G4V6W1_SCHMA Loading...

Putative 13 kDa deflagellation-inducible protein

AlphaFold DB , UniProt , Accession G4V6W1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 113 aa.

						>G4V6W1_SCHMA|G4V6W1
MKHDAQILQQHNTELVKLIEDLCQKRDQLQKAIIEEDDEKNRLQHDMRIISEKLAKINDSLSKKLVVRNSYDKAIAESQQAYSKLLENSYVLLNVLKCNQEKMKDKFAKTYTP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	72.4	Confident	90.8	Very high	192 Å²	192	117.8 Å²	117.8	95%	0.946	58%	0.582	S	S	*	*				0	-71.6	0	-68.8	-141.1	-67.4	0	0	113.4	H3 D4 A5	M1-H3 VanDerWaalsContact C-N 3.34Å; M1-H3 PolarHBondContact O-N 3.37Å; M1-D4 WeakPolarHBondContact CA-OD2 3.38Å; M1-D4 PolarHBondContact N-OD2 2.99Å; M1-D4 PolarHBondContact O-N 3Å; M1-A5 WeakPolarHBondContact O-CB 3.4Å; M1-A5 PolarHBondContact O-N 3.41Å
2	K	84.1	Confident	91.4	Very high	188 Å²	188	114.8 Å²	114.8	82%	0.817	57%	0.569	S	S	*	*	H	α-helix	trans	-59	-42.5	-178.5	-75.2	-172.8	179	-179.6	0	113.3	Q6	K2-Q6 WeakPolarHBondContact O-CG 3.43Å; K2-Q6 PolarHBondContact O-N 3.42Å; K2-Q6 VanDerWaalsContact O-N 3.15Å
3	H	87.6	Confident	91.8	Very high	123 Å²	123	111.2 Å²	111.2	57%	0.569	56%	0.558	S	S	*	*	H	α-helix	trans	-65.3	-49.5	178.6	-174.9	57.8	0	0	0	112.2	M1 A5 Q6 I7	M1-H3 VanDerWaalsContact C-N 3.34Å; M1-H3 PolarHBondContact O-N 3.37Å; H3-A5 VanDerWaalsContact C-N 3.28Å; H3-A5 PolarHBondContact O-N 3.03Å; H3-Q6 WeakPolarHBondContact O-CB 3.37Å; H3-Q6 PolarHBondContact O-N 3.07Å; H3-I7 WeakPolarHBondContact NE2-CD1 3.43Å; H3-I7 PolarHBondContact O-N 3.31Å
4	D	91.6	Very high	92.2	Very high	100 Å²	100	111.7 Å²	111.7	54%	0.535	56%	0.558	S	S	.	*	H	α-helix	trans	-59.9	-38.6	178.2	-41.6	-50.7	0	0	0	111.9	M1 I7 L8	M1-D4 WeakPolarHBondContact CA-OD2 3.38Å; M1-D4 PolarHBondContact N-OD2 2.99Å; M1-D4 PolarHBondContact O-N 3Å; D4-I7 PolarHBondContact O-N 2.73Å; D4-L8 WeakPolarHBondContact O-CB 3.45Å; D4-L8 PolarHBondContact O-N 3.02Å
5	A	92.6	Very high	92.6	Very high	60 Å²	60	110.7 Å²	110.7	50%	0.496	55%	0.554	S	S	.	*	H	α-helix	trans	-64.3	-38.5	175.4	0	0	0	0	0	112.6	M1 H3 Q9	M1-A5 WeakPolarHBondContact O-CB 3.4Å; M1-A5 PolarHBondContact O-N 3.41Å; H3-A5 VanDerWaalsContact C-N 3.28Å; H3-A5 PolarHBondContact O-N 3.03Å; A5-Q9 WeakPolarHBondContact O-CB 3.47Å; A5-Q9 PolarHBondContact O-N 3.18Å
6	Q	94.3	Very high	93	Very high	114 Å²	114	108.6 Å²	108.6	53%	0.533	55%	0.548	S	S	.	.	H	α-helix	trans	-66.4	-43.7	175.6	-74.3	173.3	-20	0	0	111.9	K2 H3 Q9 Q10	K2-Q6 WeakPolarHBondContact O-CG 3.43Å; K2-Q6 PolarHBondContact O-N 3.42Å; K2-Q6 VanDerWaalsContact O-N 3.15Å; H3-Q6 WeakPolarHBondContact O-CB 3.37Å; H3-Q6 PolarHBondContact O-N 3.07Å; Q6-Q9 PolarHBondContact O-N 3.37Å; Q6-Q10 WeakPolarHBondContact O-CG 3.45Å; Q6-Q10 PolarHBondContact O-N 3.15Å
7	I	94.5	Very high	93.3	Very high	58 Å²	58	109.5 Å²	109.5	30%	0.297	55%	0.548	S	S	.	.	H	α-helix	trans	-60.8	-47.2	176.9	-68.9	170.8	0	0	0	110.4	H3 D4 Q9 Q10 H11	H3-I7 WeakPolarHBondContact NE2-CD1 3.43Å; H3-I7 PolarHBondContact O-N 3.31Å; D4-I7 PolarHBondContact O-N 2.73Å; I7-Q9 VanDerWaalsContact C-N 3.3Å; I7-Q9 PolarHBondContact O-N 3.28Å; I7-Q10 WeakPolarHBondContact O-CB 3.47Å; I7-Q10 PolarHBondContact O-N 3.04Å; I7-Q10 VanDerWaalsContact O-N 3.17Å; I7-H11 VanDerWaalsContact CG2-NE2 3.32Å; I7-H11 WeakPolarHBondContact CG2-NE2 3.37Å; I7-H11 PolarHBondContact O-CD2 2.78Å; I7-H11 PolarHBondContact O-N 2.99Å
8	L	94.5	Very high	93.5	Very high	100 Å²	100	108.5 Å²	108.5	52%	0.524	54%	0.544	S	S	.	.	H	α-helix	trans	-60.6	-40	177.7	-177.5	61.8	0	0	0	111.9	D4 H11 N12	D4-L8 WeakPolarHBondContact O-CB 3.45Å; D4-L8 PolarHBondContact O-N 3.02Å; L8-H11 PolarHBondContact O-N 3.22Å; L8-N12 WeakPolarHBondContact O-CB 3.49Å; L8-N12 PolarHBondContact O-N 3.35Å; L8-N12 PolarHBondContact O-ND2 3.46Å
9	Q	95.8	Very high	93.8	Very high	132 Å²	132	108.2 Å²	108.2	62%	0.617	54%	0.543	S	S	*	.	H	α-helix	trans	-64	-40.8	176	-173.6	179.9	7.1	0	0	112.2	A5 Q6 I7 T13	A5-Q9 WeakPolarHBondContact O-CB 3.47Å; A5-Q9 PolarHBondContact O-N 3.18Å; Q6-Q9 PolarHBondContact O-N 3.37Å; I7-Q9 VanDerWaalsContact C-N 3.3Å; I7-Q9 PolarHBondContact O-N 3.28Å; Q9-T13 WeakPolarHBondContact O-CB 3.47Å; Q9-T13 PolarHBondContact O-N 3.44Å; Q9-T13 PolarHBondContact O-OG1 3.5Å
10	Q	95.8	Very high	94	Very high	131 Å²	131	108.1 Å²	108.1	61%	0.612	54%	0.541	S	S	*	.	H	α-helix	trans	-63.1	-48.7	175.4	-72.5	175	-3.6	0	0	111.1	Q6 I7 N12 T13 E14	Q6-Q10 WeakPolarHBondContact O-CG 3.45Å; Q6-Q10 PolarHBondContact O-N 3.15Å; I7-Q10 WeakPolarHBondContact O-CB 3.47Å; I7-Q10 PolarHBondContact O-N 3.04Å; I7-Q10 VanDerWaalsContact O-N 3.17Å; Q10-N12 PolarHBondContact O-N 3.23Å; Q10-T13 WeakPolarHBondContact O-CB 3.32Å; Q10-T13 PolarHBondContact O-N 2.93Å; Q10-E14 PolarHBondContact O-N 3Å
11	H	96.1	Very high	94.2	Very high	98 Å²	98	106.7 Å²	106.7	45%	0.454	54%	0.535	S	S	.	.	H	α-helix	trans	-59.5	-45.4	176.2	-68.7	-29.5	0	0	0	112.3	I7 L8 T13 E14 L15	I7-H11 VanDerWaalsContact CG2-NE2 3.32Å; I7-H11 WeakPolarHBondContact CG2-NE2 3.37Å; I7-H11 PolarHBondContact O-CD2 2.78Å; I7-H11 PolarHBondContact O-N 2.99Å; L8-H11 PolarHBondContact O-N 3.22Å; H11-T13 VanDerWaalsContact C-N 3.28Å; H11-T13 PolarHBondContact O-N 3.17Å; H11-E14 PolarHBondContact O-N 3.25Å; H11-L15 WeakPolarHBondContact O-CB 3.3Å; H11-L15 VanDerWaalsContact O-CG 3.23Å; H11-L15 WeakPolarHBondContact O-CG 3.38Å; H11-L15 PolarHBondContact O-N 3.43Å
12	N	97.6	Very high	95.4	Very high	81 Å²	81	103.1 Å²	103.1	43%	0.433	52%	0.519	S	S	.	.	H	α-helix	trans	-60.7	-39	177	-73.4	-12.9	0	0	0	112	L8 Q10 V16	L8-N12 WeakPolarHBondContact O-CB 3.49Å; L8-N12 PolarHBondContact O-N 3.35Å; L8-N12 PolarHBondContact O-ND2 3.46Å; Q10-N12 PolarHBondContact O-N 3.23Å; N12-V16 VanDerWaalsContact O-CG2 3.3Å; N12-V16 WeakPolarHBondContact O-CG2 3.36Å; N12-V16 PolarHBondContact O-N 2.9Å
13	T	97.1	Very high	96.1	Very high	68 Å²	68	96.4 Å²	96.4	42%	0.417	50%	0.495	S	S	.	.	H	α-helix	trans	-65.6	-41.7	177.4	-55.9	0	0	0	0	111.5	Q9 Q10 H11 K17	Q9-T13 WeakPolarHBondContact O-CB 3.47Å; Q9-T13 PolarHBondContact O-N 3.44Å; Q9-T13 PolarHBondContact O-OG1 3.5Å; Q10-T13 WeakPolarHBondContact O-CB 3.32Å; Q10-T13 PolarHBondContact O-N 2.93Å; H11-T13 VanDerWaalsContact C-N 3.28Å; H11-T13 PolarHBondContact O-N 3.17Å; T13-K17 WeakPolarHBondContact O-CG 3.23Å; T13-K17 PolarHBondContact O-N 2.89Å
14	E	97.5	Very high	96.6	Very high	119 Å²	119	95.7 Å²	95.7	56%	0.556	49%	0.492	S	S	*	.	H	α-helix	trans	-68.5	-42.2	177.2	-171.8	172.6	-163.3	0	0	112	Q10 H11 V16 K17 L18	Q10-E14 PolarHBondContact O-N 3Å; H11-E14 PolarHBondContact O-N 3.25Å; E14-V16 PolarHBondContact O-N 3.05Å; E14-K17 PolarHBondContact O-N 3.46Å; E14-L18 HydrophobicContact CG-CD1 4.21Å; E14-L18 WeakPolarHBondContact O-CG 3.39Å; E14-L18 PolarHBondContact O-N 3.28Å
15	L	98	Very high	97	Very high	96 Å²	96	97.5 Å²	97.5	50%	0.503	50%	0.495	S	S	.	.	H	α-helix	trans	-59	-45.7	175.9	-73.6	170.9	0	0	0	111.9	H11 L18 I19	H11-L15 WeakPolarHBondContact O-CB 3.3Å; H11-L15 VanDerWaalsContact O-CG 3.23Å; H11-L15 WeakPolarHBondContact O-CG 3.38Å; H11-L15 PolarHBondContact O-N 3.43Å; L15-L18 PolarHBondContact O-N 2.85Å; L15-I19 VanDerWaalsContact O-CG1 3.27Å; L15-I19 WeakPolarHBondContact O-CG1 3.35Å; L15-I19 PolarHBondContact O-N 3.47Å
16	V	98	Very high	97.3	Very high	77 Å²	77	101.5 Å²	101.5	47%	0.467	50%	0.498	S	S	.	.	H	α-helix	trans	-60.9	-46.8	177.6	170.1	0	0	0	0	110.8	N12 E14 L18 I19 E20	N12-V16 VanDerWaalsContact O-CG2 3.3Å; N12-V16 WeakPolarHBondContact O-CG2 3.36Å; N12-V16 PolarHBondContact O-N 2.9Å; E14-V16 PolarHBondContact O-N 3.05Å; V16-L18 PolarHBondContact O-N 3.45Å; V16-I19 PolarHBondContact O-N 3.48Å; V16-E20 HydrophobicContact CG1-CG 4.41Å; V16-E20 WeakPolarHBondContact O-CG 3.32Å; V16-E20 PolarHBondContact O-N 2.92Å
