G4V7C7_SCHMA Loading...

Secreted protein

AlphaFold DB , UniProt , Accession G4V7C7, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 92 aa.

						>G4V7C7_SCHMA|G4V7C7
MKLILIFALIISLLLNVTAESQASQKELFTESVKLWKSITELWKRFEHNCRVKIRKYLEEDNLGEKLAAVVSIYVKRLNKRLDMRLSEDRAE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.1	Low	75.9	Confident	199 Å²	199	119 Å²	119	98%	0.98	60%	0.602	S	S	*	*				0	-57.2	0	-63.9	-107.2	-121.1	0	0	112.2	L3 I4 L5	M1-L3 PolarHBondContact O-N 3.29Å; M1-I4 PolarHBondContact O-N 3.21Å; M1-L5 PolarHBondContact O-N 2.94Å
2	K	71.2	Confident	75.7	Confident	177 Å²	177	114.5 Å²	114.5	77%	0.77	59%	0.59	S	S	*	*	H	α-helix	trans	-57.8	-41.1	-179.1	-63.3	-177.2	179.9	-179.7	0	114.5	I4 L5 I6	K2-I4 PolarHBondContact O-N 3.44Å; K2-L5 PolarHBondContact O-N 2.88Å; K2-I6 VanDerWaalsContact O-CG1 3.32Å; K2-I6 WeakPolarHBondContact O-CG1 3.21Å; K2-I6 PolarHBondContact O-N 3.19Å; K2-I6 VanDerWaalsContact O-N 3.07Å
3	L	73.8	Confident	75.4	Confident	140 Å²	140	114.3 Å²	114.3	73%	0.733	59%	0.59	S	S	*	*	H	α-helix	trans	-65.8	-35.2	179.2	-70.4	171.3	0	0	0	113.5	M1 I6 F7	M1-L3 PolarHBondContact O-N 3.29Å; L3-I6 PolarHBondContact O-N 2.88Å; L3-F7 WeakPolarHBondContact O-CB 3.43Å; L3-F7 PolarHBondContact O-N 3.43Å
4	I	79.5	Confident	75	Confident	127 Å²	127	114 Å²	114	65%	0.651	59%	0.589	S	S	*	*	H	α-helix	trans	-69	-40.3	178.9	-61.3	170.9	0	0	0	109.8	M1 K2 F7 A8	M1-I4 PolarHBondContact O-N 3.21Å; K2-I4 PolarHBondContact O-N 3.44Å; I4-F7 PolarHBondContact O-N 3.01Å; I4-A8 WeakPolarHBondContact O-CB 2.78Å; I4-A8 PolarHBondContact O-N 3.39Å
5	L	77.1	Confident	74.5	Confident	118 Å²	118	113.7 Å²	113.7	62%	0.618	59%	0.588	S	S	*	*	H	α-helix	trans	-64.4	-40.6	175.1	-71.5	171.3	0	0	0	112.2	M1 K2 A8 L9	M1-L5 PolarHBondContact O-N 2.94Å; K2-L5 PolarHBondContact O-N 2.88Å; L5-A8 PolarHBondContact O-N 3.41Å; L5-L9 WeakPolarHBondContact O-CB 3.46Å; L5-L9 WeakPolarHBondContact O-CG 3.33Å; L5-L9 PolarHBondContact O-N 3.24Å
6	I	81.2	Confident	73.8	Confident	90 Å²	90	114.1 Å²	114.1	46%	0.462	59%	0.591	S	S	.	*	H	α-helix	trans	-63.3	-45.5	175.5	-67.4	164.2	0	0	0	110.2	K2 L3 L9 I10	K2-I6 VanDerWaalsContact O-CG1 3.32Å; K2-I6 WeakPolarHBondContact O-CG1 3.21Å; K2-I6 PolarHBondContact O-N 3.19Å; K2-I6 VanDerWaalsContact O-N 3.07Å; L3-I6 PolarHBondContact O-N 2.88Å; I6-L9 PolarHBondContact O-N 2.81Å; I6-I10 HydrophobicContact CG2-CD1 3.83Å; I6-I10 VanDerWaalsContact O-CG1 3.26Å; I6-I10 WeakPolarHBondContact O-CG1 3.43Å; I6-I10 PolarHBondContact O-N 2.92Å
7	F	78.5	Confident	73.1	Confident	138 Å²	138	110.8 Å²	110.8	61%	0.605	58%	0.577	S	S	*	*	H	α-helix	trans	-64.4	-41.5	178.4	-165.1	-106.8	0	0	0	112.1	L3 I4 I10 I11	L3-F7 WeakPolarHBondContact O-CB 3.43Å; L3-F7 PolarHBondContact O-N 3.43Å; I4-F7 PolarHBondContact O-N 3.01Å; F7-I10 PolarHBondContact O-N 3.35Å; F7-I11 HydrophobicContact CD1-CD1 3.5Å; F7-I11 HydrophobicContact CD1-CG1 4.42Å; F7-I11 HydrophobicContact CE1-CD1 3.3Å; F7-I11 HydrophobicContact CE1-CG1 4.29Å; F7-I11 HydrophobicContact CG-CD1 4.38Å; F7-I11 HydrophobicContact CZ-CD1 4.01Å; F7-I11 WeakPolarHBondContact O-CG1 3.35Å; F7-I11 PolarHBondContact O-N 2.79Å
8	A	78.9	Confident	72.2	Confident	49 Å²	49	108.7 Å²	108.7	41%	0.405	57%	0.57	S	S	.	*	H	α-helix	trans	-63.3	-41.7	175.1	0	0	0	0	0	112.4	I4 L5 I11 S12	I4-A8 WeakPolarHBondContact O-CB 2.78Å; I4-A8 PolarHBondContact O-N 3.39Å; L5-A8 PolarHBondContact O-N 3.41Å; A8-I11 PolarHBondContact O-N 3.27Å; A8-S12 PolarHBondContact O-N 2.92Å; A8-S12 PolarHBondContact O-OG 3.28Å
9	L	78.5	Confident	71.4	Confident	114 Å²	114	107.4 Å²	107.4	60%	0.597	58%	0.577	S	S	*	*	H	α-helix	trans	-62.5	-42.3	174.8	-83.4	163.9	0	0	0	112.2	L5 I6 I11 S12 L13	L5-L9 WeakPolarHBondContact O-CB 3.46Å; L5-L9 WeakPolarHBondContact O-CG 3.33Å; L5-L9 PolarHBondContact O-N 3.24Å; I6-L9 PolarHBondContact O-N 2.81Å; L9-I11 VanDerWaalsContact C-N 3.35Å; L9-S12 PolarHBondContact O-N 3.36Å; L9-L13 WeakPolarHBondContact O-CB 3.45Å; L9-L13 PolarHBondContact O-N 3.5Å
10	I	80.7	Confident	70.7	Confident	85 Å²	85	111.1 Å²	111.1	44%	0.436	59%	0.59	S	S	.	*	H	α-helix	trans	-62.7	-43.8	176.5	-68.8	165.5	0	0	0	110.4	I6 F7 L13 L14	I6-I10 HydrophobicContact CG2-CD1 3.83Å; I6-I10 VanDerWaalsContact O-CG1 3.26Å; I6-I10 WeakPolarHBondContact O-CG1 3.43Å; I6-I10 PolarHBondContact O-N 2.92Å; F7-I10 PolarHBondContact O-N 3.35Å; I10-L13 PolarHBondContact O-N 3.38Å; I10-L14 HydrophobicContact CG2-CD1 3.96Å; I10-L14 VanDerWaalsContact O-CG 3.29Å; I10-L14 WeakPolarHBondContact O-CG 3.5Å; I10-L14 PolarHBondContact O-N 3.41Å
11	I	78.9	Confident	69.9	Low	72 Å²	72	107.8 Å²	107.8	37%	0.369	58%	0.576	S	S	.	*	H	α-helix	trans	-63.9	-45.6	176.9	-69.3	168.8	0	0	0	111.2	F7 A8 L9 L13 L14 L15	F7-I11 HydrophobicContact CD1-CD1 3.5Å; F7-I11 HydrophobicContact CD1-CG1 4.42Å; F7-I11 HydrophobicContact CE1-CD1 3.3Å; F7-I11 HydrophobicContact CE1-CG1 4.29Å; F7-I11 HydrophobicContact CG-CD1 4.38Å; F7-I11 HydrophobicContact CZ-CD1 4.01Å; F7-I11 WeakPolarHBondContact O-CG1 3.35Å; F7-I11 PolarHBondContact O-N 2.79Å; A8-I11 PolarHBondContact O-N 3.27Å; L9-I11 VanDerWaalsContact C-N 3.35Å; I11-L13 VanDerWaalsContact C-N 3.34Å; I11-L13 PolarHBondContact O-N 3.48Å; I11-L14 PolarHBondContact O-N 2.87Å; I11-L15 HydrophobicContact CG2-CD1 3.95Å; I11-L15 HydrophobicContact CG2-CG 4.43Å; I11-L15 WeakPolarHBondContact O-CG 3.26Å; I11-L15 PolarHBondContact O-N 2.85Å
