62-M66 VanDerWaalsContact O-CG 3.31Å; M62-M66 WeakPolarHBondContact O-CG 3.43Å; M62-M66 PolarHBondContact O-N 3.4Å; A64-M66 PolarHBondContact O-N 3.35Å; M66-T69 PolarHBondContact O-N 3.48Å; M66-K70 VanDerWaalsContact O-CB 3.26Å; M66-K70 WeakPolarHBondContact O-CB 3.47Å; M66-K70 PolarHBondContact O-N 3.31Å
67	Q	96.9	Very high	95.3	Very high	135 Å²	135	81.7 Å²	81.7	63%	0.631	45%	0.446	S	S	*	.	H	α-helix	trans	-64.6	-44.7	178.1	-74.5	175.9	3.9	0	0	111.8	Q63 A64 K70 K71	Q63-Q67 WeakPolarHBondContact O-CB 3.31Å; Q63-Q67 VanDerWaalsContact O-CG 3.25Å; Q63-Q67 WeakPolarHBondContact O-CG 3.22Å; Q63-Q67 PolarHBondContact O-N 3.43Å; A64-Q67 PolarHBondContact O-N 3.19Å; Q67-K70 PolarHBondContact O-N 2.8Å; Q67-K71 WeakPolarHBondContact O-CB 3.46Å; Q67-K71 PolarHBondContact O-N 2.87Å
68	T	95.4	Very high	94	Very high	93 Å²	93	84.2 Å²	84.2	57%	0.571	46%	0.464	S	S	*	.	H	α-helix	trans	-62.3	-46.7	175.8	-62.9	0	0	0	0	111	A64 Y65 K70 K71 L72	A64-T68 WeakPolarHBondContact O-CB 3.47Å; A64-T68 PolarHBondContact O-N 3.24Å; A64-T68 PolarHBondContact O-OG1 3.46Å; A64-T68 VanDerWaalsContact O-OG1 3.07Å; Y65-T68 PolarHBondContact O-N 3.19Å; T68-K70 PolarHBondContact O-N 2.74Å; T68-K71 PolarHBondContact O-N 2.93Å; T68-L72 WeakPolarHBondContact O-CB 3.25Å; T68-L72 PolarHBondContact O-N 2.78Å
69	T	93.8	Very high	92.1	Very high	55 Å²	55	87 Å²	87	34%	0.337	47%	0.474	S	S	.	.	H	α-helix	trans	-61.1	-47.3	178.5	-57	0	0	0	0	110.8	Y65 M66 K71 L72 S73	Y65-T69 WeakPolarHBondContact O-CB 3.34Å; Y65-T69 PolarHBondContact O-N 3.09Å; Y65-T69 PolarHBondContact O-OG1 2.92Å; M66-T69 PolarHBondContact O-N 3.48Å; T69-K71 VanDerWaalsContact C-N 3.35Å; T69-K71 PolarHBondContact O-N 3.25Å; T69-L72 PolarHBondContact O-N 2.86Å; T69-S73 PolarHBondContact O-N 3.31Å; T69-S73 PolarHBondContact O-OG 3.16Å
70	K	95.5	Very high	90	Very high	153 Å²	153	89 Å²	89	67%	0.665	49%	0.488	S	S	*	.	H	α-helix	trans	-57.5	-47.4	175.5	-179.2	176.8	-178.2	175.5	0	111.5	M66 Q67 T68 L72 S73 T74	M66-K70 VanDerWaalsContact O-CB 3.26Å; M66-K70 WeakPolarHBondContact O-CB 3.47Å; M66-K70 PolarHBondContact O-N 3.31Å; Q67-K70 PolarHBondContact O-N 2.8Å; T68-K70 PolarHBondContact O-N 2.74Å; K70-L72 VanDerWaalsContact C-N 3.34Å; K70-L72 PolarHBondContact O-N 3.42Å; K70-S73 PolarHBondContact O-N 3.46Å; K70-T74 WeakPolarHBondContact O-CG2 3.04Å; K70-T74 PolarHBondContact O-N 3.1Å; K70-T74 PolarHBondContact O-OG1 3.23Å
71	K	94.7	Very high	87.8	Confident	127 Å²	127	91.1 Å²	91.1	55%	0.552	50%	0.497	S	S	*	.	H	α-helix	trans	-61.9	-44.4	179.2	-177.7	60.3	179.3	176.4	0	110.8	Q67 T68 T69 S73 T74 M75	Q67-K71 WeakPolarHBondContact O-CB 3.46Å; Q67-K71 PolarHBondContact O-N 2.87Å; T68-K71 PolarHBondContact O-N 2.93Å; T69-K71 VanDerWaalsContact C-N 3.35Å; T69-K71 PolarHBondContact O-N 3.25Å; K71-S73 PolarHBondContact O-N 3.29Å; K71-T74 WeakPolarHBondContact CA-OG1 3.3Å; K71-T74 PolarHBondContact O-N 3.2Å; K71-T74 PolarHBondContact O-OG1 3.38Å; K71-M75 HydrophobicContact CD-CG 4.41Å; K71-M75 HydrophobicContact CD-SD 4.43Å; K71-M75 HydrophobicContact CG-CE 4.07Å; K71-M75 HydrophobicContact CG-SD 4.23Å; K71-M75 WeakPolarHBondContact O-CG 3.09Å; K71-M75 PolarHBondContact O-N 3.49Å