17	K	97.9	Very high	97.5	Very high	124 Å²	124	99.6 Å²	99.6	54%	0.539	49%	0.491	S	S	.	.	H	α-helix	trans	-59.2	-45.5	177.6	-72.7	176	179.6	-178.1	0	112.3	T13 E14 I19 E20 D21	T13-K17 WeakPolarHBondContact O-CG 3.23Å; T13-K17 PolarHBondContact O-N 2.89Å; E14-K17 PolarHBondContact O-N 3.46Å; K17-I19 VanDerWaalsContact C-N 3.34Å; K17-I19 PolarHBondContact O-N 2.95Å; K17-E20 PolarHBondContact O-N 3.31Å; K17-D21 PolarHBondContact O-N 3.37Å
18	L	98	Very high	97.7	Very high	92 Å²	92	103 Å²	103	48%	0.482	51%	0.506	S	S	.	.	H	α-helix	trans	-64.6	-38.3	178.8	-70.6	173.8	0	0	0	112.2	E14 L15 V16 L22	E14-L18 HydrophobicContact CG-CD1 4.21Å; E14-L18 WeakPolarHBondContact O-CG 3.39Å; E14-L18 PolarHBondContact O-N 3.28Å; L15-L18 PolarHBondContact O-N 2.85Å; V16-L18 PolarHBondContact O-N 3.45Å; L18-L22 WeakPolarHBondContact O-CB 3.4Å; L18-L22 VanDerWaalsContact O-CG 3.26Å; L18-L22 WeakPolarHBondContact O-CG 3.35Å; L18-L22 PolarHBondContact O-N 3.27Å
19	I	98.1	Very high	97.9	Very high	102 Å²	102	103.4 Å²	103.4	52%	0.523	51%	0.508	S	S	.	.	H	α-helix	trans	-65.9	-44.4	175.3	-70	167.3	0	0	0	110.6	L15 V16 K17 L22 C23	L15-I19 VanDerWaalsContact O-CG1 3.27Å; L15-I19 WeakPolarHBondContact O-CG1 3.35Å; L15-I19 PolarHBondContact O-N 3.47Å; V16-I19 PolarHBondContact O-N 3.48Å; K17-I19 VanDerWaalsContact C-N 3.34Å; K17-I19 PolarHBondContact O-N 2.95Å; I19-L22 PolarHBondContact O-N 2.88Å; I19-C23 PolarHBondContact O-N 3.22Å; I19-C23 PolarHBondContact O-SG 3.41Å; I19-C23 VanDerWaalsContact O-SG 3.38Å
20	E	98.2	Very high	98	Very high	106 Å²	106	101.7 Å²	101.7	50%	0.495	50%	0.5	S	S	.	.	H	α-helix	trans	-59.7	-46.1	176.2	-74.8	175.8	177.2	0	0	111.5	V16 K17 L22 C23 Q24	V16-E20 HydrophobicContact CG1-CG 4.41Å; V16-E20 WeakPolarHBondContact O-CG 3.32Å; V16-E20 PolarHBondContact O-N 2.92Å; K17-E20 PolarHBondContact O-N 3.31Å; E20-L22 VanDerWaalsContact C-N 3.33Å; E20-L22 PolarHBondContact O-N 3.38Å; E20-C23 PolarHBondContact O-N 2.9Å; E20-Q24 WeakPolarHBondContact O-CG 3.26Å; E20-Q24 PolarHBondContact O-N 3.04Å
21	D	98.3	Very high	98.1	Very high	79 Å²	79	102 Å²	102	42%	0.422	50%	0.499	S	S	.	.	H	α-helix	trans	-59.6	-41.9	176.3	-75.5	-12.3	0	0	0	112	K17 Q24 K25	K17-D21 PolarHBondContact O-N 3.37Å; D21-Q24 PolarHBondContact O-N 2.97Å; D21-K25 WeakPolarHBondContact O-CG 3.5Å; D21-K25 PolarHBondContact O-N 3.43Å
22	L	98.6	Very high	98.2	Very high	118 Å²	118	99.1 Å²	99.1	62%	0.618	49%	0.493	S	S	*	.	H	α-helix	trans	-65.3	-42.9	176	-73.7	172	0	0	0	111.8	L18 I19 E20 K25 R26	L18-L22 WeakPolarHBondContact O-CB 3.4Å; L18-L22 VanDerWaalsContact O-CG 3.26Å; L18-L22 WeakPolarHBondContact O-CG 3.35Å; L18-L22 PolarHBondContact O-N 3.27Å; I19-L22 PolarHBondContact O-N 2.88Å; E20-L22 VanDerWaalsContact C-N 3.33Å; E20-L22 PolarHBondContact O-N 3.38Å; L22-K25 PolarHBondContact O-N 2.93Å; L22-R26 WeakPolarHBondContact O-CB 3.35Å; L22-R26 PolarHBondContact O-N 3.09Å
23	C	98.5	Very high	98.3	Very high	46 Å²	46	99.2 Å²	99.2	31%	0.311	49%	0.492	S	S	.	.	H	α-helix	trans	-61.7	-44.6	175.4	-73	0	0	0	0	111.5	I19 E20 K25 R26 D27	I19-C23 PolarHBondContact O-N 3.22Å; I19-C23 PolarHBondContact O-SG 3.41Å; I19-C23 VanDerWaalsContact O-SG 3.38Å; E20-C23 PolarHBondContact O-N 2.9Å; C23-K25 PolarHBondContact O-N 3.42Å; C23-R26 PolarHBondContact O-N 3Å; C23-D27 WeakPolarHBondContact O-CB 3.49Å; C23-D27 PolarHBondContact O-N 3.49Å
24	Q	98.5	Very high	98.4	Very high	109 Å²	109	100.1 Å²	100.1	51%	0.509	49%	0.494	S	S	.	.	H	α-helix	trans	-61.3	-45.4	177.1	-72.2	179.4	15	0	0	112	E20 D21 D27 Q28	E20-Q24 WeakPolarHBondContact O-CG 3.26Å; E20-Q24 PolarHBondContact O-N 3.04Å; D21-Q24 PolarHBondContact O-N 2.97Å; Q24-D27 PolarHBondContact O-N 3.26Å; Q24-Q28 VanDerWaalsContact O-CG 3.32Å; Q24-Q28 WeakPolarHBondContact O-CG 3.43Å; Q24-Q28 PolarHBondContact O-N 3.31Å
25	K	98.6	Very high	98.4	Very high	137 Å²	137	100.9 Å²	100.9	60%	0.596	50%	0.497	S	S	*	.	H	α-helix	trans	-62.6	-42.5	177	-75.2	175.1	-178.6	173.7	0	112.2	D21 L22 C23 D27 Q28 L29	D21-K25 WeakPolarHBondContact O-CG 3.5Å; D21-K25 PolarHBondContact O-N 3.43Å; L22-K25 PolarHBondContact O-N 2.93Å; C23-K25 PolarHBondContact O-N 3.42Å; K25-D27 VanDerWaalsContact C-N 3.33Å; K25-D27 PolarHBondContact O-N 3.33Å; K25-Q28 PolarHBondContact O-N 2.97Å; K25-L29 WeakPolarHBondContact O-CB 3.27Å; K25-L29 PolarHBondContact O-N 2.84Å
26	R	98.7	Very high	98.5	Very high	145 Å²	145	102.8 Å²	102.8	55%	0.547	50%	0.504	S	S	.	.	H	α-helix	trans	-58.9	-46	174.1	-179.5	-158.7	65.4	-158.9	-5	110.9	L22 C23 L29 Q30	L22-R26 WeakPolarHBondContact O-CB 3.35Å; L22-R26 PolarHBondContact O-N 3.09Å; C23-R26 PolarHBondContact O-N 3Å; R26-L29 PolarHBondContact O-N 2.95Å; R26-Q30 WeakPolarHBondContact O-CB 3.45Å; R26-Q30 PolarHBondContact O-N 2.94Å
27	D	98.6	Very high	98.5	Very high	74 Å²	74	102.3 Å²	102.3	40%	0.396	50%	0.498	S	S	.	.	H	α-helix	trans	-70	-34.4	-176.7	-65	-8.7	0	0	0	111.9	C23 Q24 K25 K31	C23-D27 WeakPolarHBondContact O-CB 3.49Å; C23-D27 PolarHBondContact O-N 3.49Å; Q24-D27 PolarHBondContact O-N 3.26Å; K25-D27 VanDerWaalsContact C-N 3.33Å; K25-D27 PolarHBondContact O-N 3.33Å; D27-K31 WeakPolarHBondContact O-CG 3.3Å; D27-K31 PolarHBondContact O-N 3.49Å; D27-K31 VanDerWaalsContact O-N 3.09Å
28	Q	98.6	Very high	98.5	Very high	128 Å²	128	100.1 Å²	100.1	60%	0.598	49%	0.493	S	S	*	.	H	α-helix	trans	-63.4	-47.6	170.5	-72.8	172.6	9.4	0	0	111.6	Q24 K25 Q30 K31 A32	Q24-Q28 VanDerWaalsContact O-CG 3.32Å; Q24-Q28 WeakPolarHBondContact O-CG 3.43Å; Q24-Q28 PolarHBondContact O-N 3.31Å; K25-Q28 PolarHBondContact O-N 2.97Å; Q28-Q30 VanDerWaalsContact C-N 3.32Å; Q28-Q30 PolarHBondContact O-N 3.45Å; Q28-K31 PolarHBondContact O-N 3.29Å; Q28-A32 PolarHBondContact O-N 3.08Å; Q28-A32 VanDerWaalsContact O-N 3.08Å
29	L	98.6	Very high	98.5	Very high	109 Å²	109	101.6 Å²	101.6	57%	0.571	50%	0.497	S	S	*	.	H	α-helix	trans	-61.5	-41.9	176.8	-179.8	62.5	0	0	0	111.4	K25 R26 K31 A32 I33	K25-L29 WeakPolarHBondContact O-CB 3.27Å; K25-L29 PolarHBondContact O-N 2.84Å; R26-L29 PolarHBondContact O-N 2.95Å; L29-K31 VanDerWaalsContact C-N 3.3Å; L29-K31 PolarHBondContact O-N 3.12Å; L29-A32 PolarHBondContact O-N 3.25Å; L29-I33 HydrophobicContact CD1-CD1 4.4Å; L29-I33 HydrophobicContact CD1-CG1 4.48Å; L29-I33 HydrophobicContact CG-CD1 4Å; L29-I33 VanDerWaalsContact O-CG1 3.32Å; L29-I33 WeakPolarHBondContact O-CG1 3.44Å; L29-I33 PolarHBondContact O-N 2.92Å
30	Q	98.6	Very high	98.6	Very high	97 Å²	97	101.2 Å²	101.2	45%	0.453	49%	0.492	S	S	.	.	H	α-helix	trans	-62.2	-37.4	177.9	-176	58.7	63.5	0	0	112.2	R26 Q28 I34	R26-Q30 WeakPolarHBondContact O-CB 3.45Å; R26-Q30 PolarHBondContact O-N 2.94Å; Q28-Q30 VanDerWaalsContact C-N 3.32Å; Q28-Q30 PolarHBondContact O-N 3.45Å; Q30-I34 HydrophobicContact CG-CD1 4.29Å; Q30-I34 WeakPolarHBondContact O-CD1 3.37Å; Q30-I34 VanDerWaalsContact O-CG1 3.3Å; Q30-I34 WeakPolarHBondContact O-CG1 3.45Å; Q30-I34 PolarHBondContact O-N 2.98Å
31	K	98.7	Very high	98.6	Very high	136 Å²	136	99.4 Å²	99.4	59%	0.591	49%	0.486	S	S	*	.	H	α-helix	trans	-64.7	-47.5	173.5	-73.4	173.6	-178.3	-178.6	0	111.5	D27 Q28 L29 I33 I34 E35	D27-K31 WeakPolarHBondContact O-CG 3.3Å; D27-K31 PolarHBondContact O-N 3.49Å; D27-K31 VanDerWaalsContact O-N 3.09Å; Q28-K31 PolarHBondContact O-N 3.29Å; L29-K31 VanDerWaalsContact C-N 3.3Å; L29-K31 PolarHBondContact O-N 3.12Å; K31-I33 VanDerWaalsContact C-N 3.31Å; K31-I33 PolarHBondContact O-N 3.38Å; K31-I34 PolarHBondContact O-N 3.4Å; K31-I34 VanDerWaalsContact O-N 3.12Å; K31-E35 WeakPolarHBondContact O-CG 3.48Å; K31-E35 PolarHBondContact O-N 3.4Å