12	S	74.2	Confident	70.1	Confident	65 Å²	65	106.1 Å²	106.1	46%	0.455	57%	0.565	S	S	.	*	H	α-helix	trans	-62.5	-38.6	177	-74.5	0	0	0	0	112.8	A8 L9 L15 N16	A8-S12 PolarHBondContact O-N 2.92Å; A8-S12 PolarHBondContact O-OG 3.28Å; L9-S12 PolarHBondContact O-N 3.36Å; S12-L15 PolarHBondContact O-N 2.85Å; S12-N16 PolarHBondContact O-N 3.21Å; S12-N16 PolarHBondContact O-ND2 3.42Å
13	L	72	Confident	69.5	Low	112 Å²	112	101 Å²	101	59%	0.586	56%	0.556	S	S	*	*	H	α-helix	trans	-62.9	-45.8	173.4	-96.3	153.4	0	0	0	111.6	L9 I10 I11 L15 N16 V17	L9-L13 WeakPolarHBondContact O-CB 3.45Å; L9-L13 PolarHBondContact O-N 3.5Å; I10-L13 PolarHBondContact O-N 3.38Å; I11-L13 VanDerWaalsContact C-N 3.34Å; I11-L13 PolarHBondContact O-N 3.48Å; L13-L15 VanDerWaalsContact C-N 3.33Å; L13-L15 PolarHBondContact O-N 2.98Å; L13-N16 PolarHBondContact O-N 3.35Å; L13-V17 WeakPolarHBondContact O-CB 3.26Å; L13-V17 VanDerWaalsContact O-CG2 3.24Å; L13-V17 WeakPolarHBondContact O-CG2 3.29Å; L13-V17 PolarHBondContact O-N 3.39Å
14	L	68.8	Low	69	Low	110 Å²	110	96.2 Å²	96.2	58%	0.576	54%	0.535	S	S	*	.	H	α-helix	trans	-61	-41.1	177.3	-73.6	166.7	0	0	0	111.9	I10 I11 T18	I10-L14 HydrophobicContact CG2-CD1 3.96Å; I10-L14 VanDerWaalsContact O-CG 3.29Å; I10-L14 WeakPolarHBondContact O-CG 3.5Å; I10-L14 PolarHBondContact O-N 3.41Å; I11-L14 PolarHBondContact O-N 2.87Å; L14-T18 PolarHBondContact O-N 2.85Å; L14-T18 VanDerWaalsContact O-N 3.16Å; L14-T18 PolarHBondContact O-OG1 3.45Å
15	L	67.4	Low	68.3	Low	110 Å²	110	93.9 Å²	93.9	58%	0.576	52%	0.521	S	S	*	.	H	α-helix	trans	-67.6	-42.1	178.6	-72.9	171	0	0	0	112.9	I11 S12 L13 T18	I11-L15 HydrophobicContact CG2-CD1 3.95Å; I11-L15 HydrophobicContact CG2-CG 4.43Å; I11-L15 WeakPolarHBondContact O-CG 3.26Å; I11-L15 PolarHBondContact O-N 2.85Å; S12-L15 PolarHBondContact O-N 2.85Å; L13-L15 VanDerWaalsContact C-N 3.33Å; L13-L15 PolarHBondContact O-N 2.98Å; L15-T18 WeakPolarHBondContact CA-OG1 3.32Å; L15-T18 PolarHBondContact O-N 3.16Å; L15-T18 PolarHBondContact O-OG1 3.02Å
16	N	64.7	Low	67.9	Low	120 Å²	120	95.9 Å²	95.9	64%	0.642	53%	0.525	S	S	*	.	H	α-helix	trans	-66.3	-39.1	176.9	-79.5	-30.5	0	0	0	111.9	S12 L13 T18 A19	S12-N16 PolarHBondContact O-N 3.21Å; S12-N16 PolarHBondContact O-ND2 3.42Å; L13-N16 PolarHBondContact O-N 3.35Å; N16-T18 VanDerWaalsContact C-N 3.27Å; N16-T18 PolarHBondContact O-N 3.4Å; N16-A19 PolarHBondContact O-N 3.15Å
17	V	61.8	Low	67.7	Low	58 Å²	58	98 Å²	98	35%	0.352	53%	0.532	S	S	.	.	H	α-helix	trans	-65.2	-31.6	176.9	169.9	0	0	0	0	111.9	L13 A19 L28	L13-V17 WeakPolarHBondContact O-CB 3.26Å; L13-V17 VanDerWaalsContact O-CG2 3.24Å; L13-V17 WeakPolarHBondContact O-CG2 3.29Å; L13-V17 PolarHBondContact O-N 3.39Å; V17-A19 VanDerWaalsContact C-N 3.27Å; V17-A19 PolarHBondContact O-N 3.35Å; V17-L28 HydrophobicContact CG1-CD1 3.43Å; V17-L28 VanDerWaalsContact CG1-CD1 3.43Å
18	T	57	Low	67.4	Low	72 Å²	72	95.4 Å²	95.4	44%	0.442	53%	0.525	S	S	.	.	H	α-helix	trans	-69.2	-19.2	175.9	39.5	0	0	0	0	114.5	L14 L15 N16 Q25	L14-T18 PolarHBondContact O-N 2.85Å; L14-T18 VanDerWaalsContact O-N 3.16Å; L14-T18 PolarHBondContact O-OG1 3.45Å; L15-T18 WeakPolarHBondContact CA-OG1 3.32Å; L15-T18 PolarHBondContact O-N 3.16Å; L15-T18 PolarHBondContact O-OG1 3.02Å; N16-T18 VanDerWaalsContact C-N 3.27Å; N16-T18 PolarHBondContact O-N 3.4Å; T18-Q25 HydrophobicContact CG2-CG 4.4Å; T18-Q25 PolarHBondContact O-NE2 2.9Å
19	A	56.6	Low	67.2	Low	85 Å²	85	100 Å²	100	70%	0.702	54%	0.536	S	S	*	.	H	α-helix	trans	-81.4	-25.4	-176.7	0	0	0	0	0	114.3	N16 V17	N16-A19 PolarHBondContact O-N 3.15Å; V17-A19 VanDerWaalsContact C-N 3.27Å; V17-A19 PolarHBondContact O-N 3.35Å
20	E	56.2	Low	67.3	Low	181 Å²	181	98 Å²	98	85%	0.846	53%	0.528	S	S	*	.	H	α-helix	trans	-111.5	-10.1	-165.4	-76	-172.3	163.8	0	0	116.8
21	S	55.4	Low	67.3	Low	41 Å²	41	98.5 Å²	98.5	29%	0.287	53%	0.529	S	S	.	.			trans	-158.5	111.9	173.3	61.3	0	0	0	0	115.5	A23 S24 Q25	S21-A23 PolarHBondContact O-N 3.43Å; S21-S24 PolarHBondContact O-N 3.18Å; S21-S24 WeakPolarHBondContact OG-CB 3.32Å; S21-S24 PolarHBondContact OG-N 3.36Å; S21-Q25 WeakPolarHBondContact O-CG 3.39Å; S21-Q25 PolarHBondContact O-N 3.45Å
22	Q	58.8	Low	67.3	Low	164 Å²	164	97.8 Å²	97.8	77%	0.766	53%	0.53	S	S	*	.	H	α-helix	trans	-57.2	-27.6	164.6	-71.5	-173.4	-13.1	0	0	112	K26	Q22-K26 PolarHBondContact O-N 2.93Å
23	A	59.4	Low	67.7	Low	70 Å²	70	97.2 Å²	97.2	58%	0.579	52%	0.524	S	S	*	.	H	α-helix	trans	-69.5	-48.6	175	0	0	0	0	0	112.5	S21 Q25 K26 E27	S21-A23 PolarHBondContact O-N 3.43Å; A23-Q25 VanDerWaalsContact C-N 3.32Å; A23-Q25 PolarHBondContact O-N 3.46Å; A23-K26 PolarHBondContact O-N 2.85Å; A23-E27 PolarHBondContact O-N 3.46Å