72	L	93.7	Very high	85.8	Confident	107 Å²	107	94.6 Å²	94.6	56%	0.56	52%	0.521	S	S	*	.	H	α-helix	trans	-59.9	-46.1	176.6	-176.3	60.1	0	0	0	111.9	T68 T69 K70 T74 M75 A76	T68-L72 WeakPolarHBondContact O-CB 3.25Å; T68-L72 PolarHBondContact O-N 2.78Å; T69-L72 PolarHBondContact O-N 2.86Å; K70-L72 VanDerWaalsContact C-N 3.34Å; K70-L72 PolarHBondContact O-N 3.42Å; L72-T74 VanDerWaalsContact C-N 3.32Å; L72-T74 PolarHBondContact O-N 3.46Å; L72-M75 HydrophobicContact CD1-CE 4.21Å; L72-M75 PolarHBondContact O-N 3.12Å; L72-M75 VanDerWaalsContact O-N 3.17Å; L72-A76 WeakPolarHBondContact O-CB 3.31Å; L72-A76 PolarHBondContact O-N 3.44Å
73	S	92.6	Very high	84	Confident	67 Å²	67	97.3 Å²	97.3	47%	0.469	54%	0.542	S	S	.	.	H	α-helix	trans	-60.5	-39.7	175.5	-53.6	0	0	0	0	112.6	T69 K70 K71 S77	T69-S73 PolarHBondContact O-N 3.31Å; T69-S73 PolarHBondContact O-OG 3.16Å; K70-S73 PolarHBondContact O-N 3.46Å; K71-S73 PolarHBondContact O-N 3.29Å; S73-S77 PolarHBondContact O-N 3.37Å; S73-S77 VanDerWaalsContact O-N 3.16Å; S73-S77 PolarHBondContact O-OG 3.29Å
74	T	93.1	Very high	81.7	Confident	67 Å²	67	99 Å²	99	41%	0.411	56%	0.557	S	S	.	*	H	α-helix	trans	-66.6	-38.2	175.6	60.2	0	0	0	0	112.3	K70 K71 L72 S77 S78	K70-T74 WeakPolarHBondContact O-CG2 3.04Å; K70-T74 PolarHBondContact O-N 3.1Å; K70-T74 PolarHBondContact O-OG1 3.23Å; K71-T74 WeakPolarHBondContact CA-OG1 3.3Å; K71-T74 PolarHBondContact O-N 3.2Å; K71-T74 PolarHBondContact O-OG1 3.38Å; L72-T74 VanDerWaalsContact C-N 3.32Å; L72-T74 PolarHBondContact O-N 3.46Å; T74-S77 PolarHBondContact O-N 3.2Å; T74-S78 PolarHBondContact O-N 2.05Å; T74-S78 PolarHBondContact O-OG 3Å
75	M	91.9	Very high	79.3	Confident	76 Å²	76	100.2 Å²	100.2	37%	0.374	57%	0.574	S	S	.	*	H	α-helix	trans	-68.7	-46	177.6	-69.5	-176.2	-53.2	0	0	111.3	K71 L72 S77 S78 D79	K71-M75 HydrophobicContact CD-CG 4.41Å; K71-M75 HydrophobicContact CD-SD 4.43Å; K71-M75 HydrophobicContact CG-CE 4.07Å; K71-M75 HydrophobicContact CG-SD 4.23Å; K71-M75 WeakPolarHBondContact O-CG 3.09Å; K71-M75 PolarHBondContact O-N 3.49Å; L72-M75 HydrophobicContact CD1-CE 4.21Å; L72-M75 PolarHBondContact O-N 3.12Å; L72-M75 VanDerWaalsContact O-N 3.17Å; M75-S77 PolarHBondContact O-N 3.09Å; M75-S77 VanDerWaalsContact O-N 3.14Å; M75-S78 WeakPolarHBondContact CA-OG 3.49Å; M75-S78 CarbonylContact O-C 3.53Å; M75-S78 WeakPolarHBondContact O-CA 3.29Å; M75-S78 PolarHBondContact O-N 3.07Å; M75-S78 PolarHBondContact O-OG 3.24Å; M75-D79 PolarHBondContact O-N 2.97Å