32	A	98.6	Very high	98.6	Very high	39 Å²	39	103.9 Å²	103.9	32%	0.322	50%	0.496	S	S	.	.	H	α-helix	trans	-59.4	-41.7	177.5	0	0	0	0	0	112.1	Q28 L29 I34 E35 E36	Q28-A32 PolarHBondContact O-N 3.08Å; Q28-A32 VanDerWaalsContact O-N 3.08Å; L29-A32 PolarHBondContact O-N 3.25Å; A32-I34 VanDerWaalsContact C-N 3.31Å; A32-I34 PolarHBondContact O-N 2.93Å; A32-E35 PolarHBondContact O-N 3.08Å; A32-E36 WeakPolarHBondContact O-CG 3.34Å; A32-E36 PolarHBondContact O-N 3.19Å
33	I	98.7	Very high	98.6	Very high	82 Å²	82	103 Å²	103	42%	0.421	49%	0.492	S	S	.	.	H	α-helix	trans	-59.1	-42.4	175.4	-71.3	167.1	0	0	0	111.5	L29 K31 D37	L29-I33 HydrophobicContact CD1-CD1 4.4Å; L29-I33 HydrophobicContact CD1-CG1 4.48Å; L29-I33 HydrophobicContact CG-CD1 4Å; L29-I33 VanDerWaalsContact O-CG1 3.32Å; L29-I33 WeakPolarHBondContact O-CG1 3.44Å; L29-I33 PolarHBondContact O-N 2.92Å; K31-I33 VanDerWaalsContact C-N 3.31Å; K31-I33 PolarHBondContact O-N 3.38Å; I33-D37 WeakPolarHBondContact O-CB 3.46Å; I33-D37 PolarHBondContact O-N 2.95Å
34	I	98.7	Very high	98.6	Very high	87 Å²	87	106.1 Å²	106.1	45%	0.446	50%	0.502	S	S	.	.	H	α-helix	trans	-67.5	-43.8	179.4	-68.1	164.1	0	0	0	110.5	Q30 K31 A32 D37 D38	Q30-I34 HydrophobicContact CG-CD1 4.29Å; Q30-I34 WeakPolarHBondContact O-CD1 3.37Å; Q30-I34 VanDerWaalsContact O-CG1 3.3Å; Q30-I34 WeakPolarHBondContact O-CG1 3.45Å; Q30-I34 PolarHBondContact O-N 2.98Å; K31-I34 PolarHBondContact O-N 3.4Å; K31-I34 VanDerWaalsContact O-N 3.12Å; A32-I34 VanDerWaalsContact C-N 3.31Å; A32-I34 PolarHBondContact O-N 2.93Å; I34-D37 PolarHBondContact O-N 3.24Å; I34-D38 WeakPolarHBondContact O-CB 3.33Å; I34-D38 PolarHBondContact O-N 3.4Å
35	E	98.6	Very high	98.6	Very high	136 Å²	136	105.5 Å²	105.5	64%	0.636	50%	0.499	S	S	*	.	H	α-helix	trans	-61.3	-45	178.2	-71.2	172	-175.4	0	0	111.8	K31 A32 D38 E39	K31-E35 WeakPolarHBondContact O-CG 3.48Å; K31-E35 PolarHBondContact O-N 3.4Å; A32-E35 PolarHBondContact O-N 3.08Å; E35-D38 PolarHBondContact O-N 3.02Å; E35-E39 PolarHBondContact O-N 3.15Å
36	E	98.6	Very high	98.6	Very high	136 Å²	136	103 Å²	103	64%	0.636	49%	0.492	S	S	*	.	H	α-helix	trans	-67	-38.4	176.2	-73.3	-174.9	-176.1	0	0	112.6	A32 E39 K40	A32-E36 WeakPolarHBondContact O-CG 3.34Å; A32-E36 PolarHBondContact O-N 3.19Å; E36-E39 PolarHBondContact O-N 3.46Å; E36-K40 WeakPolarHBondContact O-CB 3.32Å; E36-K40 PolarHBondContact O-N 3.47Å
37	D	98.6	Very high	98.6	Very high	66 Å²	66	102.2 Å²	102.2	35%	0.353	50%	0.496	S	S	.	.	H	α-helix	trans	-65.9	-41.3	176.7	-164.5	72.5	0	0	0	111.5	I33 I34 K40 N41	I33-D37 WeakPolarHBondContact O-CB 3.46Å; I33-D37 PolarHBondContact O-N 2.95Å; I34-D37 PolarHBondContact O-N 3.24Å; D37-K40 PolarHBondContact O-N 3.33Å; D37-K40 WeakPolarHBondContact OD1-CE 3.41Å; D37-K40 IonicContact OD1-NZ 2.61Å; D37-K40 PolarHBondContact OD1-NZ 3.03Å; D37-N41 WeakPolarHBondContact O-CB 3.42Å; D37-N41 PolarHBondContact O-N 3.39Å; D37-N41 PolarHBondContact O-ND2 2.9Å; D37-N41 PolarHBondContact OD2-ND2 3.34Å
38	D	98.6	Very high	98.6	Very high	79 Å²	79	104.5 Å²	104.5	42%	0.422	50%	0.499	S	S	.	.	H	α-helix	trans	-61.7	-43.5	174.4	-83.2	-12.8	0	0	0	111.9	I34 E35 N41 R42	I34-D38 WeakPolarHBondContact O-CB 3.33Å; I34-D38 PolarHBondContact O-N 3.4Å; E35-D38 PolarHBondContact O-N 3.02Å; D38-N41 PolarHBondContact O-N 2.87Å; D38-R42 WeakPolarHBondContact O-CG 3.49Å; D38-R42 PolarHBondContact O-N 2.96Å; D38-R42 VanDerWaalsContact O-N 3.08Å
39	E	98.5	Very high	98.6	Very high	122 Å²	122	100.8 Å²	100.8	57%	0.57	48%	0.483	S	S	*	.	H	α-helix	trans	-63.7	-46.1	175.2	-175.3	174.2	-173.1	0	0	111.5	E35 E36 N41 R42 L43	E35-E39 PolarHBondContact O-N 3.15Å; E36-E39 PolarHBondContact O-N 3.46Å; E39-N41 VanDerWaalsContact C-N 3.29Å; E39-N41 PolarHBondContact O-N 3.05Å; E39-R42 WeakPolarHBondContact O-CB 3.34Å; E39-R42 PolarHBondContact O-N 3.4Å; E39-R42 VanDerWaalsContact O-N 3.15Å; E39-L43 HydrophobicContact CG-CD1 4.18Å; E39-L43 HydrophobicContact CG-CG 4.47Å; E39-L43 WeakPolarHBondContact O-CG 3.4Å; E39-L43 PolarHBondContact O-N 3.14Å
40	K	98.6	Very high	98.6	Very high	94 Å²	94	100.8 Å²	100.8	41%	0.409	48%	0.482	S	S	.	.	H	α-helix	trans	-56.1	-44.9	175.5	-177.1	-165.5	74.1	-161.7	0	111.2	E36 D37 R42 L43 Q44	E36-K40 WeakPolarHBondContact O-CB 3.32Å; E36-K40 PolarHBondContact O-N 3.47Å; D37-K40 PolarHBondContact O-N 3.33Å; D37-K40 WeakPolarHBondContact OD1-CE 3.41Å; D37-K40 IonicContact OD1-NZ 2.61Å; D37-K40 PolarHBondContact OD1-NZ 3.03Å; K40-R42 VanDerWaalsContact C-N 3.34Å; K40-R42 PolarHBondContact O-N 2.9Å; K40-L43 PolarHBondContact O-N 2.95Å; K40-Q44 WeakPolarHBondContact O-CB 3.37Å; K40-Q44 WeakPolarHBondContact O-CG 3.47Å; K40-Q44 PolarHBondContact O-N 3.35Å
41	N	98.6	Very high	98.6	Very high	69 Å²	69	99.3 Å²	99.3	37%	0.369	48%	0.482	S	S	.	.	H	α-helix	trans	-64.4	-38.2	180	-68.8	-29.9	0	0	0	111.6	D37 D38 E39 H45	D37-N41 WeakPolarHBondContact O-CB 3.42Å; D37-N41 PolarHBondContact O-N 3.39Å; D37-N41 PolarHBondContact O-ND2 2.9Å; D37-N41 PolarHBondContact OD2-ND2 3.34Å; D38-N41 PolarHBondContact O-N 2.87Å; E39-N41 VanDerWaalsContact C-N 3.29Å; E39-N41 PolarHBondContact O-N 3.05Å; N41-H45 PolarHBondContact O-N 2.98Å
42	R	98.6	Very high	98.6	Very high	172 Å²	172	96.9 Å²	96.9	65%	0.649	47%	0.473	S	S	*	.	H	α-helix	trans	-64.1	-47.4	173.1	-69.1	173.3	-166.8	-173.8	6.4	111.7	D38 E39 K40 Q44 H45 D46	D38-R42 WeakPolarHBondContact O-CG 3.49Å; D38-R42 PolarHBondContact O-N 2.96Å; D38-R42 VanDerWaalsContact O-N 3.08Å; E39-R42 WeakPolarHBondContact O-CB 3.34Å; E39-R42 PolarHBondContact O-N 3.4Å; E39-R42 VanDerWaalsContact O-N 3.15Å; K40-R42 VanDerWaalsContact C-N 3.34Å; K40-R42 PolarHBondContact O-N 2.9Å; R42-Q44 VanDerWaalsContact C-N 3.32Å; R42-Q44 PolarHBondContact O-N 2.61Å; R42-H45 WeakPolarHBondContact O-CB 3.41Å; R42-H45 PolarHBondContact O-N 2.92Å; R42-H45 VanDerWaalsContact O-N 3.14Å; R42-D46 PolarHBondContact O-N 3.3Å
43	L	98.7	Very high	98.6	Very high	101 Å²	101	101.2 Å²	101.2	53%	0.529	49%	0.485	S	S	.	.	H	α-helix	trans	-61.8	-39.4	178.1	-69.7	173.7	0	0	0	112.3	E39 K40 D46 M47	E39-L43 HydrophobicContact CG-CD1 4.18Å; E39-L43 HydrophobicContact CG-CG 4.47Å; E39-L43 WeakPolarHBondContact O-CG 3.4Å; E39-L43 PolarHBondContact O-N 3.14Å; K40-L43 PolarHBondContact O-N 2.95Å; L43-D46 PolarHBondContact O-N 3.46Å; L43-M47 VanDerWaalsContact O-CB 3.32Å; L43-M47 WeakPolarHBondContact O-CB 3.39Å; L43-M47 PolarHBondContact O-N 3.5Å
44	Q	98.6	Very high	98.6	Very high	111 Å²	111	102 Å²	102	52%	0.519	49%	0.489	S	S	.	.	H	α-helix	trans	-63.9	-40	174.4	-75.3	-178.9	-7.2	0	0	112.2	K40 R42 M47 R48	K40-Q44 WeakPolarHBondContact O-CB 3.37Å; K40-Q44 WeakPolarHBondContact O-CG 3.47Å; K40-Q44 PolarHBondContact O-N 3.35Å; R42-Q44 VanDerWaalsContact C-N 3.32Å; R42-Q44 PolarHBondContact O-N 2.61Å; Q44-M47 PolarHBondContact O-N 2.88Å; Q44-R48 PolarHBondContact O-N 3.35Å; Q44-R48 VanDerWaalsContact O-N 3.1Å
45	H	98.5	Very high	98.6	Very high	96 Å²	96	100.6 Å²	100.6	44%	0.444	49%	0.491	S	S	.	.	H	α-helix	trans	-63	-46.3	175.3	-174.8	83.3	0	0	0	111.9	N41 R42 R48 I49	N41-H45 PolarHBondContact O-N 2.98Å; R42-H45 WeakPolarHBondContact O-CB 3.41Å; R42-H45 PolarHBondContact O-N 2.92Å; R42-H45 VanDerWaalsContact O-N 3.14Å; H45-R48 PolarHBondContact CE1-NH2 3.23Å; H45-R48 VanDerWaalsContact CE1-NH2 3.3Å; H45-R48 WeakPolarHBondContact O-CB 3.42Å; H45-R48 PolarHBondContact O-N 3.3Å; H45-I49 WeakPolarHBondContact NE2-CD1 3.33Å; H45-I49 PolarHBondContact O-N 3.11Å; H45-I49 VanDerWaalsContact O-N 3.11Å