24	S	63.7	Low	68.3	Low	40 Å²	40	97 Å²	97	28%	0.28	52%	0.518	S	S	.	.	H	α-helix	trans	-69.8	-31	177.6	-162.9	0	0	0	0	111.8	S21 K26 E27 L28	S21-S24 PolarHBondContact O-N 3.18Å; S21-S24 WeakPolarHBondContact OG-CB 3.32Å; S21-S24 PolarHBondContact OG-N 3.36Å; S24-K26 VanDerWaalsContact C-N 3.3Å; S24-K26 PolarHBondContact O-N 3Å; S24-E27 PolarHBondContact O-N 3.37Å; S24-L28 VanDerWaalsContact O-CB 3.28Å; S24-L28 WeakPolarHBondContact O-CB 3.33Å; S24-L28 VanDerWaalsContact O-CG 3.22Å; S24-L28 WeakPolarHBondContact O-CG 3.26Å; S24-L28 PolarHBondContact O-N 2.78Å
25	Q	63.9	Low	69	Low	77 Å²	77	97 Å²	97	36%	0.36	52%	0.518	S	S	.	.	H	α-helix	trans	-58.8	-40.7	172.4	-75	-171.7	11.3	0	0	112.4	T18 S21 A23 F29	T18-Q25 HydrophobicContact CG2-CG 4.4Å; T18-Q25 PolarHBondContact O-NE2 2.9Å; S21-Q25 WeakPolarHBondContact O-CG 3.39Å; S21-Q25 PolarHBondContact O-N 3.45Å; A23-Q25 VanDerWaalsContact C-N 3.32Å; A23-Q25 PolarHBondContact O-N 3.46Å; Q25-F29 VanDerWaalsContact O-CB 3.24Å; Q25-F29 WeakPolarHBondContact O-CB 3.46Å; Q25-F29 PolarHBondContact O-N 2.85Å
26	K	70.2	Confident	69.8	Low	160 Å²	160	100.1 Å²	100.1	70%	0.696	52%	0.522	S	S	*	.	H	α-helix	trans	-67.5	-41	176.7	-74.2	-177.4	-180	-179.4	0	112.1	Q22 A23 S24 F29 T30	Q22-K26 PolarHBondContact O-N 2.93Å; A23-K26 PolarHBondContact O-N 2.85Å; S24-K26 VanDerWaalsContact C-N 3.3Å; S24-K26 PolarHBondContact O-N 3Å; K26-F29 PolarHBondContact O-N 3.44Å; K26-T30 WeakPolarHBondContact O-CB 3.33Å; K26-T30 PolarHBondContact O-N 3.32Å; K26-T30 PolarHBondContact O-OG1 2.8Å
27	E	76	Confident	71	Confident	134 Å²	134	100.6 Å²	100.6	63%	0.626	52%	0.519	S	S	*	.	H	α-helix	trans	-65.7	-47.2	176.4	-72.6	-177.8	169.8	0	0	111.5	A23 S24 F29 T30 E31	A23-E27 PolarHBondContact O-N 3.46Å; S24-E27 PolarHBondContact O-N 3.37Å; E27-F29 VanDerWaalsContact C-N 3.32Å; E27-F29 PolarHBondContact O-N 2.89Å; E27-T30 WeakPolarHBondContact O-CB 3.31Å; E27-T30 PolarHBondContact O-N 3.23Å; E27-T30 VanDerWaalsContact O-N 3.07Å; E27-E31 WeakPolarHBondContact O-CG 3.43Å; E27-E31 PolarHBondContact O-N 3.02Å
28	L	72.3	Confident	72.2	Confident	85 Å²	85	101.2 Å²	101.2	45%	0.445	53%	0.526	S	S	.	.	H	α-helix	trans	-60.6	-39.5	174.8	-72.6	173.1	0	0	0	112.5	V17 S24 T30 S32	V17-L28 HydrophobicContact CG1-CD1 3.43Å; V17-L28 VanDerWaalsContact CG1-CD1 3.43Å; S24-L28 VanDerWaalsContact O-CB 3.28Å; S24-L28 WeakPolarHBondContact O-CB 3.33Å; S24-L28 VanDerWaalsContact O-CG 3.22Å; S24-L28 WeakPolarHBondContact O-CG 3.26Å; S24-L28 PolarHBondContact O-N 2.78Å; L28-T30 VanDerWaalsContact C-N 3.33Å; L28-S32 VanDerWaalsContact O-CB 3.25Å; L28-S32 WeakPolarHBondContact O-CB 3.45Å; L28-S32 PolarHBondContact O-N 3.22Å; L28-S32 PolarHBondContact O-OG 3.42Å
29	F	75.9	Confident	73.7	Confident	145 Å²	145	102.3 Å²	102.3	64%	0.636	53%	0.528	S	S	*	.	H	α-helix	trans	-64.2	-41.7	173.4	-168.2	-97.8	0	0	0	111.1	Q25 K26 E27 S32 V33	Q25-F29 VanDerWaalsContact O-CB 3.24Å; Q25-F29 WeakPolarHBondContact O-CB 3.46Å; Q25-F29 PolarHBondContact O-N 2.85Å; K26-F29 PolarHBondContact O-N 3.44Å; E27-F29 VanDerWaalsContact C-N 3.32Å; E27-F29 PolarHBondContact O-N 2.89Å; F29-S32 VanDerWaalsContact CA-OG 3.3Å; F29-S32 WeakPolarHBondContact CA-OG 3.47Å; F29-S32 PolarHBondContact O-N 3Å; F29-S32 PolarHBondContact O-OG 3.33Å; F29-V33 HydrophobicContact CD1-CG2 4.03Å; F29-V33 HydrophobicContact CE1-CG2 3.73Å; F29-V33 HydrophobicContact CZ-CG2 4.08Å; F29-V33 WeakPolarHBondContact O-CB 3.33Å; F29-V33 WeakPolarHBondContact O-CG2 3.13Å; F29-V33 PolarHBondContact O-N 2.9Å
30	T	80.5	Confident	75.2	Confident	72 Å²	72	100.5 Å²	100.5	44%	0.442	51%	0.508	S	S	.	.	H	α-helix	trans	-65.6	-43.7	178.4	-53.9	0	0	0	0	111.4	K26 E27 L28 V33 K34	K26-T30 WeakPolarHBondContact O-CB 3.33Å; K26-T30 PolarHBondContact O-N 3.32Å; K26-T30 PolarHBondContact O-OG1 2.8Å; E27-T30 WeakPolarHBondContact O-CB 3.31Å; E27-T30 PolarHBondContact O-N 3.23Å; E27-T30 VanDerWaalsContact O-N 3.07Å; L28-T30 VanDerWaalsContact C-N 3.33Å; T30-V33 PolarHBondContact O-N 2.82Å; T30-K34 WeakPolarHBondContact O-CG 3.42Å; T30-K34 PolarHBondContact O-N 3.04Å
31	E	80.8	Confident	76.8	Confident	95 Å²	95	97.4 Å²	97.4	44%	0.444	49%	0.494	S	S	.	.	H	α-helix	trans	-68	-41.2	177.1	-70.8	-55.2	129.8	0	0	112	E27 V33 K34 L35	E27-E31 WeakPolarHBondContact O-CG 3.43Å; E27-E31 PolarHBondContact O-N 3.02Å; E31-V33 VanDerWaalsContact C-N 3.34Å; E31-V33 PolarHBondContact O-N 2.89Å; E31-K34 PolarHBondContact O-N 3.09Å; E31-K34 IonicContact OE1-NZ 2.74Å; E31-K34 PolarHBondContact OE1-NZ 2.79Å; E31-L35 WeakPolarHBondContact O-CB 3.2Å; E31-L35 WeakPolarHBondContact O-CG 3.34Å; E31-L35 PolarHBondContact O-N 3.08Å
32	S	77.1	Confident	78.4	Confident	57 Å²	57	101.5 Å²	101.5	40%	0.399	51%	0.512	S	S	.	.	H	α-helix	trans	-63.8	-37.7	174.1	58.5	0	0	0	0	112.5	L28 F29 L35 W36	L28-S32 VanDerWaalsContact O-CB 3.25Å; L28-S32 WeakPolarHBondContact O-CB 3.45Å; L28-S32 PolarHBondContact O-N 3.22Å; L28-S32 PolarHBondContact O-OG 3.42Å; F29-S32 VanDerWaalsContact CA-OG 3.3Å; F29-S32 WeakPolarHBondContact CA-OG 3.47Å; F29-S32 PolarHBondContact O-N 3Å; F29-S32 PolarHBondContact O-OG 3.33Å; S32-L35 PolarHBondContact O-N 3.18Å; S32-W36 WeakPolarHBondContact O-CB 3.47Å; S32-W36 PolarHBondContact O-N 3.26Å