76	A	88.8	Confident	77.2	Confident	69 Å²	69	107.8 Å²	107.8	57%	0.57	62%	0.62	S	S	*	*	H	α-helix	trans	-58	-31	175.3	0	0	0	0	0	113	L72	L72-A76 WeakPolarHBondContact O-CB 3.31Å; L72-A76 PolarHBondContact O-N 3.44Å
77	S	83.3	Confident	76.2	Confident	102 Å²	102	107.6 Å²	107.6	71%	0.713	62%	0.623	S	S	*	*	H	α-helix	trans	-80.2	-18.2	175.3	-52.4	0	0	0	0	113.4	S73 T74 M75	S73-S77 PolarHBondContact O-N 3.37Å; S73-S77 VanDerWaalsContact O-N 3.16Å; S73-S77 PolarHBondContact O-OG 3.29Å; T74-S77 PolarHBondContact O-N 3.2Å; M75-S77 PolarHBondContact O-N 3.09Å; M75-S77 VanDerWaalsContact O-N 3.14Å
78	S	71.5	Confident	75.1	Confident	68 Å²	68	106.2 Å²	106.2	48%	0.476	62%	0.623	S	S	.	*	H	α-helix	trans	-105.5	-13.6	-178.2	39.5	0	0	0	0	114.3	T74 M75 S80 K81	T74-S78 PolarHBondContact O-N 2.05Å; T74-S78 PolarHBondContact O-OG 3Å; M75-S78 WeakPolarHBondContact CA-OG 3.49Å; M75-S78 CarbonylContact O-C 3.53Å; M75-S78 WeakPolarHBondContact O-CA 3.29Å; M75-S78 PolarHBondContact O-N 3.07Å; M75-S78 PolarHBondContact O-OG 3.24Å; S78-S80 PolarHBondContact O-N 3.13Å; S78-S80 VanDerWaalsContact O-N 3.1Å; S78-K81 PolarHBondContact O-N 3.2Å
79	D	59.3	Low	74	Confident	92 Å²	92	106.9 Å²	106.9	49%	0.492	63%	0.626	S	S	.	*	T	Hydrogen-bonded Turn	trans	-67	-5.9	178.1	-87.2	-35.6	0	0	0	115	M75 K81	M75-D79 PolarHBondContact O-N 2.97Å; D79-K81 PolarHBondContact O-N 3.12Å
80	S	53.7	Low	72.8	Confident	107 Å²	107	109.9 Å²	109.9	75%	0.748	64%	0.643	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.1	-14.1	163.6	-58.6	0	0	0	0	113.4	S78	S78-S80 PolarHBondContact O-N 3.13Å; S78-S80 VanDerWaalsContact O-N 3.1Å
81	K	51.9	Low	71.4	Confident	177 Å²	177	107.3 Å²	107.3	77%	0.77	64%	0.641	S	S	*	*	T	Hydrogen-bonded Turn	trans	-106.9	-19.2	179.8	-90.1	-177.8	177.3	-75.2	0	115.9	S78 D79	S78-K81 PolarHBondContact O-N 3.2Å; D79-K81 PolarHBondContact O-N 3.12Å
82	V	58.2	Low	69.9	Low	110 Å²	110	105.9 Å²	105.9	67%	0.667	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.5	-26	-176.5	-177.8	0	0	0	0	112.1	T84	V82-T84 PolarHBondContact O-N 3.16Å
83	V	59.5	Low	68.2	Low	132 Å²	132	105.9 Å²	105.9	80%	0.8	65%	0.653	S	S	*	*	S	Bend	trans	-76.9	0.5	179.6	104.2	0	0	0	0	114.5
84	T	50.2	Low	66.3	Low	105 Å²	105	108.8 Å²	108.8	64%	0.644	67%	0.668	S	S	*	*			trans	-125.4	63.3	168.7	60.6	0	0	0	0	109.1	V82 N86	V82-T84 PolarHBondContact O-N 3.16Å; T84-N86 PolarHBondContact O-N 2.92Å
85	G	48	Very low	64.1	Low	72 Å²	72	112.3 Å²	112.3	74%	0.742	69%	0.689	S	S	*	*			trans	-67.6	95.2	164.1	0	0	0	0	0	109.9
86	N	52.3	Low	61.5	Low	238 Å²	238	115.6 Å²	115.6	100%	1.273	72%	0.718	S	S	*	*			trans	-128.2	0	156.3	-108.3	41.8	0	0	0	107.7	T84	T84-N86 PolarHBondContact O-N 2.92Å

Retrieved 86 of 86 residues in 25.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).