46	D	98.5	Very high	98.6	Very high	83 Å²	83	101.3 Å²	101.3	44%	0.444	49%	0.492	S	S	.	.	H	α-helix	trans	-64.2	-41.6	178.2	-72.7	-18	0	0	0	111.7	R42 L43 R48 I49 I50	R42-D46 PolarHBondContact O-N 3.3Å; L43-D46 PolarHBondContact O-N 3.46Å; D46-R48 VanDerWaalsContact C-N 3.28Å; D46-R48 PolarHBondContact O-N 3.1Å; D46-I49 PolarHBondContact O-N 3.49Å; D46-I49 VanDerWaalsContact O-N 3.15Å; D46-I50 WeakPolarHBondContact O-CG1 3.42Å; D46-I50 PolarHBondContact O-N 2.9Å
47	M	98.5	Very high	98.6	Very high	129 Å²	129	100 Å²	100	64%	0.635	49%	0.488	S	S	*	.	H	α-helix	trans	-57.6	-41.3	174.9	-174.9	178.1	-68.7	0	0	111.6	L43 Q44 I50 S51	L43-M47 VanDerWaalsContact O-CB 3.32Å; L43-M47 WeakPolarHBondContact O-CB 3.39Å; L43-M47 PolarHBondContact O-N 3.5Å; Q44-M47 PolarHBondContact O-N 2.88Å; M47-I50 PolarHBondContact O-N 3.41Å; M47-S51 VanDerWaalsContact O-CB 3.31Å; M47-S51 WeakPolarHBondContact O-CB 3.41Å; M47-S51 PolarHBondContact O-N 3.01Å; M47-S51 PolarHBondContact O-OG 3.15Å
48	R	98.5	Very high	98.6	Very high	123 Å²	123	100.9 Å²	100.9	46%	0.464	49%	0.493	S	S	.	.	H	α-helix	trans	-62.4	-47.3	174.7	-173.9	-174.1	62.6	86.9	1.4	111.6	Q44 H45 D46 I50 S51 E52	Q44-R48 PolarHBondContact O-N 3.35Å; Q44-R48 VanDerWaalsContact O-N 3.1Å; H45-R48 PolarHBondContact CE1-NH2 3.23Å; H45-R48 VanDerWaalsContact CE1-NH2 3.3Å; H45-R48 WeakPolarHBondContact O-CB 3.42Å; H45-R48 PolarHBondContact O-N 3.3Å; D46-R48 VanDerWaalsContact C-N 3.28Å; D46-R48 PolarHBondContact O-N 3.1Å; R48-I50 PolarHBondContact O-N 2.68Å; R48-S51 PolarHBondContact O-N 3.32Å; R48-E52 IonicContact CZ-OE1 3.46Å; R48-E52 IonicContact NH1-OE1 3.37Å; R48-E52 PolarHBondContact NH1-OE1 3.46Å; R48-E52 IonicContact NH1-OE2 3.39Å; R48-E52 WeakPolarHBondContact O-CG 3.43Å; R48-E52 PolarHBondContact O-N 2.85Å
49	I	98.6	Very high	98.6	Very high	49 Å²	49	101.1 Å²	101.1	25%	0.251	49%	0.494	S	S	.	.	H	α-helix	trans	-60.7	-45.4	178.8	-68.1	171.6	0	0	0	111.2	H45 D46 S51 E52 K53	H45-I49 WeakPolarHBondContact NE2-CD1 3.33Å; H45-I49 PolarHBondContact O-N 3.11Å; H45-I49 VanDerWaalsContact O-N 3.11Å; D46-I49 PolarHBondContact O-N 3.49Å; D46-I49 VanDerWaalsContact O-N 3.15Å; I49-S51 VanDerWaalsContact C-N 3.33Å; I49-E52 PolarHBondContact O-N 3.24Å; I49-K53 HydrophobicContact CG2-CD 4.15Å; I49-K53 WeakPolarHBondContact O-CG 3.38Å; I49-K53 PolarHBondContact O-N 3.37Å
50	I	98.6	Very high	98.6	Very high	109 Å²	109	97.5 Å²	97.5	56%	0.559	48%	0.482	S	S	*	.	H	α-helix	trans	-63.4	-42.4	179	-68.3	167.3	0	0	0	110.3	D46 M47 R48 E52 K53 L54	D46-I50 WeakPolarHBondContact O-CG1 3.42Å; D46-I50 PolarHBondContact O-N 2.9Å; M47-I50 PolarHBondContact O-N 3.41Å; R48-I50 PolarHBondContact O-N 2.68Å; I50-E52 PolarHBondContact O-N 2.98Å; I50-K53 PolarHBondContact O-N 2.97Å; I50-L54 WeakPolarHBondContact O-CB 3.32Å; I50-L54 PolarHBondContact O-N 2.93Å
51	S	98.7	Very high	98.6	Very high	66 Å²	66	97.4 Å²	97.4	46%	0.462	49%	0.486	S	S	.	.	H	α-helix	trans	-61.5	-42.6	177.5	-60.3	0	0	0	0	111.8	M47 R48 I49 L54 A55	M47-S51 VanDerWaalsContact O-CB 3.31Å; M47-S51 WeakPolarHBondContact O-CB 3.41Å; M47-S51 PolarHBondContact O-N 3.01Å; M47-S51 PolarHBondContact O-OG 3.15Å; R48-S51 PolarHBondContact O-N 3.32Å; I49-S51 VanDerWaalsContact C-N 3.33Å; S51-L54 PolarHBondContact O-N 2.73Å; S51-A55 WeakPolarHBondContact O-CB 3.38Å; S51-A55 PolarHBondContact O-N 3.39Å
52	E	98.6	Very high	98.6	Very high	85 Å²	85	97.3 Å²	97.3	40%	0.397	49%	0.491	S	S	.	.	H	α-helix	trans	-64.1	-41.9	174.9	-72.8	172.4	-164.3	0	0	112.4	R48 I49 I50 A55 K56	R48-E52 IonicContact CZ-OE1 3.46Å; R48-E52 IonicContact NH1-OE1 3.37Å; R48-E52 PolarHBondContact NH1-OE1 3.46Å; R48-E52 IonicContact NH1-OE2 3.39Å; R48-E52 WeakPolarHBondContact O-CG 3.43Å; R48-E52 PolarHBondContact O-N 2.85Å; I49-E52 PolarHBondContact O-N 3.24Å; I50-E52 PolarHBondContact O-N 2.98Å; E52-A55 PolarHBondContact O-N 3.22Å; E52-K56 WeakPolarHBondContact O-CG 3.31Å; E52-K56 PolarHBondContact O-N 3.34Å; E52-K56 VanDerWaalsContact O-N 3.07Å
53	K	98.7	Very high	98.6	Very high	131 Å²	131	94.8 Å²	94.8	57%	0.57	48%	0.484	S	S	*	.	H	α-helix	trans	-63.2	-44.2	175.5	-74.5	175.2	179.2	177	0	111.3	I49 I50 K56 I57	I49-K53 HydrophobicContact CG2-CD 4.15Å; I49-K53 WeakPolarHBondContact O-CG 3.38Å; I49-K53 PolarHBondContact O-N 3.37Å; I50-K53 PolarHBondContact O-N 2.97Å; K53-K56 PolarHBondContact O-N 2.93Å; K53-I57 WeakPolarHBondContact O-CG1 3.39Å; K53-I57 PolarHBondContact O-N 3.27Å
54	L	98.7	Very high	98.6	Very high	97 Å²	97	96.6 Å²	96.6	51%	0.508	49%	0.488	S	S	.	.	H	α-helix	trans	-61.8	-44.6	177.4	-178.6	61.4	0	0	0	111.2	I50 S51 K56 I57 N58	I50-L54 WeakPolarHBondContact O-CB 3.32Å; I50-L54 PolarHBondContact O-N 2.93Å; S51-L54 PolarHBondContact O-N 2.73Å; L54-K56 VanDerWaalsContact C-N 3.35Å; L54-K56 PolarHBondContact O-N 3.07Å; L54-I57 PolarHBondContact O-N 3.44Å; L54-N58 WeakPolarHBondContact O-CB 3.47Å; L54-N58 PolarHBondContact O-N 3.48Å; L54-N58 PolarHBondContact O-ND2 3.49Å
55	A	98.7	Very high	98.6	Very high	58 Å²	58	95.2 Å²	95.2	48%	0.479	48%	0.484	S	S	.	.	H	α-helix	trans	-59.3	-43.7	176.3	0	0	0	0	0	112.1	S51 E52 I57 N58 D59	S51-A55 WeakPolarHBondContact O-CB 3.38Å; S51-A55 PolarHBondContact O-N 3.39Å; E52-A55 PolarHBondContact O-N 3.22Å; A55-I57 PolarHBondContact O-N 2.89Å; A55-N58 PolarHBondContact O-N 3.02Å; A55-D59 PolarHBondContact O-N 3.01Å
56	K	98.7	Very high	98.6	Very high	151 Å²	151	94.9 Å²	94.9	66%	0.657	49%	0.488	S	S	*	.	H	α-helix	trans	-61.9	-42	175.4	-73	174.5	-179	175.7	0	112.5	E52 K53 L54 S60	E52-K56 WeakPolarHBondContact O-CG 3.31Å; E52-K56 PolarHBondContact O-N 3.34Å; E52-K56 VanDerWaalsContact O-N 3.07Å; K53-K56 PolarHBondContact O-N 2.93Å; L54-K56 VanDerWaalsContact C-N 3.35Å; L54-K56 PolarHBondContact O-N 3.07Å; K56-S60 WeakPolarHBondContact O-CB 3.33Å; K56-S60 PolarHBondContact O-N 3.43Å
57	I	98.7	Very high	98.7	Very high	108 Å²	108	94.6 Å²	94.6	55%	0.554	49%	0.489	S	S	*	.	H	α-helix	trans	-65	-44.3	177	-70.3	169.3	0	0	0	110.5	K53 L54 A55 D59 S60 L61	K53-I57 WeakPolarHBondContact O-CG1 3.39Å; K53-I57 PolarHBondContact O-N 3.27Å; L54-I57 PolarHBondContact O-N 3.44Å; A55-I57 PolarHBondContact O-N 2.89Å; I57-D59 PolarHBondContact O-N 3.49Å; I57-S60 PolarHBondContact O-N 3.39Å; I57-L61 VanDerWaalsContact O-CB 3.29Å; I57-L61 WeakPolarHBondContact O-CB 3.27Å; I57-L61 PolarHBondContact O-N 2.79Å
58	N	98.7	Very high	98.7	Very high	86 Å²	86	94.5 Å²	94.5	46%	0.46	48%	0.482	S	S	.	.	H	α-helix	trans	-61.2	-44.8	179	-74.9	-19.8	0	0	0	112.1	L54 A55 L61 S62	L54-N58 WeakPolarHBondContact O-CB 3.47Å; L54-N58 PolarHBondContact O-N 3.48Å; L54-N58 PolarHBondContact O-ND2 3.49Å; A55-N58 PolarHBondContact O-N 3.02Å; N58-L61 PolarHBondContact O-N 3.48Å; N58-S62 WeakPolarHBondContact O-CB 3.35Å; N58-S62 PolarHBondContact O-N 2.89Å
59	D	98.6	Very high	98.7	Very high	84 Å²	84	92.6 Å²	92.6	45%	0.449	48%	0.481	S	S	.	.	H	α-helix	trans	-61.5	-46.3	174.5	175.4	63.4	0	0	0	111.6	A55 I57 L61 S62 K63	A55-D59 PolarHBondContact O-N 3.01Å; I57-D59 PolarHBondContact O-N 3.49Å; D59-L61 VanDerWaalsContact C-N 3.34Å; D59-L61 PolarHBondContact O-N 3.24Å; D59-S62 PolarHBondContact O-N 2.89Å; D59-K63 WeakPolarHBondContact O-CG 3.36Å; D59-K63 PolarHBondContact O-N 3.43Å; D59-K63 VanDerWaalsContact OD1-CE 3.27Å; D59-K63 WeakPolarHBondContact OD1-CE 3.29Å; D59-K63 IonicContact OD1-NZ 3.86Å; D59-K63 PolarHBondContact OD1-NZ 3.26Å; D59-K63 WeakPolarHBondContact OD2-CE 3.48Å; D59-K63 IonicContact OD2-NZ 2.7Å; D59-K63 PolarHBondContact OD2-NZ 2.67Å