33	V	82.8	Confident	79.7	Confident	54 Å²	54	101.6 Å²	101.6	33%	0.327	51%	0.505	S	S	.	.	H	α-helix	trans	-65	-41	173.5	169.6	0	0	0	0	111.4	F29 T30 E31 W36 K37	F29-V33 HydrophobicContact CD1-CG2 4.03Å; F29-V33 HydrophobicContact CE1-CG2 3.73Å; F29-V33 HydrophobicContact CZ-CG2 4.08Å; F29-V33 WeakPolarHBondContact O-CB 3.33Å; F29-V33 WeakPolarHBondContact O-CG2 3.13Å; F29-V33 PolarHBondContact O-N 2.9Å; T30-V33 PolarHBondContact O-N 2.82Å; E31-V33 VanDerWaalsContact C-N 3.34Å; E31-V33 PolarHBondContact O-N 2.89Å; V33-W36 PolarHBondContact O-N 2.87Å; V33-K37 WeakPolarHBondContact O-CG 3.39Å; V33-K37 PolarHBondContact O-N 3.07Å
34	K	85.6	Confident	81.1	Confident	107 Å²	107	104.7 Å²	104.7	47%	0.465	51%	0.506	S	S	.	.	H	α-helix	trans	-63.9	-43.3	174.4	-72.8	175.1	-172.6	167.3	0	111.9	T30 E31 K37 S38	T30-K34 WeakPolarHBondContact O-CG 3.42Å; T30-K34 PolarHBondContact O-N 3.04Å; E31-K34 PolarHBondContact O-N 3.09Å; E31-K34 IonicContact OE1-NZ 2.74Å; E31-K34 PolarHBondContact OE1-NZ 2.79Å; K34-K37 PolarHBondContact O-N 2.72Å; K34-S38 WeakPolarHBondContact O-CB 3.21Å; K34-S38 PolarHBondContact O-N 3.44Å; K34-S38 PolarHBondContact O-OG 3.4Å
35	L	83	Confident	82.3	Confident	109 Å²	109	111.3 Å²	111.3	57%	0.571	52%	0.524	S	S	*	.	H	α-helix	trans	-60.3	-46.2	174.8	-76.3	170.4	0	0	0	110.7	E31 S32 K37 S38 I39	E31-L35 WeakPolarHBondContact O-CB 3.2Å; E31-L35 WeakPolarHBondContact O-CG 3.34Å; E31-L35 PolarHBondContact O-N 3.08Å; S32-L35 PolarHBondContact O-N 3.18Å; L35-K37 PolarHBondContact O-N 3.22Å; L35-S38 PolarHBondContact O-N 2.87Å; L35-I39 WeakPolarHBondContact O-CB 3.15Å; L35-I39 VanDerWaalsContact O-CG1 3.27Å; L35-I39 WeakPolarHBondContact O-CG1 3.27Å; L35-I39 PolarHBondContact O-N 3.2Å
36	W	83.4	Confident	83.4	Confident	176 Å²	176	113.1 Å²	113.1	67%	0.667	53%	0.531	S	S	*	.	H	α-helix	trans	-61.7	-42.2	178.2	-172.6	-106.4	0	0	0	112.5	S32 V33 I39 T40	S32-W36 WeakPolarHBondContact O-CB 3.47Å; S32-W36 PolarHBondContact O-N 3.26Å; V33-W36 PolarHBondContact O-N 2.87Å; W36-I39 PolarHBondContact O-N 2.98Å; W36-T40 WeakPolarHBondContact O-CB 3.26Å; W36-T40 PolarHBondContact O-N 3.19Å; W36-T40 PolarHBondContact O-OG1 2.92Å
37	K	90.2	Very high	84.2	Confident	131 Å²	131	109.6 Å²	109.6	57%	0.57	52%	0.517	S	S	*	.	H	α-helix	trans	-60.4	-46.2	173.4	-77.3	-178.3	179.2	-177.5	0	111.6	V33 K34 L35 I39 T40 E41	V33-K37 WeakPolarHBondContact O-CG 3.39Å; V33-K37 PolarHBondContact O-N 3.07Å; K34-K37 PolarHBondContact O-N 2.72Å; L35-K37 PolarHBondContact O-N 3.22Å; K37-I39 PolarHBondContact O-N 3.47Å; K37-T40 WeakPolarHBondContact O-CB 3.45Å; K37-T40 PolarHBondContact O-N 3.4Å; K37-E41 WeakPolarHBondContact O-CG 3.33Å; K37-E41 PolarHBondContact O-N 3.37Å
38	S	88.3	Confident	84.8	Confident	70 Å²	70	108.8 Å²	108.8	49%	0.49	51%	0.513	S	S	.	.	H	α-helix	trans	-62.6	-43.8	178.9	-56.1	0	0	0	0	111.8	K34 L35 T40 E41 L42	K34-S38 WeakPolarHBondContact O-CB 3.21Å; K34-S38 PolarHBondContact O-N 3.44Å; K34-S38 PolarHBondContact O-OG 3.4Å; L35-S38 PolarHBondContact O-N 2.87Å; S38-T40 VanDerWaalsContact C-N 3.33Å; S38-T40 PolarHBondContact O-N 3.02Å; S38-E41 PolarHBondContact O-N 3.33Å; S38-L42 WeakPolarHBondContact O-CB 3.43Å; S38-L42 PolarHBondContact O-N 3.43Å
39	I	86.8	Confident	85.4	Confident	96 Å²	96	109.3 Å²	109.3	49%	0.492	52%	0.516	S	S	.	.	H	α-helix	trans	-60.7	-44.3	174.1	-69.8	166.2	0	0	0	110.3	L35 W36 K37 E41 L42 W43	L35-I39 WeakPolarHBondContact O-CB 3.15Å; L35-I39 VanDerWaalsContact O-CG1 3.27Å; L35-I39 WeakPolarHBondContact O-CG1 3.27Å; L35-I39 PolarHBondContact O-N 3.2Å; W36-I39 PolarHBondContact O-N 2.98Å; K37-I39 PolarHBondContact O-N 3.47Å; I39-E41 PolarHBondContact O-N 3.08Å; I39-L42 PolarHBondContact O-N 2.96Å; I39-W43 VanDerWaalsContact O-CB 3.28Å; I39-W43 WeakPolarHBondContact O-CB 3.49Å; I39-W43 PolarHBondContact O-N 3.46Å
40	T	88.1	Confident	85.7	Confident	47 Å²	47	104.2 Å²	104.2	29%	0.288	50%	0.498	S	S	.	.	H	α-helix	trans	-64.8	-40.8	179.8	-57.8	0	0	0	0	111.7	W36 K37 S38 W43 K44	W36-T40 WeakPolarHBondContact O-CB 3.26Å; W36-T40 PolarHBondContact O-N 3.19Å; W36-T40 PolarHBondContact O-OG1 2.92Å; K37-T40 WeakPolarHBondContact O-CB 3.45Å; K37-T40 PolarHBondContact O-N 3.4Å; S38-T40 VanDerWaalsContact C-N 3.33Å; S38-T40 PolarHBondContact O-N 3.02Å; T40-W43 PolarHBondContact O-N 2.82Å; T40-K44 WeakPolarHBondContact O-CG 3.49Å; T40-K44 PolarHBondContact O-N 3.27Å
41	E	90.4	Very high	85.9	Confident	115 Å²	115	107.4 Å²	107.4	54%	0.537	50%	0.502	S	S	.	.	H	α-helix	trans	-65.4	-43.3	174.9	-75.3	179.8	-166.7	0	0	112	K37 S38 I39 W43 K44 R45	K37-E41 WeakPolarHBondContact O-CG 3.33Å; K37-E41 PolarHBondContact O-N 3.37Å; S38-E41 PolarHBondContact O-N 3.33Å; I39-E41 PolarHBondContact O-N 3.08Å; E41-W43 VanDerWaalsContact C-N 3.3Å; E41-W43 PolarHBondContact O-N 3.41Å; E41-K44 PolarHBondContact O-N 3.24Å; E41-R45 WeakPolarHBondContact O-CG 3.25Å; E41-R45 PolarHBondContact O-N 3.36Å
42	L	88.3	Confident	86.1	Confident	128 Å²	128	106.4 Å²	106.4	67%	0.67	50%	0.503	S	S	*	.	H	α-helix	trans	-63.6	-40.2	176.5	-157.6	122.4	0	0	0	110.9	S38 I39 R45 F46	S38-L42 WeakPolarHBondContact O-CB 3.43Å; S38-L42 PolarHBondContact O-N 3.43Å; I39-L42 PolarHBondContact O-N 2.96Å; L42-R45 PolarHBondContact O-N 2.99Å; L42-F46 WeakPolarHBondContact O-CB 3.45Å; L42-F46 PolarHBondContact O-N 2.91Å