60	S	98.7	Very high	98.7	Very high	46 Å²	46	93.7 Å²	93.7	32%	0.322	49%	0.493	S	S	.	.	H	α-helix	trans	-62	-40.6	176.7	179.8	0	0	0	0	112.5	K56 I57 K64	K56-S60 WeakPolarHBondContact O-CB 3.33Å; K56-S60 PolarHBondContact O-N 3.43Å; I57-S60 PolarHBondContact O-N 3.39Å; S60-K64 VanDerWaalsContact O-CG 3.3Å; S60-K64 WeakPolarHBondContact O-CG 3.05Å; S60-K64 PolarHBondContact O-N 3.03Å
61	L	98.7	Very high	98.7	Very high	92 Å²	92	96 Å²	96	48%	0.482	50%	0.496	S	S	.	.	H	α-helix	trans	-67.2	-44.8	179.9	-176.9	61.4	0	0	0	110.9	I57 N58 D59 K63 K64 L65	I57-L61 VanDerWaalsContact O-CB 3.29Å; I57-L61 WeakPolarHBondContact O-CB 3.27Å; I57-L61 PolarHBondContact O-N 2.79Å; N58-L61 PolarHBondContact O-N 3.48Å; D59-L61 VanDerWaalsContact C-N 3.34Å; D59-L61 PolarHBondContact O-N 3.24Å; L61-K63 VanDerWaalsContact C-N 3.34Å; L61-K63 PolarHBondContact O-N 3.2Å; L61-K64 PolarHBondContact O-N 3.43Å; L61-L65 HydrophobicContact CG-CD1 4.23Å; L61-L65 WeakPolarHBondContact O-CG 3.3Å; L61-L65 PolarHBondContact O-N 2.92Å
62	S	98.7	Very high	98.7	Very high	67 Å²	67	96.1 Å²	96.1	47%	0.469	49%	0.491	S	S	.	.	H	α-helix	trans	-55.3	-48.9	174.7	-177	0	0	0	0	111.4	N58 D59 K64 L65 V66	N58-S62 WeakPolarHBondContact O-CB 3.35Å; N58-S62 PolarHBondContact O-N 2.89Å; D59-S62 PolarHBondContact O-N 2.89Å; S62-K64 PolarHBondContact O-N 3.43Å; S62-L65 PolarHBondContact O-N 3.42Å; S62-V66 WeakPolarHBondContact O-CG2 3.38Å; S62-V66 PolarHBondContact O-N 3.46Å
63	K	98.7	Very high	98.7	Very high	119 Å²	119	98.3 Å²	98.3	52%	0.517	50%	0.5	S	S	.	.	H	α-helix	trans	-59.2	-45.3	176.1	-71.6	168.8	179	167.2	0	112.5	D59 L61 L65 V66 V67	D59-K63 WeakPolarHBondContact O-CG 3.36Å; D59-K63 PolarHBondContact O-N 3.43Å; D59-K63 VanDerWaalsContact OD1-CE 3.27Å; D59-K63 WeakPolarHBondContact OD1-CE 3.29Å; D59-K63 IonicContact OD1-NZ 3.86Å; D59-K63 PolarHBondContact OD1-NZ 3.26Å; D59-K63 WeakPolarHBondContact OD2-CE 3.48Å; D59-K63 IonicContact OD2-NZ 2.7Å; D59-K63 PolarHBondContact OD2-NZ 2.67Å; L61-K63 VanDerWaalsContact C-N 3.34Å; L61-K63 PolarHBondContact O-N 3.2Å; K63-L65 VanDerWaalsContact C-N 3.35Å; K63-L65 PolarHBondContact O-N 3.36Å; K63-V66 PolarHBondContact O-N 2.7Å; K63-V67 WeakPolarHBondContact O-CG2 3.37Å; K63-V67 PolarHBondContact O-N 3.46Å
64	K	98.8	Very high	98.7	Very high	139 Å²	139	94.2 Å²	94.2	60%	0.604	49%	0.49	S	S	*	.	H	α-helix	trans	-62.8	-40	177.8	-74.2	174.5	-177.4	-179.6	0	112.1	S60 L61 S62 V67 R68	S60-K64 VanDerWaalsContact O-CG 3.3Å; S60-K64 WeakPolarHBondContact O-CG 3.05Å; S60-K64 PolarHBondContact O-N 3.03Å; L61-K64 PolarHBondContact O-N 3.43Å; S62-K64 PolarHBondContact O-N 3.43Å; K64-V67 PolarHBondContact O-N 3.06Å; K64-R68 WeakPolarHBondContact O-CB 3.38Å; K64-R68 PolarHBondContact O-N 3.41Å
65	L	98.7	Very high	98.7	Very high	82 Å²	82	93.7 Å²	93.7	43%	0.429	49%	0.487	S	S	.	.	H	α-helix	trans	-63.7	-43.7	176.9	-74.5	170.4	0	0	0	111.6	L61 S62 K63 R68 N69	L61-L65 HydrophobicContact CG-CD1 4.23Å; L61-L65 WeakPolarHBondContact O-CG 3.3Å; L61-L65 PolarHBondContact O-N 2.92Å; S62-L65 PolarHBondContact O-N 3.42Å; K63-L65 VanDerWaalsContact C-N 3.35Å; K63-L65 PolarHBondContact O-N 3.36Å; L65-R68 PolarHBondContact O-N 3.03Å; L65-N69 WeakPolarHBondContact O-CB 3.42Å; L65-N69 PolarHBondContact O-N 3.16Å; L65-N69 PolarHBondContact O-OD1 3.32Å
66	V	98.7	Very high	98.7	Very high	88 Å²	88	93.4 Å²	93.4	53%	0.533	49%	0.485	S	S	.	.	H	α-helix	trans	-59.4	-49.5	175.9	172.4	0	0	0	0	110.8	S62 K63 R68 N69 S70	S62-V66 WeakPolarHBondContact O-CG2 3.38Å; S62-V66 PolarHBondContact O-N 3.46Å; K63-V66 PolarHBondContact O-N 2.7Å; V66-R68 PolarHBondContact O-N 3.23Å; V66-N69 PolarHBondContact O-N 3.05Å; V66-S70 PolarHBondContact O-N 3.13Å; V66-S70 PolarHBondContact O-OG 3.43Å
67	V	98.7	Very high	98.7	Very high	78 Å²	78	91.1 Å²	91.1	47%	0.473	48%	0.476	S	S	.	.	H	α-helix	trans	-61.2	-44.5	178.8	170.7	0	0	0	0	111.4	K63 K64 N69 S70 Y71	K63-V67 WeakPolarHBondContact O-CG2 3.37Å; K63-V67 PolarHBondContact O-N 3.46Å; K64-V67 PolarHBondContact O-N 3.06Å; V67-N69 VanDerWaalsContact C-N 3.33Å; V67-N69 PolarHBondContact O-N 3.37Å; V67-S70 WeakPolarHBondContact O-CB 3.26Å; V67-S70 PolarHBondContact O-N 3.06Å; V67-S70 VanDerWaalsContact O-N 3.13Å; V67-Y71 HydrophobicContact CG1-CD2 3.85Å; V67-Y71 HydrophobicContact CG1-CE2 3.51Å; V67-Y71 VanDerWaalsContact O-CD2 3.26Å; V67-Y71 WeakPolarHBondContact O-CD2 3.46Å; V67-Y71 PolarHBondContact O-N 3.21Å
68	R	98.7	Very high	98.7	Very high	126 Å²	126	89.7 Å²	89.7	48%	0.475	48%	0.476	S	S	.	.	H	α-helix	trans	-58.6	-45.4	175.9	-172.6	-77.7	-58.1	-148.8	-8	111.1	K64 L65 V66 S70 Y71 D72	K64-R68 WeakPolarHBondContact O-CB 3.38Å; K64-R68 PolarHBondContact O-N 3.41Å; L65-R68 PolarHBondContact O-N 3.03Å; V66-R68 PolarHBondContact O-N 3.23Å; R68-S70 VanDerWaalsContact C-N 3.25Å; R68-S70 PolarHBondContact O-N 3.35Å; R68-Y71 WeakPolarHBondContact O-CB 3.26Å; R68-Y71 PolarHBondContact O-N 2.91Å; R68-Y71 VanDerWaalsContact O-N 3.08Å; R68-D72 WeakPolarHBondContact CD-OD2 3.39Å; R68-D72 IonicContact CZ-OD2 3.69Å; R68-D72 IonicContact NE-OD2 3.76Å; R68-D72 PolarHBondContact NE-OD2 3.04Å; R68-D72 IonicContact NH1-OD2 2.68Å; R68-D72 PolarHBondContact NH1-OD2 2.86Å; R68-D72 PolarHBondContact O-N 3.27Å
69	N	98.6	Very high	98.7	Very high	83 Å²	83	91.5 Å²	91.5	44%	0.444	48%	0.482	S	S	.	.	H	α-helix	trans	-62.5	-33.7	177.7	-66.5	-7.4	0	0	0	112.1	L65 V66 V67 D72 K73	L65-N69 WeakPolarHBondContact O-CB 3.42Å; L65-N69 PolarHBondContact O-N 3.16Å; L65-N69 PolarHBondContact O-OD1 3.32Å; V66-N69 PolarHBondContact O-N 3.05Å; V67-N69 VanDerWaalsContact C-N 3.33Å; V67-N69 PolarHBondContact O-N 3.37Å; N69-D72 PolarHBondContact O-N 2.93Å; N69-K73 WeakPolarHBondContact O-CB 3.42Å; N69-K73 PolarHBondContact O-N 2.75Å
70	S	98.6	Very high	98.7	Very high	73 Å²	73	93.4 Å²	93.4	51%	0.51	49%	0.488	S	S	.	.	H	α-helix	trans	-65.2	-40.8	172.4	-56.2	0	0	0	0	112.3	V66 V67 R68 K73 A74	V66-S70 PolarHBondContact O-N 3.13Å; V66-S70 PolarHBondContact O-OG 3.43Å; V67-S70 WeakPolarHBondContact O-CB 3.26Å; V67-S70 PolarHBondContact O-N 3.06Å; V67-S70 VanDerWaalsContact O-N 3.13Å; R68-S70 VanDerWaalsContact C-N 3.25Å; R68-S70 PolarHBondContact O-N 3.35Å; S70-K73 PolarHBondContact O-N 3.41Å; S70-A74 WeakPolarHBondContact O-CB 3.48Å; S70-A74 PolarHBondContact O-N 2.99Å
71	Y	98.7	Very high	98.6	Very high	156 Å²	156	93.7 Å²	93.7	61%	0.612	49%	0.493	S	S	*	.	H	α-helix	trans	-62.6	-46.9	172.6	-78.4	-69.5	0	0	0	111.9	V67 R68 K73 A74 I75	V67-Y71 HydrophobicContact CG1-CD2 3.85Å; V67-Y71 HydrophobicContact CG1-CE2 3.51Å; V67-Y71 VanDerWaalsContact O-CD2 3.26Å; V67-Y71 WeakPolarHBondContact O-CD2 3.46Å; V67-Y71 PolarHBondContact O-N 3.21Å; R68-Y71 WeakPolarHBondContact O-CB 3.26Å; R68-Y71 PolarHBondContact O-N 2.91Å; R68-Y71 VanDerWaalsContact O-N 3.08Å; Y71-K73 VanDerWaalsContact C-N 3.26Å; Y71-K73 PolarHBondContact O-N 3.48Å; Y71-A74 PolarHBondContact O-N 3.08Å; Y71-A74 VanDerWaalsContact O-N 3.16Å; Y71-I75 WeakPolarHBondContact O-CB 3.48Å; Y71-I75 VanDerWaalsContact O-CG1 3.26Å; Y71-I75 WeakPolarHBondContact O-CG1 3.35Å; Y71-I75 PolarHBondContact O-N 3.32Å
72	D	98.8	Very high	98.6	Very high	70 Å²	70	97 Å²	97	37%	0.374	50%	0.5	S	S	.	.	H	α-helix	trans	-56.9	-43.5	178.1	-71.1	-10.9	0	0	0	111.1	R68 N69 I75 A76	R68-D72 WeakPolarHBondContact CD-OD2 3.39Å; R68-D72 IonicContact CZ-OD2 3.69Å; R68-D72 IonicContact NE-OD2 3.76Å; R68-D72 PolarHBondContact NE-OD2 3.04Å; R68-D72 IonicContact NH1-OD2 2.68Å; R68-D72 PolarHBondContact NH1-OD2 2.86Å; R68-D72 PolarHBondContact O-N 3.27Å; N69-D72 PolarHBondContact O-N 2.93Å; D72-I75 PolarHBondContact O-N 3.27Å; D72-A76 WeakPolarHBondContact O-CB 3.46Å; D72-A76 PolarHBondContact O-N 3.43Å
73	K	98.7	Very high	98.6	Very high	131 Å²	131	97.3 Å²	97.3	57%	0.57	50%	0.502	S	S	*	.	H	α-helix	trans	-62	-49.2	175.6	-178.3	175.5	173.1	179.5	0	111.9	N69 S70 Y71 I75 A76 E77	N69-K73 WeakPolarHBondContact O-CB 3.42Å; N69-K73 PolarHBondContact O-N 2.75Å; S70-K73 PolarHBondContact O-N 3.41Å; Y71-K73 VanDerWaalsContact C-N 3.26Å; Y71-K73 PolarHBondContact O-N 3.48Å; K73-I75 VanDerWaalsContact C-N 3.31Å; K73-I75 PolarHBondContact O-N 3.45Å; K73-A76 PolarHBondContact O-N 3.47Å; K73-E77 WeakPolarHBondContact CE-OE1 3.41Å; K73-E77 HydrophobicContact CG-CG 4.46Å; K73-E77 IonicContact NZ-OE1 2.73Å; K73-E77 WeakPolarHBondContact O-CB 3.5Å; K73-E77 WeakPolarHBondContact O-CG 3.3Å; K73-E77 PolarHBondContact O-N 2.98Å
74	A	98.6	Very high	98.6	Very high	44 Å²	44	97.3 Å²	97.3	36%	0.364	50%	0.502	S	S	.	.	H	α-helix	trans	-62.5	-38.5	179.9	0	0	0	0	0	112.5	S70 Y71 S78	S70-A74 WeakPolarHBondContact O-CB 3.48Å; S70-A74 PolarHBondContact O-N 2.99Å; Y71-A74 PolarHBondContact O-N 3.08Å; Y71-A74 VanDerWaalsContact O-N 3.16Å; A74-S78 VanDerWaalsContact O-CB 3.3Å; A74-S78 WeakPolarHBondContact O-CB 3.39Å; A74-S78 PolarHBondContact O-N 2.93Å; A74-S78 PolarHBondContact O-OG 2.96Å
75	I	98.7	Very high	98.6	Very high	86 Å²	86	96 Å²	96	44%	0.441	50%	0.501	S	S	.	.	H	α-helix	trans	-63.9	-49.4	175.1	-69.7	165.5	0	0	0	110	Y71 D72 K73 E77 S78 Q79	Y71-I75 WeakPolarHBondContact O-CB 3.48Å; Y71-I75 VanDerWaalsContact O-CG1 3.26Å; Y71-I75 WeakPolarHBondContact O-CG1 3.35Å; Y71-I75 PolarHBondContact O-N 3.32Å; D72-I75 PolarHBondContact O-N 3.27Å; K73-I75 VanDerWaalsContact C-N 3.31Å; K73-I75 PolarHBondContact O-N 3.45Å; I75-E77 PolarHBondContact O-N 3.03Å; I75-S78 PolarHBondContact O-N 2.92Å; I75-Q79 HydrophobicContact CG2-CG 4.31Å; I75-Q79 WeakPolarHBondContact O-CB 3.38Å; I75-Q79 VanDerWaalsContact O-CG 3.28Å; I75-Q79 WeakPolarHBondContact O-CG 2.83Å; I75-Q79 PolarHBondContact O-N 3.46Å
76	A	98.7	Very high	98.5	Very high	53 Å²	53	97 Å²	97	44%	0.438	51%	0.507	S	S	.	.	H	α-helix	trans	-60.9	-44	179.8	0	0	0	0	0	112.1	D72 K73 Q79 Q80	D72-A76 WeakPolarHBondContact O-CB 3.46Å; D72-A76 PolarHBondContact O-N 3.43Å; K73-A76 PolarHBondContact O-N 3.47Å; A76-Q79 PolarHBondContact O-N 3.26Å; A76-Q80 WeakPolarHBondContact O-CB 3.28Å; A76-Q80 PolarHBondContact O-N 2.86Å
77	E	98.6	Very high	98.5	Very high	103 Å²	103	98.9 Å²	98.9	48%	0.481	51%	0.509	S	S	.	.	H	α-helix	trans	-62.4	-43.7	176.2	-73.2	174	174.4	0	0	111.6	K73 I75 Q80 A81	K73-E77 WeakPolarHBondContact CE-OE1 3.41Å; K73-E77 HydrophobicContact CG-CG 4.46Å; K73-E77 IonicContact NZ-OE1 2.73Å; K73-E77 WeakPolarHBondContact O-CB 3.5Å; K73-E77 WeakPolarHBondContact O-CG 3.3Å; K73-E77 PolarHBondContact O-N 2.98Å; I75-E77 PolarHBondContact O-N 3.03Å; E77-Q80 PolarHBondContact O-N 2.96Å; E77-A81 WeakPolarHBondContact O-CB 3.45Å; E77-A81 PolarHBondContact O-N 2.95Å
78	S	98.4	Very high	98.4	Very high	78 Å²	78	100 Å²	100	55%	0.545	51%	0.513	S	S	.	.	H	α-helix	trans	-65.2	-43.1	177.9	-59.9	0	0	0	0	112.1	A74 I75 Q80 A81 Y82	A74-S78 VanDerWaalsContact O-CB 3.3Å; A74-S78 WeakPolarHBondContact O-CB 3.39Å; A74-S78 PolarHBondContact O-N 2.93Å; A74-S78 PolarHBondContact O-OG 2.96Å; I75-S78 PolarHBondContact O-N 2.92Å; S78-Q80 VanDerWaalsContact C-N 3.35Å; S78-A81 PolarHBondContact O-N 3.11Å; S78-Y82 WeakPolarHBondContact O-CB 3.5Å; S78-Y82 PolarHBondContact O-N 2.9Å
79	Q	98.5	Very high	98.4	Very high	124 Å²	124	97 Å²	97	58%	0.579	51%	0.511	S	S	*	.	H	α-helix	trans	-63	-41.5	175.7	-74.6	174.4	-16.2	0	0	111.4	I75 A76 Y82 S83	I75-Q79 HydrophobicContact CG2-CG 4.31Å; I75-Q79 WeakPolarHBondContact O-CB 3.38Å; I75-Q79 VanDerWaalsContact O-CG 3.28Å; I75-Q79 WeakPolarHBondContact O-CG 2.83Å; I75-Q79 PolarHBondContact O-N 3.46Å; A76-Q79 PolarHBondContact O-N 3.26Å; Q79-Y82 PolarHBondContact O-N 3.1Å; Q79-S83 PolarHBondContact O-N 2.94Å; Q79-S83 PolarHBondContact O-OG 3.33Å; Q79-S83 VanDerWaalsContact O-OG 3.13Å
80	Q	98.6	Very high	98.3	Very high	123 Å²	123	100 Å²	100	58%	0.575	52%	0.517	S	S	*	.	H	α-helix	trans	-63.6	-43.6	176.1	-173	-176.6	63.9	0	0	111.6	A76 E77 S78 S83 K84	A76-Q80 WeakPolarHBondContact O-CB 3.28Å; A76-Q80 PolarHBondContact O-N 2.86Å; E77-Q80 PolarHBondContact O-N 2.96Å; S78-Q80 VanDerWaalsContact C-N 3.35Å; Q80-S83 PolarHBondContact O-N 3.22Å; Q80-K84 PolarHBondContact O-N 3.44Å
81	A	98.4	Very high	98.3	Very high	52 Å²	52	100.2 Å²	100.2	43%	0.43	52%	0.515	S	S	.	.	H	α-helix	trans	-62.4	-43.3	176	0	0	0	0	0	111.6	E77 S78 K84 L85	E77-A81 WeakPolarHBondContact O-CB 3.45Å; E77-A81 PolarHBondContact O-N 2.95Å; S78-A81 PolarHBondContact O-N 3.11Å; A81-K84 WeakPolarHBondContact O-CB 3.41Å; A81-K84 PolarHBondContact O-N 3.36Å; A81-L85 PolarHBondContact O-N 3.36Å; A81-L85 VanDerWaalsContact O-N 3.1Å
82	Y	98.3	Very high	98.3	Very high	162 Å²	162	97.9 Å²	97.9	64%	0.635	51%	0.513	S	S	*	.	H	α-helix	trans	-63	-42.4	177.6	-172.6	-99.8	0	0	0	112.5	S78 Q79 K84 L85 L86	S78-Y82 WeakPolarHBondContact O-CB 3.5Å; S78-Y82 PolarHBondContact O-N 2.9Å; Q79-Y82 PolarHBondContact O-N 3.1Å; Y82-K84 VanDerWaalsContact C-N 3.29Å; Y82-K84 PolarHBondContact O-N 3.26Å; Y82-L85 WeakPolarHBondContact O-CB 3.48Å; Y82-L85 PolarHBondContact O-N 3.34Å; Y82-L85 VanDerWaalsContact O-N 3.11Å; Y82-L86 PolarHBondContact O-N 2.67Å
83	S	98.4	Very high	98.2	Very high	73 Å²	73	98.7 Å²	98.7	51%	0.51	52%	0.516	S	S	.	.	H	α-helix	trans	-59	-39.2	175	-66.9	0	0	0	0	112.5	Q79 Q80 L86 E87	Q79-S83 PolarHBondContact O-N 2.94Å; Q79-S83 PolarHBondContact O-OG 3.33Å; Q79-S83 VanDerWaalsContact O-OG 3.13Å; Q80-S83 PolarHBondContact O-N 3.22Å; S83-L86 PolarHBondContact O-N 3.44Å; S83-E87 PolarHBondContact O-N 2.99Å
84	K	98.4	Very high	98.2	Very high	119 Å²	119	95.3 Å²	95.3	52%	0.517	51%	0.505	S	S	.	.	H	α-helix	trans	-65.6	-39	174.3	-69.9	176.5	179.3	176.1	0	112.3	Q80 A81 Y82 L86 E87 N88	Q80-K84 PolarHBondContact O-N 3.44Å; A81-K84 WeakPolarHBondContact O-CB 3.41Å; A81-K84 PolarHBondContact O-N 3.36Å; Y82-K84 VanDerWaalsContact C-N 3.29Å; Y82-K84 PolarHBondContact O-N 3.26Å; K84-L86 VanDerWaalsContact C-N 3.33Å; K84-E87 PolarHBondContact O-N 2.87Å; K84-N88 WeakPolarHBondContact O-CB 3.36Å; K84-N88 PolarHBondContact O-N 3.38Å; K84-N88 PolarHBondContact O-ND2 3.35Å
85	L	97.9	Very high	98.1	Very high	113 Å²	113	96.7 Å²	96.7	59%	0.592	51%	0.509	S	S	*	.	H	α-helix	trans	-63.2	-41.4	174.8	-69.5	176.6	0	0	0	111.5	A81 Y82 N88 S89	A81-L85 PolarHBondContact O-N 3.36Å; A81-L85 VanDerWaalsContact O-N 3.1Å; Y82-L85 WeakPolarHBondContact O-CB 3.48Å; Y82-L85 PolarHBondContact O-N 3.34Å; Y82-L85 VanDerWaalsContact O-N 3.11Å; L85-N88 PolarHBondContact O-N 3.35Å; L85-S89 WeakPolarHBondContact O-CB 3.41Å; L85-S89 PolarHBondContact O-N 3.13Å
86	L	98	Very high	98.1	Very high	103 Å²	103	97.4 Å²	97.4	54%	0.539	51%	0.512	S	S	.	.	H	α-helix	trans	-61.5	-47.6	176.7	-176.3	63.4	0	0	0	111.2	Y82 S83 K84 N88 S89 Y90	Y82-L86 PolarHBondContact O-N 2.67Å; S83-L86 PolarHBondContact O-N 3.44Å; K84-L86 VanDerWaalsContact C-N 3.33Å; L86-N88 PolarHBondContact O-N 3.02Å; L86-S89 PolarHBondContact O-N 3.22Å; L86-S89 PolarHBondContact O-OG 3.45Å; L86-Y90 PolarHBondContact O-N 3.48Å
87	E	98	Very high	98	Very high	126 Å²	126	100.2 Å²	100.2	59%	0.589	52%	0.515	S	S	*	.	H	α-helix	trans	-57.9	-48.8	175.4	-176.1	178.5	-172	0	0	111.8	S83 K84 S89 Y90 V91	S83-E87 PolarHBondContact O-N 2.99Å; K84-E87 PolarHBondContact O-N 2.87Å; E87-S89 VanDerWaalsContact C-N 3.3Å; E87-S89 PolarHBondContact O-N 2.93Å; E87-Y90 WeakPolarHBondContact O-CB 3.39Å; E87-Y90 PolarHBondContact O-N 3.37Å; E87-Y90 VanDerWaalsContact O-N 3.14Å; E87-V91 WeakPolarHBondContact O-CG2 3.43Å; E87-V91 PolarHBondContact O-N 3.41Å