43	W	87.4	Confident	86.3	Confident	166 Å²	166	110.3 Å²	110.3	63%	0.629	51%	0.513	S	S	*	.	H	α-helix	trans	-63	-44.5	174.5	-169.3	-100	0	0	0	112	I39 T40 E41 R45 F46 E47	I39-W43 VanDerWaalsContact O-CB 3.28Å; I39-W43 WeakPolarHBondContact O-CB 3.49Å; I39-W43 PolarHBondContact O-N 3.46Å; T40-W43 PolarHBondContact O-N 2.82Å; E41-W43 VanDerWaalsContact C-N 3.3Å; E41-W43 PolarHBondContact O-N 3.41Å; W43-R45 PolarHBondContact O-N 2.93Å; W43-F46 PolarHBondContact O-N 2.77Å; W43-E47 WeakPolarHBondContact O-CB 3.43Å; W43-E47 PolarHBondContact O-N 3.45Å
44	K	89.3	Confident	86.1	Confident	135 Å²	135	112.2 Å²	112.2	59%	0.587	52%	0.52	S	S	*	.	H	α-helix	trans	-60.9	-42.6	175.3	-76.8	176.8	178.9	-178.8	0	112.2	T40 E41 E47 H48	T40-K44 WeakPolarHBondContact O-CG 3.49Å; T40-K44 PolarHBondContact O-N 3.27Å; E41-K44 PolarHBondContact O-N 3.24Å; K44-E47 PolarHBondContact O-N 2.88Å; K44-H48 WeakPolarHBondContact O-CB 3.45Å; K44-H48 PolarHBondContact O-N 3.46Å
45	R	88	Confident	85.9	Confident	178 Å²	178	114 Å²	114	67%	0.672	52%	0.524	S	S	*	.	H	α-helix	trans	-64.5	-41.9	175.4	-70.5	-178.1	-172.4	-152.1	3.9	111.5	E41 L42 W43 H48 N49	E41-R45 WeakPolarHBondContact O-CG 3.25Å; E41-R45 PolarHBondContact O-N 3.36Å; L42-R45 PolarHBondContact O-N 2.99Å; W43-R45 PolarHBondContact O-N 2.93Å; R45-H48 PolarHBondContact O-N 3.46Å; R45-N49 WeakPolarHBondContact O-CB 3.48Å; R45-N49 PolarHBondContact O-N 3.3Å
46	F	87	Confident	85.9	Confident	115 Å²	115	114.7 Å²	114.7	50%	0.504	52%	0.522	S	S	.	.	H	α-helix	trans	-62.9	-47.7	175.5	-179.3	-99	0	0	0	111.5	L42 W43 H48 N49 C50	L42-F46 WeakPolarHBondContact O-CB 3.45Å; L42-F46 PolarHBondContact O-N 2.91Å; W43-F46 PolarHBondContact O-N 2.77Å; F46-H48 VanDerWaalsContact C-N 3.31Å; F46-H48 PolarHBondContact O-N 3.38Å; F46-N49 PolarHBondContact O-N 2.92Å; F46-C50 VanDerWaalsContact CE1-SG 3.51Å; F46-C50 WeakPolarHBondContact CZ-SG 3.44Å; F46-C50 VanDerWaalsContact O-CB 3.3Å; F46-C50 WeakPolarHBondContact O-CB 3.38Å; F46-C50 PolarHBondContact O-N 3.33Å; F46-C50 PolarHBondContact O-SG 3.4Å; F46-C50 VanDerWaalsContact O-SG 3.38Å
47	E	86.5	Confident	85.5	Confident	86 Å²	86	113.3 Å²	113.3	40%	0.402	52%	0.518	S	S	.	.	H	α-helix	trans	-57.7	-45.1	176.3	-168	-161.6	151.8	0	0	111	W43 K44 C50 R51	W43-E47 WeakPolarHBondContact O-CB 3.43Å; W43-E47 PolarHBondContact O-N 3.45Å; K44-E47 PolarHBondContact O-N 2.88Å; E47-C50 PolarHBondContact O-N 3.48Å; E47-R51 WeakPolarHBondContact O-CB 3.45Å; E47-R51 PolarHBondContact O-N 3.48Å; E47-R51 IonicContact OE1-CZ 3.8Å; E47-R51 IonicContact OE1-NE 3.97Å; E47-R51 IonicContact OE1-NH2 2.8Å; E47-R51 PolarHBondContact OE1-NH2 2.8Å
48	H	88.8	Confident	84.9	Confident	118 Å²	118	109.1 Å²	109.1	55%	0.546	50%	0.501	S	S	.	.	H	α-helix	trans	-60.9	-50.1	176.9	-175.1	76.9	0	0	0	111.8	K44 R45 F46 C50 R51 V52	K44-H48 WeakPolarHBondContact O-CB 3.45Å; K44-H48 PolarHBondContact O-N 3.46Å; R45-H48 PolarHBondContact O-N 3.46Å; F46-H48 VanDerWaalsContact C-N 3.31Å; F46-H48 PolarHBondContact O-N 3.38Å; H48-C50 PolarHBondContact O-N 3.37Å; H48-R51 PolarHBondContact O-N 3.03Å; H48-V52 WeakPolarHBondContact O-CG2 3.39Å; H48-V52 PolarHBondContact O-N 3.44Å
49	N	85.1	Confident	84.6	Confident	95 Å²	95	112 Å²	112	51%	0.508	51%	0.507	S	S	.	.	H	α-helix	trans	-63.1	-41.2	179.2	-74.6	-17.2	0	0	0	112.3	R45 F46 V52 K53	R45-N49 WeakPolarHBondContact O-CB 3.48Å; R45-N49 PolarHBondContact O-N 3.3Å; F46-N49 PolarHBondContact O-N 2.92Å; N49-V52 PolarHBondContact O-N 2.87Å; N49-K53 WeakPolarHBondContact O-CB 3.39Å; N49-K53 WeakPolarHBondContact O-CG 3.49Å; N49-K53 PolarHBondContact O-N 2.75Å
50	C	82.4	Confident	84.2	Confident	38 Å²	38	113.1 Å²	113.1	26%	0.257	51%	0.51	S	S	.	.	H	α-helix	trans	-63.4	-45	174.5	-76.7	0	0	0	0	111	F46 E47 H48 V52 K53 I54	F46-C50 VanDerWaalsContact CE1-SG 3.51Å; F46-C50 WeakPolarHBondContact CZ-SG 3.44Å; F46-C50 VanDerWaalsContact O-CB 3.3Å; F46-C50 WeakPolarHBondContact O-CB 3.38Å; F46-C50 PolarHBondContact O-N 3.33Å; F46-C50 PolarHBondContact O-SG 3.4Å; F46-C50 VanDerWaalsContact O-SG 3.38Å; E47-C50 PolarHBondContact O-N 3.48Å; H48-C50 PolarHBondContact O-N 3.37Å; C50-V52 VanDerWaalsContact C-N 3.35Å; C50-V52 PolarHBondContact O-N 3.5Å; C50-K53 PolarHBondContact O-N 3.18Å; C50-I54 VanDerWaalsContact O-CB 3.27Å; C50-I54 WeakPolarHBondContact O-CB 3.4Å; C50-I54 WeakPolarHBondContact O-CD1 3.4Å; C50-I54 WeakPolarHBondContact O-CG1 3.37Å; C50-I54 PolarHBondContact O-N 3.49Å
51	R	83.6	Confident	83.6	Confident	139 Å²	139	115.6 Å²	115.6	53%	0.525	52%	0.522	S	S	.	.	H	α-helix	trans	-60.9	-42.4	176.9	-172.8	-176.9	-65.6	-108.8	4	111.9	E47 H48 R55	E47-R51 WeakPolarHBondContact O-CB 3.45Å; E47-R51 PolarHBondContact O-N 3.48Å; E47-R51 IonicContact OE1-CZ 3.8Å; E47-R51 IonicContact OE1-NE 3.97Å; E47-R51 IonicContact OE1-NH2 2.8Å; E47-R51 PolarHBondContact OE1-NH2 2.8Å; H48-R51 PolarHBondContact O-N 3.03Å; R51-R55 VanDerWaalsContact O-CB 3.26Å; R51-R55 WeakPolarHBondContact O-CB 3.47Å; R51-R55 PolarHBondContact O-N 2.86Å