88	N	97.7	Very high	97.9	Very high	103 Å²	103	98.2 Å²	98.2	55%	0.551	51%	0.512	S	S	*	.	H	α-helix	trans	-60.1	-39.8	177.4	-72.1	-18.7	0	0	0	112.2	K84 L85 L86 Y90 V91 L92	K84-N88 WeakPolarHBondContact O-CB 3.36Å; K84-N88 PolarHBondContact O-N 3.38Å; K84-N88 PolarHBondContact O-ND2 3.35Å; L85-N88 PolarHBondContact O-N 3.35Å; L86-N88 PolarHBondContact O-N 3.02Å; N88-Y90 VanDerWaalsContact C-N 3.34Å; N88-V91 PolarHBondContact O-N 2.97Å; N88-L92 WeakPolarHBondContact O-CB 3.36Å; N88-L92 PolarHBondContact O-N 3.35Å
89	S	98	Very high	97.8	Very high	62 Å²	62	98.1 Å²	98.1	43%	0.434	51%	0.505	S	S	.	.	H	α-helix	trans	-65.4	-37.7	177.3	77.6	0	0	0	0	112.1	L85 L86 E87 L92 L93	L85-S89 WeakPolarHBondContact O-CB 3.41Å; L85-S89 PolarHBondContact O-N 3.13Å; L86-S89 PolarHBondContact O-N 3.22Å; L86-S89 PolarHBondContact O-OG 3.45Å; E87-S89 VanDerWaalsContact C-N 3.3Å; E87-S89 PolarHBondContact O-N 2.93Å; S89-L92 PolarHBondContact O-N 2.91Å; S89-L93 WeakPolarHBondContact O-CB 3.43Å; S89-L93 PolarHBondContact O-N 2.92Å
90	Y	97.2	Very high	97.7	Very high	147 Å²	147	97.4 Å²	97.4	58%	0.576	50%	0.502	S	S	*	.	H	α-helix	trans	-65.7	-45.9	175.8	174.3	-101.2	0	0	0	111.3	L86 E87 N88 L92 L93 N94	L86-Y90 PolarHBondContact O-N 3.48Å; E87-Y90 WeakPolarHBondContact O-CB 3.39Å; E87-Y90 PolarHBondContact O-N 3.37Å; E87-Y90 VanDerWaalsContact O-N 3.14Å; N88-Y90 VanDerWaalsContact C-N 3.34Å; Y90-L92 PolarHBondContact O-N 3.14Å; Y90-L93 PolarHBondContact O-N 2.95Å; Y90-N94 WeakPolarHBondContact CE1-ND2 3.17Å; Y90-N94 PolarHBondContact O-N 3.47Å; Y90-N94 PolarHBondContact O-ND2 2.84Å; Y90-N94 PolarHBondContact OH-ND2 3.32Å
91	V	97.9	Very high	97.6	Very high	77 Å²	77	96.5 Å²	96.5	47%	0.467	50%	0.497	S	S	.	.	H	α-helix	trans	-58.9	-48.3	174.9	173.2	0	0	0	0	110.6	E87 N88 L93 N94 V95	E87-V91 WeakPolarHBondContact O-CG2 3.43Å; E87-V91 PolarHBondContact O-N 3.41Å; N88-V91 PolarHBondContact O-N 2.97Å; V91-L93 PolarHBondContact O-N 2.73Å; V91-N94 PolarHBondContact O-N 3.36Å; V91-V95 WeakPolarHBondContact O-CG2 3.38Å; V91-V95 PolarHBondContact O-N 3.49Å
92	L	97.8	Very high	97.4	Very high	106 Å²	106	99.6 Å²	99.6	56%	0.555	50%	0.501	S	S	*	.	H	α-helix	trans	-59.8	-45.7	178.9	-178.9	62.5	0	0	0	112	N88 S89 Y90 N94 V95 L96	N88-L92 WeakPolarHBondContact O-CB 3.36Å; N88-L92 PolarHBondContact O-N 3.35Å; S89-L92 PolarHBondContact O-N 2.91Å; Y90-L92 PolarHBondContact O-N 3.14Å; L92-N94 VanDerWaalsContact C-N 3.32Å; L92-N94 PolarHBondContact O-N 3.45Å; L92-V95 PolarHBondContact O-N 3.34Å; L92-L96 HydrophobicContact CD1-CD1 4.49Å; L92-L96 HydrophobicContact CD1-CG 4.44Å; L92-L96 HydrophobicContact CG-CD1 4.25Å; L92-L96 WeakPolarHBondContact O-CG 3.49Å; L92-L96 PolarHBondContact O-N 2.93Å
93	L	97.9	Very high	97.3	Very high	87 Å²	87	97.8 Å²	97.8	46%	0.455	50%	0.5	S	S	.	.	H	α-helix	trans	-58.5	-43.4	177.5	178	62.4	0	0	0	111.8	S89 Y90 V91 L96 K97	S89-L93 WeakPolarHBondContact O-CB 3.43Å; S89-L93 PolarHBondContact O-N 2.92Å; Y90-L93 PolarHBondContact O-N 2.95Å; V91-L93 PolarHBondContact O-N 2.73Å; L93-L96 PolarHBondContact O-N 3.25Å; L93-K97 HydrophobicContact CG-CD 4.49Å; L93-K97 WeakPolarHBondContact O-CG 3.42Å; L93-K97 PolarHBondContact O-N 3.07Å
94	N	97.8	Very high	97	Very high	61 Å²	61	99.5 Å²	99.5	33%	0.326	50%	0.498	S	S	.	.	H	α-helix	trans	-67.4	-40	179.3	-73.9	-21.2	0	0	0	112.3	Y90 V91 L92 K97 C98	Y90-N94 WeakPolarHBondContact CE1-ND2 3.17Å; Y90-N94 PolarHBondContact O-N 3.47Å; Y90-N94 PolarHBondContact O-ND2 2.84Å; Y90-N94 PolarHBondContact OH-ND2 3.32Å; V91-N94 PolarHBondContact O-N 3.36Å; L92-N94 VanDerWaalsContact C-N 3.32Å; L92-N94 PolarHBondContact O-N 3.45Å; N94-K97 PolarHBondContact O-N 2.98Å; N94-C98 WeakPolarHBondContact O-CB 3.4Å; N94-C98 PolarHBondContact O-N 3.21Å
95	V	97.7	Very high	96.8	Very high	73 Å²	73	97.7 Å²	97.7	44%	0.442	49%	0.494	S	S	.	.	H	α-helix	trans	-61	-45.1	173.1	171.2	0	0	0	0	110.7	V91 L92 C98 N99	V91-V95 WeakPolarHBondContact O-CG2 3.38Å; V91-V95 PolarHBondContact O-N 3.49Å; L92-V95 PolarHBondContact O-N 3.34Å; V95-C98 PolarHBondContact O-N 3.36Å; V95-N99 WeakPolarHBondContact O-CB 3.37Å; V95-N99 PolarHBondContact O-N 3.17Å; V95-N99 PolarHBondContact O-ND2 3.01Å
96	L	97.5	Very high	96.5	Very high	100 Å²	100	98.6 Å²	98.6	52%	0.524	49%	0.493	S	S	.	.	H	α-helix	trans	-63.6	-43.7	178.1	-73.2	176	0	0	0	112.4	L92 L93 C98 N99 Q100	L92-L96 HydrophobicContact CD1-CD1 4.49Å; L92-L96 HydrophobicContact CD1-CG 4.44Å; L92-L96 HydrophobicContact CG-CD1 4.25Å; L92-L96 WeakPolarHBondContact O-CG 3.49Å; L92-L96 PolarHBondContact O-N 2.93Å; L93-L96 PolarHBondContact O-N 3.25Å; L96-C98 PolarHBondContact O-N 3.29Å; L96-N99 PolarHBondContact O-N 3.4Å; L96-Q100 WeakPolarHBondContact O-CB 3.44Å; L96-Q100 PolarHBondContact O-N 3.49Å
97	K	97.1	Very high	96.3	Very high	112 Å²	112	99.8 Å²	99.8	49%	0.487	49%	0.494	S	S	.	.	H	α-helix	trans	-59.4	-46.2	174.8	-76.3	179.4	177.9	178.4	0	111.9	L93 N94 N99 Q100 E101	L93-K97 HydrophobicContact CG-CD 4.49Å; L93-K97 WeakPolarHBondContact O-CG 3.42Å; L93-K97 PolarHBondContact O-N 3.07Å; N94-K97 PolarHBondContact O-N 2.98Å; K97-N99 VanDerWaalsContact C-N 3.35Å; K97-N99 PolarHBondContact O-N 3.48Å; K97-Q100 WeakPolarHBondContact O-CB 3.41Å; K97-Q100 PolarHBondContact O-N 3.23Å; K97-E101 PolarHBondContact O-N 3.12Å
98	C	96.2	Very high	96	Very high	62 Å²	62	95.9 Å²	95.9	42%	0.419	48%	0.484	S	S	.	.	H	α-helix	trans	-60.7	-44.1	177.4	-179.3	0	0	0	0	111.9	N94 V95 L96 E101 K102	N94-C98 WeakPolarHBondContact O-CB 3.4Å; N94-C98 PolarHBondContact O-N 3.21Å; V95-C98 PolarHBondContact O-N 3.36Å; L96-C98 PolarHBondContact O-N 3.29Å; C98-E101 PolarHBondContact O-N 3.38Å; C98-K102 WeakPolarHBondContact O-CG 3.47Å; C98-K102 PolarHBondContact O-N 2.9Å; C98-K102 VanDerWaalsContact O-N 3.12Å; C98-K102 VanDerWaalsContact SG-CE 3.6Å
99	N	96.9	Very high	95.7	Very high	76 Å²	76	98 Å²	98	41%	0.406	49%	0.488	S	S	.	.	H	α-helix	trans	-65.3	-39.7	175.9	-72.4	-19.6	0	0	0	111.9	V95 L96 K97 K102 M103	V95-N99 WeakPolarHBondContact O-CB 3.37Å; V95-N99 PolarHBondContact O-N 3.17Å; V95-N99 PolarHBondContact O-ND2 3.01Å; L96-N99 PolarHBondContact O-N 3.4Å; K97-N99 VanDerWaalsContact C-N 3.35Å; K97-N99 PolarHBondContact O-N 3.48Å; N99-K102 PolarHBondContact O-N 3.46Å; N99-M103 VanDerWaalsContact O-CG 3.23Å; N99-M103 WeakPolarHBondContact O-CG 3.23Å; N99-M103 PolarHBondContact O-N 2.91Å
100	Q	96.7	Very high	95.3	Very high	109 Å²	109	99.8 Å²	99.8	51%	0.509	50%	0.497	S	S	.	.	H	α-helix	trans	-60.9	-46	176.8	-172.1	-178.9	14.1	0	0	111.8	L96 K97 M103 K104	L96-Q100 WeakPolarHBondContact O-CB 3.44Å; L96-Q100 PolarHBondContact O-N 3.49Å; K97-Q100 WeakPolarHBondContact O-CB 3.41Å; K97-Q100 PolarHBondContact O-N 3.23Å; Q100-M103 PolarHBondContact O-N 3.46Å; Q100-M103 VanDerWaalsContact O-N 3.17Å; Q100-K104 WeakPolarHBondContact O-CG 3.28Å; Q100-K104 PolarHBondContact O-N 2.97Å
101	E	95.6	Very high	94.7	Very high	103 Å²	103	100.4 Å²	100.4	48%	0.481	50%	0.499	S	S	.	.	H	α-helix	trans	-63.4	-41.7	177.3	-68	-53.4	123.9	0	0	112.1	K97 C98 M103 K104 D105	K97-E101 PolarHBondContact O-N 3.12Å; C98-E101 PolarHBondContact O-N 3.38Å; E101-M103 VanDerWaalsContact C-N 3.27Å; E101-M103 PolarHBondContact O-N 3.02Å; E101-K104 PolarHBondContact O-N 3.44Å; E101-K104 IonicContact OE1-NZ 2.67Å; E101-K104 PolarHBondContact OE1-NZ 3.15Å; E101-D105 PolarHBondContact O-N 3.01Å
102	K	95	Very high	93.4	Very high	118 Å²	118	101.4 Å²	101.4	51%	0.513	51%	0.505	S	S	.	.	H	α-helix	trans	-60	-37.9	172.8	-71.3	171.9	-177.5	171.4	0	112.3	C98 N99 K106	C98-K102 WeakPolarHBondContact O-CG 3.47Å; C98-K102 PolarHBondContact O-N 2.9Å; C98-K102 VanDerWaalsContact O-N 3.12Å; C98-K102 VanDerWaalsContact SG-CE 3.6Å; N99-K102 PolarHBondContact O-N 3.46Å; K102-K106 WeakPolarHBondContact O-CG 3.33Å; K102-K106 PolarHBondContact O-N 2.85Å