52	V	85.9	Confident	82.7	Confident	74 Å²	74	115.7 Å²	115.7	45%	0.448	53%	0.526	S	S	.	.	H	α-helix	trans	-65.7	-46.8	176.5	172	0	0	0	0	111	H48 N49 C50 R55 K56	H48-V52 WeakPolarHBondContact O-CG2 3.39Å; H48-V52 PolarHBondContact O-N 3.44Å; N49-V52 PolarHBondContact O-N 2.87Å; C50-V52 VanDerWaalsContact C-N 3.35Å; C50-V52 PolarHBondContact O-N 3.5Å; V52-R55 PolarHBondContact O-N 2.94Å; V52-K56 WeakPolarHBondContact O-CB 3.36Å; V52-K56 PolarHBondContact O-N 3.37Å
53	K	80.7	Confident	82	Confident	140 Å²	140	112.8 Å²	112.8	61%	0.609	51%	0.511	S	S	*	.	H	α-helix	trans	-61.5	-48.3	176.5	-77.2	-176.1	178.3	-174.5	0	111.7	N49 C50 R55 K56 Y57	N49-K53 WeakPolarHBondContact O-CB 3.39Å; N49-K53 WeakPolarHBondContact O-CG 3.49Å; N49-K53 PolarHBondContact O-N 2.75Å; C50-K53 PolarHBondContact O-N 3.18Å; K53-R55 VanDerWaalsContact C-N 3.33Å; K53-R55 PolarHBondContact O-N 3.2Å; K53-K56 PolarHBondContact O-N 2.96Å; K53-Y57 HydrophobicContact CB-CD2 4.44Å; K53-Y57 HydrophobicContact CB-CE2 4.48Å; K53-Y57 WeakPolarHBondContact O-CD2 3.3Å; K53-Y57 PolarHBondContact O-N 2.87Å
54	I	80	Confident	81.3	Confident	93 Å²	93	106.4 Å²	106.4	48%	0.477	50%	0.497	S	S	.	.	H	α-helix	trans	-60	-45.2	178.1	-70	164.8	0	0	0	109.9	C50 K56 Y57 L58	C50-I54 VanDerWaalsContact O-CB 3.27Å; C50-I54 WeakPolarHBondContact O-CB 3.4Å; C50-I54 WeakPolarHBondContact O-CD1 3.4Å; C50-I54 WeakPolarHBondContact O-CG1 3.37Å; C50-I54 PolarHBondContact O-N 3.49Å; I54-K56 VanDerWaalsContact C-N 3.33Å; I54-K56 PolarHBondContact O-N 3.44Å; I54-Y57 PolarHBondContact O-N 3.39Å; I54-L58 HydrophobicContact CG2-CD1 3.7Å; I54-L58 HydrophobicContact CG2-CG 4.09Å; I54-L58 WeakPolarHBondContact O-CB 3.35Å; I54-L58 WeakPolarHBondContact O-CG 3.34Å; I54-L58 PolarHBondContact O-N 2.86Å
55	R	81.1	Confident	80.6	Confident	146 Å²	146	107.5 Å²	107.5	55%	0.551	50%	0.504	S	S	*	.	H	α-helix	trans	-58.2	-47.2	176	-176.8	-178.1	-66.1	172.3	-4.1	111.2	R51 V52 K53 L58 E59	R51-R55 VanDerWaalsContact O-CB 3.26Å; R51-R55 WeakPolarHBondContact O-CB 3.47Å; R51-R55 PolarHBondContact O-N 2.86Å; V52-R55 PolarHBondContact O-N 2.94Å; K53-R55 VanDerWaalsContact C-N 3.33Å; K53-R55 PolarHBondContact O-N 3.2Å; R55-L58 PolarHBondContact O-N 3.23Å; R55-E59 WeakPolarHBondContact CD-OE1 3.28Å; R55-E59 HydrophobicContact CG-CG 4.4Å; R55-E59 WeakPolarHBondContact CG-OE1 3.34Å; R55-E59 WeakPolarHBondContact O-CB 3.43Å; R55-E59 WeakPolarHBondContact O-CG 3.49Å; R55-E59 PolarHBondContact O-N 3.44Å
56	K	82.3	Confident	80.1	Confident	122 Å²	122	105.7 Å²	105.7	53%	0.53	50%	0.501	S	S	.	.	H	α-helix	trans	-60.4	-46.6	177.3	-175.6	173.3	172.4	175.9	0	112.1	V52 K53 I54 L58 E59 E60	V52-K56 WeakPolarHBondContact O-CB 3.36Å; V52-K56 PolarHBondContact O-N 3.37Å; K53-K56 PolarHBondContact O-N 2.96Å; I54-K56 VanDerWaalsContact C-N 3.33Å; I54-K56 PolarHBondContact O-N 3.44Å; K56-L58 VanDerWaalsContact C-N 3.32Å; K56-L58 PolarHBondContact O-N 3.02Å; K56-E59 PolarHBondContact O-N 2.84Å; K56-E60 WeakPolarHBondContact CE-OE1 3.37Å; K56-E60 HydrophobicContact CG-CG 4.36Å; K56-E60 IonicContact NZ-OE1 3.74Å; K56-E60 WeakPolarHBondContact O-CB 3.49Å; K56-E60 WeakPolarHBondContact O-CG 3.39Å; K56-E60 PolarHBondContact O-N 2.85Å
57	Y	75.3	Confident	79.7	Confident	147 Å²	147	104.5 Å²	104.5	58%	0.576	50%	0.499	S	S	*	.	H	α-helix	trans	-60.5	-40.1	174.1	-82	-66.4	0	0	0	112.4	K53 I54 D61	K53-Y57 HydrophobicContact CB-CD2 4.44Å; K53-Y57 HydrophobicContact CB-CE2 4.48Å; K53-Y57 WeakPolarHBondContact O-CD2 3.3Å; K53-Y57 PolarHBondContact O-N 2.87Å; I54-Y57 PolarHBondContact O-N 3.39Å; Y57-D61 PolarHBondContact O-N 2.74Å
58	L	78	Confident	79.3	Confident	44 Å²	44	103.2 Å²	103.2	23%	0.23	50%	0.503	C	S	.	.	H	α-helix	trans	-68.7	-34.5	178.7	-72.2	174.6	0	0	0	112.6	I54 R55 K56 N62 L63 G64 L67	I54-L58 HydrophobicContact CG2-CD1 3.7Å; I54-L58 HydrophobicContact CG2-CG 4.09Å; I54-L58 WeakPolarHBondContact O-CB 3.35Å; I54-L58 WeakPolarHBondContact O-CG 3.34Å; I54-L58 PolarHBondContact O-N 2.86Å; R55-L58 PolarHBondContact O-N 3.23Å; K56-L58 VanDerWaalsContact C-N 3.32Å; K56-L58 PolarHBondContact O-N 3.02Å; L58-N62 CarbonylContact O-C 3.51Å; L58-N62 WeakPolarHBondContact O-CA 3.27Å; L58-N62 PolarHBondContact O-N 3.42Å; L58-L63 HydrophobicContact CD2-CB 3.6Å; L58-L63 PolarHBondContact O-N 3.47Å; L58-G64 PolarHBondContact O-N 3.4Å; L58-L67 HydrophobicContact CD1-CD2 4.26Å; L58-L67 HydrophobicContact CD2-CB 4.47Å; L58-L67 HydrophobicContact CD2-CD2 4.08Å
59	E	80.7	Confident	78.8	Confident	130 Å²	130	100.1 Å²	100.1	61%	0.607	50%	0.498	S	S	*	.	H	α-helix	trans	-73.9	-45.5	176.1	-75.1	170.8	-171.5	0	0	111.5	R55 K56 D61 N62	R55-E59 WeakPolarHBondContact CD-OE1 3.28Å; R55-E59 HydrophobicContact CG-CG 4.4Å; R55-E59 WeakPolarHBondContact CG-OE1 3.34Å; R55-E59 WeakPolarHBondContact O-CB 3.43Å; R55-E59 WeakPolarHBondContact O-CG 3.49Å; R55-E59 PolarHBondContact O-N 3.44Å; K56-E59 PolarHBondContact O-N 2.84Å; E59-D61 PolarHBondContact O-N 2.83Å; E59-N62 PolarHBondContact O-N 2.82Å
60	E	80.2	Confident	78.7	Confident	119 Å²	119	98.8 Å²	98.8	56%	0.556	49%	0.494	S	S	*	.	H	α-helix	trans	-60.9	-41.6	-178.7	-76.8	176.5	171.7	0	0	112.5	K56	K56-E60 WeakPolarHBondContact CE-OE1 3.37Å; K56-E60 HydrophobicContact CG-CG 4.36Å; K56-E60 IonicContact NZ-OE1 3.74Å; K56-E60 WeakPolarHBondContact O-CB 3.49Å; K56-E60 WeakPolarHBondContact O-CG 3.39Å; K56-E60 PolarHBondContact O-N 2.85Å
61	D	74.9	Confident	78.7	Confident	100 Å²	100	100.9 Å²	100.9	54%	0.535	51%	0.505	S	S	.	.	T	Hydrogen-bonded Turn	trans	-97.3	7.7	-176.9	-70.2	-31	0	0	0	113.7	Y57 E59 L63	Y57-D61 PolarHBondContact O-N 2.74Å; E59-D61 PolarHBondContact O-N 2.83Å; D61-L63 HydrophobicContact CB-CB 4.34Å; D61-L63 HydrophobicContact CB-CD1 3.51Å; D61-L63 HydrophobicContact CB-CG 3.53Å; D61-L63 PolarHBondContact O-N 3.44Å
62	N	71.8	Confident	78.7	Confident	117 Å²	117	96.9 Å²	96.9	63%	0.626	50%	0.498	S	S	*	.	T	Hydrogen-bonded Turn	trans	47.6	29.6	-168.2	-76.8	-45	0	0	0	112.8	L58 E59 G64	L58-N62 CarbonylContact O-C 3.51Å; L58-N62 WeakPolarHBondContact O-CA 3.27Å; L58-N62 PolarHBondContact O-N 3.42Å; E59-N62 PolarHBondContact O-N 2.82Å; N62-G64 PolarHBondContact O-N 2.94Å
63	L	73.6	Confident	78.7	Confident	66 Å²	66	97.5 Å²	97.5	35%	0.346	50%	0.498	S	S	.	.	H	α-helix	trans	-74.4	-17.2	-179.1	-77.2	167.1	0	0	0	111.7	L58 D61 E65 K66 L67	L58-L63 HydrophobicContact CD2-CB 3.6Å; L58-L63 PolarHBondContact O-N 3.47Å; D61-L63 HydrophobicContact CB-CB 4.34Å; D61-L63 HydrophobicContact CB-CD1 3.51Å; D61-L63 HydrophobicContact CB-CG 3.53Å; D61-L63 PolarHBondContact O-N 3.44Å; L63-E65 VanDerWaalsContact C-N 3.32Å; L63-E65 PolarHBondContact O-N 2.92Å; L63-K66 HydrophobicContact CD2-CD 4.17Å; L63-K66 PolarHBondContact O-N 2.73Å; L63-L67 VanDerWaalsContact O-CB 3.26Å; L63-L67 WeakPolarHBondContact O-CB 3.48Å; L63-L67 PolarHBondContact O-N 3.07Å
64	G	72.9	Confident	78.8	Confident	33 Å²	33	97.8 Å²	97.8	34%	0.34	50%	0.496	S	S	.	.	H	α-helix	trans	-53.2	-48.4	176.9	0	0	0	0	0	112.5	L58 N62 L67 A68	L58-G64 PolarHBondContact O-N 3.4Å; N62-G64 PolarHBondContact O-N 2.94Å; G64-L67 PolarHBondContact O-N 2.89Å; G64-A68 VanDerWaalsContact O-CB 3.29Å; G64-A68 WeakPolarHBondContact O-CB 3.47Å; G64-A68 PolarHBondContact O-N 3.25Å
65	E	74.6	Confident	79.1	Confident	157 Å²	157	96.6 Å²	96.6	73%	0.734	49%	0.493	S	S	*	.	H	α-helix	trans	-67.9	-43	179	-64.9	-173.2	169.4	0	0	112.2	L63 L67 A68 A69	L63-E65 VanDerWaalsContact C-N 3.32Å; L63-E65 PolarHBondContact O-N 2.92Å; E65-L67 PolarHBondContact O-N 3.4Å; E65-A68 PolarHBondContact O-N 3.24Å; E65-A69 WeakPolarHBondContact O-CB 3.47Å; E65-A69 PolarHBondContact O-N 2.88Å
66	K	77	Confident	79.5	Confident	140 Å²	140	96.6 Å²	96.6	61%	0.609	50%	0.497	S	S	*	.	H	α-helix	trans	-62.2	-44.1	177.2	-71.4	177.8	179.5	170	0	111.3	L63 A69 V70	L63-K66 HydrophobicContact CD2-CD 4.17Å; L63-K66 PolarHBondContact O-N 2.73Å; K66-A69 PolarHBondContact O-N 2.81Å; K66-V70 WeakPolarHBondContact O-CG2 3.2Å; K66-V70 PolarHBondContact O-N 2.98Å
67	L	78.4	Confident	79.8	Confident	90 Å²	90	98.3 Å²	98.3	47%	0.471	50%	0.5	S	S	.	.	H	α-helix	trans	-66.4	-43.5	178.3	-168.6	72.6	0	0	0	110.8	L58 L63 G64 E65 A69 V70 V71	L58-L67 HydrophobicContact CD1-CD2 4.26Å; L58-L67 HydrophobicContact CD2-CB 4.47Å; L58-L67 HydrophobicContact CD2-CD2 4.08Å; L63-L67 VanDerWaalsContact O-CB 3.26Å; L63-L67 WeakPolarHBondContact O-CB 3.48Å; L63-L67 PolarHBondContact O-N 3.07Å; G64-L67 PolarHBondContact O-N 2.89Å; E65-L67 PolarHBondContact O-N 3.4Å; L67-A69 VanDerWaalsContact C-N 3.31Å; L67-A69 PolarHBondContact O-N 3.48Å; L67-V70 PolarHBondContact O-N 2.83Å; L67-V71 VanDerWaalsContact O-CG2 3.32Å; L67-V71 WeakPolarHBondContact O-CG2 3.42Å; L67-V71 PolarHBondContact O-N 3.25Å
68	A	77.9	Confident	80.4	Confident	59 Å²	59	96.2 Å²	96.2	49%	0.488	50%	0.499	S	S	.	.	H	α-helix	trans	-60.4	-40.4	174.9	0	0	0	0	0	111.9	G64 E65 V71 S72	G64-A68 VanDerWaalsContact O-CB 3.29Å; G64-A68 WeakPolarHBondContact O-CB 3.47Å; G64-A68 PolarHBondContact O-N 3.25Å; E65-A68 PolarHBondContact O-N 3.24Å; A68-V71 PolarHBondContact O-N 3.45Å; A68-S72 VanDerWaalsContact O-CB 3.26Å; A68-S72 WeakPolarHBondContact O-CB 3.37Å; A68-S72 PolarHBondContact O-N 3.29Å
69	A	79.5	Confident	80.9	Confident	53 Å²	53	98 Å²	98	44%	0.438	51%	0.509	S	S	.	.	H	α-helix	trans	-62.5	-44.9	174.5	0	0	0	0	0	111.8	E65 K66 L67 S72 I73	E65-A69 WeakPolarHBondContact O-CB 3.47Å; E65-A69 PolarHBondContact O-N 2.88Å; K66-A69 PolarHBondContact O-N 2.81Å; L67-A69 VanDerWaalsContact C-N 3.31Å; L67-A69 PolarHBondContact O-N 3.48Å; A69-S72 WeakPolarHBondContact O-CB 3.44Å; A69-S72 PolarHBondContact O-N 3.24Å; A69-I73 WeakPolarHBondContact O-CG1 3.38Å; A69-I73 PolarHBondContact O-N 2.98Å
70	V	81.9	Confident	81.3	Confident	68 Å²	68	98.6 Å²	98.6	41%	0.412	51%	0.509	S	S	.	.	H	α-helix	trans	-61.5	-49.2	175.9	172.4	0	0	0	0	110.9	K66 L67 S72 I73 Y74	K66-V70 WeakPolarHBondContact O-CG2 3.2Å; K66-V70 PolarHBondContact O-N 2.98Å; L67-V70 PolarHBondContact O-N 2.83Å; V70-S72 VanDerWaalsContact C-N 3.31Å; V70-S72 PolarHBondContact O-N 2.97Å; V70-I73 WeakPolarHBondContact O-CB 3.24Å; V70-I73 PolarHBondContact O-N 3.33Å; V70-I73 VanDerWaalsContact O-N 3.15Å; V70-Y74 HydrophobicContact CG1-CD2 3.7Å; V70-Y74 HydrophobicContact CG1-CE2 3.56Å; V70-Y74 VanDerWaalsContact O-CD2 3.26Å; V70-Y74 WeakPolarHBondContact O-CD2 3.22Å; V70-Y74 PolarHBondContact O-N 3.37Å