103	M	94.9	Very high	91.5	Very high	124 Å²	124	106 Å²	106	61%	0.611	54%	0.541	S	S	*	.	H	α-helix	trans	-72.7	-34.8	177.8	-67.5	-63.6	-108.3	0	0	111.9	N99 Q100 E101 K106 F107	N99-M103 VanDerWaalsContact O-CG 3.23Å; N99-M103 WeakPolarHBondContact O-CG 3.23Å; N99-M103 PolarHBondContact O-N 2.91Å; Q100-M103 PolarHBondContact O-N 3.46Å; Q100-M103 VanDerWaalsContact O-N 3.17Å; E101-M103 VanDerWaalsContact C-N 3.27Å; E101-M103 PolarHBondContact O-N 3.02Å; M103-K106 PolarHBondContact O-N 3.11Å; M103-K106 HydrophobicContact SD-CD 4.28Å; M103-F107 VanDerWaalsContact O-CB 3.28Å; M103-F107 WeakPolarHBondContact O-CB 3.36Å; M103-F107 PolarHBondContact O-N 3.45Å
104	K	94	Very high	91.2	Very high	108 Å²	108	106.9 Å²	106.9	47%	0.47	55%	0.546	S	S	.	.	H	α-helix	trans	-63.2	-46	171.9	-72.8	176.7	-176.1	167.7	0	112	Q100 E101 K106 F107 A108	Q100-K104 WeakPolarHBondContact O-CG 3.28Å; Q100-K104 PolarHBondContact O-N 2.97Å; E101-K104 PolarHBondContact O-N 3.44Å; E101-K104 IonicContact OE1-NZ 2.67Å; E101-K104 PolarHBondContact OE1-NZ 3.15Å; K104-K106 PolarHBondContact O-N 3.45Å; K104-F107 PolarHBondContact O-N 3.23Å; K104-A108 WeakPolarHBondContact O-CB 3.49Å; K104-A108 PolarHBondContact O-N 3.46Å
105	D	92.5	Very high	90.8	Very high	81 Å²	81	109.3 Å²	109.3	43%	0.433	56%	0.557	S	S	.	*	H	α-helix	trans	-59.8	-45.4	175.6	173.8	64	0	0	0	111.4	E101 A108 K109	E101-D105 PolarHBondContact O-N 3.01Å; D105-A108 PolarHBondContact O-N 3.06Å; D105-K109 VanDerWaalsContact CG-NZ 3.34Å; D105-K109 WeakPolarHBondContact O-CG 3.47Å; D105-K109 PolarHBondContact O-N 3.04Å; D105-K109 VanDerWaalsContact OD1-CE 3.22Å; D105-K109 WeakPolarHBondContact OD1-CE 3.33Å; D105-K109 IonicContact OD1-NZ 3.2Å; D105-K109 PolarHBondContact OD1-NZ 3.02Å; D105-K109 WeakPolarHBondContact OD2-CE 3.22Å; D105-K109 IonicContact OD2-NZ 2.7Å; D105-K109 PolarHBondContact OD2-NZ 3.18Å
106	K	93.2	Very high	90.5	Very high	132 Å²	132	111.3 Å²	111.3	57%	0.574	56%	0.563	S	S	*	*	H	α-helix	trans	-60.2	-45.6	173.4	-75.9	179.9	178.2	-173.6	0	112.2	K102 M103 K104 K109 T110	K102-K106 WeakPolarHBondContact O-CG 3.33Å; K102-K106 PolarHBondContact O-N 2.85Å; M103-K106 PolarHBondContact O-N 3.11Å; M103-K106 HydrophobicContact SD-CD 4.28Å; K104-K106 PolarHBondContact O-N 3.45Å; K106-K109 PolarHBondContact O-N 2.84Å; K106-T110 PolarHBondContact O-N 3.2Å; K106-T110 PolarHBondContact O-OG1 2.7Å; K106-T110 VanDerWaalsContact O-OG1 3.04Å
107	F	93.1	Very high	90	Very high	128 Å²	128	112 Å²	112	56%	0.561	57%	0.566	S	S	*	*	H	α-helix	trans	-62.5	-46.3	179.2	-173.4	-86.4	0	0	0	111.4	M103 K104 K109 T110 Y111	M103-F107 VanDerWaalsContact O-CB 3.28Å; M103-F107 WeakPolarHBondContact O-CB 3.36Å; M103-F107 PolarHBondContact O-N 3.45Å; K104-F107 PolarHBondContact O-N 3.23Å; F107-K109 PolarHBondContact O-N 2.83Å; F107-T110 PolarHBondContact O-N 3.5Å; F107-T110 VanDerWaalsContact O-N 3.11Å; F107-Y111 AromaticContact CD1-CD2 3.93Å; F107-Y111 HydrophobicContact CD1-CD2 3.93Å; F107-Y111 AromaticContact CD2-CD2 3.6Å; F107-Y111 HydrophobicContact CD2-CD2 3.6Å; F107-Y111 AromaticContact CD2-CE2 3.55Å; F107-Y111 HydrophobicContact CD2-CE2 3.55Å; F107-Y111 AromaticContact CE1-CD2 3.76Å; F107-Y111 HydrophobicContact CE1-CD2 3.76Å; F107-Y111 HydrophobicContact CE1-CE2 4.45Å; F107-Y111 HydrophobicContact CE1-CG 4.19Å; F107-Y111 AromaticContact CE2-CD2 3.42Å; F107-Y111 HydrophobicContact CE2-CD2 3.42Å; F107-Y111 VanDerWaalsContact CE2-CD2 3.42Å; F107-Y111 AromaticContact CE2-CE2 3.27Å; F107-Y111 HydrophobicContact CE2-CE2 3.27Å; F107-Y111 HydrophobicContact CE2-CG 4.37Å; F107-Y111 AromaticContact CG-CD2 3.85Å; F107-Y111 HydrophobicContact CG-CD2 3.85Å; F107-Y111 HydrophobicContact CG-CE2 4.26Å; F107-Y111 AromaticContact CZ-CD2 3.5Å; F107-Y111 HydrophobicContact CZ-CD2 3.5Å; F107-Y111 VanDerWaalsContact CZ-CD2 3.5Å; F107-Y111 AromaticContact CZ-CE2 3.77Å; F107-Y111 HydrophobicContact CZ-CE2 3.77Å; F107-Y111 HydrophobicContact CZ-CG 4.05Å; F107-Y111 WeakPolarHBondContact O-CD2 3.46Å; F107-Y111 PolarHBondContact O-N 3.06Å
108	A	91.9	Very high	89.6	Confident	44 Å²	44	112 Å²	112	36%	0.364	57%	0.571	S	S	.	*	H	α-helix	trans	-56.6	-50.1	175.8	0	0	0	0	0	110.9	K104 D105 T110 Y111 T112	K104-A108 WeakPolarHBondContact O-CB 3.49Å; K104-A108 PolarHBondContact O-N 3.46Å; D105-A108 PolarHBondContact O-N 3.06Å; A108-T110 PolarHBondContact O-N 2.95Å; A108-Y111 PolarHBondContact O-N 3.04Å; A108-Y111 VanDerWaalsContact O-N 3.15Å; A108-T112 PolarHBondContact O-N 3.38Å; A108-T112 PolarHBondContact O-OG1 3.36Å
109	K	90.9	Very high	89.2	Confident	147 Å²	147	115.3 Å²	115.3	64%	0.639	58%	0.581	S	S	*	*	H	α-helix	trans	-59.2	-27.5	176.5	-72.5	169.8	179.4	164.2	0	114.4	D105 K106 F107	D105-K109 VanDerWaalsContact CG-NZ 3.34Å; D105-K109 WeakPolarHBondContact O-CG 3.47Å; D105-K109 PolarHBondContact O-N 3.04Å; D105-K109 VanDerWaalsContact OD1-CE 3.22Å; D105-K109 WeakPolarHBondContact OD1-CE 3.33Å; D105-K109 IonicContact OD1-NZ 3.2Å; D105-K109 PolarHBondContact OD1-NZ 3.02Å; D105-K109 WeakPolarHBondContact OD2-CE 3.22Å; D105-K109 IonicContact OD2-NZ 2.7Å; D105-K109 PolarHBondContact OD2-NZ 3.18Å; K106-K109 PolarHBondContact O-N 2.84Å; F107-K109 PolarHBondContact O-N 2.83Å
110	T	90.7	Very high	88.6	Confident	100 Å²	100	118.1 Å²	118.1	61%	0.613	59%	0.593	S	S	*	*	H	α-helix	trans	-84.2	-29.5	177.8	-59	0	0	0	0	113.1	K106 F107 A108	K106-T110 PolarHBondContact O-N 3.2Å; K106-T110 PolarHBondContact O-OG1 2.7Å; K106-T110 VanDerWaalsContact O-OG1 3.04Å; F107-T110 PolarHBondContact O-N 3.5Å; F107-T110 VanDerWaalsContact O-N 3.11Å; A108-T110 PolarHBondContact O-N 2.95Å
111	Y	84.5	Confident	88	Confident	161 Å²	161	118.8 Å²	118.8	63%	0.631	60%	0.6	S	S	*	*	H	α-helix	trans	-119.6	-6.3	-168.2	-69.3	-79.2	0	0	0	116	F107 A108	F107-Y111 AromaticContact CD1-CD2 3.93Å; F107-Y111 HydrophobicContact CD1-CD2 3.93Å; F107-Y111 AromaticContact CD2-CD2 3.6Å; F107-Y111 HydrophobicContact CD2-CD2 3.6Å; F107-Y111 AromaticContact CD2-CE2 3.55Å; F107-Y111 HydrophobicContact CD2-CE2 3.55Å; F107-Y111 AromaticContact CE1-CD2 3.76Å; F107-Y111 HydrophobicContact CE1-CD2 3.76Å; F107-Y111 HydrophobicContact CE1-CE2 4.45Å; F107-Y111 HydrophobicContact CE1-CG 4.19Å; F107-Y111 AromaticContact CE2-CD2 3.42Å; F107-Y111 HydrophobicContact CE2-CD2 3.42Å; F107-Y111 VanDerWaalsContact CE2-CD2 3.42Å; F107-Y111 AromaticContact CE2-CE2 3.27Å; F107-Y111 HydrophobicContact CE2-CE2 3.27Å; F107-Y111 HydrophobicContact CE2-CG 4.37Å; F107-Y111 AromaticContact CG-CD2 3.85Å; F107-Y111 HydrophobicContact CG-CD2 3.85Å; F107-Y111 HydrophobicContact CG-CE2 4.26Å; F107-Y111 AromaticContact CZ-CD2 3.5Å; F107-Y111 HydrophobicContact CZ-CD2 3.5Å; F107-Y111 VanDerWaalsContact CZ-CD2 3.5Å; F107-Y111 AromaticContact CZ-CE2 3.77Å; F107-Y111 HydrophobicContact CZ-CE2 3.77Å; F107-Y111 HydrophobicContact CZ-CG 4.05Å; F107-Y111 WeakPolarHBondContact O-CD2 3.46Å; F107-Y111 PolarHBondContact O-N 3.06Å; A108-Y111 PolarHBondContact O-N 3.04Å; A108-Y111 VanDerWaalsContact O-N 3.15Å
112	T	69.4	Low	87.4	Confident	97 Å²	97	120.2 Å²	120.2	60%	0.595	61%	0.61	S	S	*	*			trans	-88.7	125.1	165.7	52.7	0	0	0	0	109.9	A108	A108-T112 PolarHBondContact O-N 3.38Å; A108-T112 PolarHBondContact O-OG1 3.36Å
113	P	58.2	Low	86.7	Confident	202 Å²	202	120.4 Å²	120.4	100%	1.312	62%	0.618	S	S	*	*			trans	-65	0	-173.1	27.2	-35.4	0	0	0	114.4

Retrieved 113 of 113 residues in 151.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).