71	V	83.1	Confident	81.7	Confident	81 Å²	81	101 Å²	101	49%	0.491	51%	0.513	S	S	.	.	H	α-helix	trans	-59.1	-43.1	177.3	172.4	0	0	0	0	110.9	L67 A68 I73 Y74 V75	L67-V71 VanDerWaalsContact O-CG2 3.32Å; L67-V71 WeakPolarHBondContact O-CG2 3.42Å; L67-V71 PolarHBondContact O-N 3.25Å; A68-V71 PolarHBondContact O-N 3.45Å; V71-I73 VanDerWaalsContact C-N 3.33Å; V71-I73 PolarHBondContact O-N 3.36Å; V71-Y74 PolarHBondContact O-N 3.4Å; V71-Y74 VanDerWaalsContact O-N 3.16Å; V71-V75 HydrophobicContact CG1-CG2 4.18Å; V71-V75 WeakPolarHBondContact O-CG2 3.45Å; V71-V75 PolarHBondContact O-N 2.95Å
72	S	83.5	Confident	82.4	Confident	56 Å²	56	101 Å²	101	39%	0.392	51%	0.512	S	S	.	.	H	α-helix	trans	-58.4	-42.7	175.8	-175.8	0	0	0	0	112.3	A68 A69 V70 V75 K76	A68-S72 VanDerWaalsContact O-CB 3.26Å; A68-S72 WeakPolarHBondContact O-CB 3.37Å; A68-S72 PolarHBondContact O-N 3.29Å; A69-S72 WeakPolarHBondContact O-CB 3.44Å; A69-S72 PolarHBondContact O-N 3.24Å; V70-S72 VanDerWaalsContact C-N 3.31Å; V70-S72 PolarHBondContact O-N 2.97Å; S72-V75 PolarHBondContact O-N 3.41Å; S72-K76 WeakPolarHBondContact O-CB 3.28Å; S72-K76 VanDerWaalsContact O-CG 3.31Å; S72-K76 WeakPolarHBondContact O-CG 3.42Å; S72-K76 PolarHBondContact O-N 3.16Å
73	I	85	Confident	83.2	Confident	86 Å²	86	100.3 Å²	100.3	44%	0.441	51%	0.509	S	S	.	.	H	α-helix	trans	-62.4	-45.7	175.1	-67	164.1	0	0	0	110.9	A69 V70 V71 K76 R77	A69-I73 WeakPolarHBondContact O-CG1 3.38Å; A69-I73 PolarHBondContact O-N 2.98Å; V70-I73 WeakPolarHBondContact O-CB 3.24Å; V70-I73 PolarHBondContact O-N 3.33Å; V70-I73 VanDerWaalsContact O-N 3.15Å; V71-I73 VanDerWaalsContact C-N 3.33Å; V71-I73 PolarHBondContact O-N 3.36Å; I73-K76 PolarHBondContact O-N 3.37Å; I73-R77 WeakPolarHBondContact O-CG 3.3Å; I73-R77 PolarHBondContact O-N 3.34Å
74	Y	83.7	Confident	83.8	Confident	146 Å²	146	101.2 Å²	101.2	57%	0.573	51%	0.512	S	S	*	.	H	α-helix	trans	-63.6	-44	178.3	-83.4	-75.4	0	0	0	112.3	V70 V71 R77 L78	V70-Y74 HydrophobicContact CG1-CD2 3.7Å; V70-Y74 HydrophobicContact CG1-CE2 3.56Å; V70-Y74 VanDerWaalsContact O-CD2 3.26Å; V70-Y74 WeakPolarHBondContact O-CD2 3.22Å; V70-Y74 PolarHBondContact O-N 3.37Å; V71-Y74 PolarHBondContact O-N 3.4Å; V71-Y74 VanDerWaalsContact O-N 3.16Å; Y74-R77 PolarHBondContact O-N 3.19Å; Y74-L78 WeakPolarHBondContact O-CG 3.25Å; Y74-L78 PolarHBondContact O-N 2.81Å
75	V	86.6	Confident	84.4	Confident	68 Å²	68	108.3 Å²	108.3	41%	0.412	53%	0.529	S	S	.	.	H	α-helix	trans	-61.5	-45.7	176.5	171.7	0	0	0	0	110.8	V71 S72 R77 L78 N79	V71-V75 HydrophobicContact CG1-CG2 4.18Å; V71-V75 WeakPolarHBondContact O-CG2 3.45Å; V71-V75 PolarHBondContact O-N 2.95Å; S72-V75 PolarHBondContact O-N 3.41Å; V75-R77 VanDerWaalsContact C-N 3.3Å; V75-R77 PolarHBondContact O-N 3.36Å; V75-L78 PolarHBondContact O-N 3.18Å; V75-N79 PolarHBondContact O-N 2.69Å
76	K	88.3	Confident	84.8	Confident	146 Å²	146	105.3 Å²	105.3	64%	0.635	52%	0.517	S	S	*	.	H	α-helix	trans	-58.5	-41.7	174.9	-75.6	178.6	-177.9	-176.1	0	112.2	S72 I73 K80	S72-K76 WeakPolarHBondContact O-CB 3.28Å; S72-K76 VanDerWaalsContact O-CG 3.31Å; S72-K76 WeakPolarHBondContact O-CG 3.42Å; S72-K76 PolarHBondContact O-N 3.16Å; I73-K76 PolarHBondContact O-N 3.37Å; K76-K80 WeakPolarHBondContact O-CB 3.26Å; K76-K80 PolarHBondContact O-N 3.31Å
77	R	88.5	Confident	85	Confident	158 Å²	158	102 Å²	102	60%	0.596	51%	0.511	S	S	*	.	H	α-helix	trans	-65.8	-39.8	176.6	-73.9	177.8	180	-170.3	1.4	112.3	I73 Y74 V75 R81	I73-R77 WeakPolarHBondContact O-CG 3.3Å; I73-R77 PolarHBondContact O-N 3.34Å; Y74-R77 PolarHBondContact O-N 3.19Å; V75-R77 VanDerWaalsContact C-N 3.3Å; V75-R77 PolarHBondContact O-N 3.36Å; R77-R81 WeakPolarHBondContact O-CG 2.81Å; R77-R81 PolarHBondContact O-N 2.99Å; R77-R81 VanDerWaalsContact O-N 3.09Å
78	L	89	Confident	84.9	Confident	103 Å²	103	103.5 Å²	103.5	54%	0.539	52%	0.516	S	S	.	.	H	α-helix	trans	-67.4	-46.1	177	-76.9	168.7	0	0	0	111.6	Y74 V75 K80 R81 L82	Y74-L78 WeakPolarHBondContact O-CG 3.25Å; Y74-L78 PolarHBondContact O-N 2.81Å; V75-L78 PolarHBondContact O-N 3.18Å; L78-K80 VanDerWaalsContact C-N 3.32Å; L78-K80 PolarHBondContact O-N 3.36Å; L78-R81 WeakPolarHBondContact O-CA 3.47Å; L78-R81 WeakPolarHBondContact O-CB 3.29Å; L78-R81 PolarHBondContact O-N 3.34Å; L78-L82 PolarHBondContact O-N 3.07Å
79	N	87.6	Confident	84.5	Confident	83 Å²	83	106.2 Å²	106.2	44%	0.444	52%	0.522	S	S	.	.	H	α-helix	trans	-58.1	-45.9	175	-73.1	-8.9	0	0	0	110.8	V75 R81 L82 D83	V75-N79 PolarHBondContact O-N 2.69Å; N79-R81 VanDerWaalsContact C-N 3.27Å; N79-R81 PolarHBondContact O-N 3.33Å; N79-L82 WeakPolarHBondContact O-CB 3.37Å; N79-L82 PolarHBondContact O-N 3.3Å; N79-L82 VanDerWaalsContact O-N 3.08Å; N79-D83 WeakPolarHBondContact O-CB 3.41Å; N79-D83 VanDerWaalsContact O-CG 3.25Å; N79-D83 PolarHBondContact O-N 3.05Å
80	K	90	Very high	83.9	Confident	142 Å²	142	113.9 Å²	113.9	62%	0.617	54%	0.54	S	S	*	.	H	α-helix	trans	-57.1	-39.9	174.5	-174.4	175.9	-179.5	177.9	0	112.6	K76 L78 M84	K76-K80 WeakPolarHBondContact O-CB 3.26Å; K76-K80 PolarHBondContact O-N 3.31Å; L78-K80 VanDerWaalsContact C-N 3.32Å; L78-K80 PolarHBondContact O-N 3.36Å; K80-M84 VanDerWaalsContact O-CG 3.25Å; K80-M84 WeakPolarHBondContact O-CG 3.34Å; K80-M84 PolarHBondContact O-N 3.45Å; K80-M84 VanDerWaalsContact O-N 3.07Å
81	R	88.8	Confident	83.1	Confident	170 Å²	170	115 Å²	115	64%	0.642	56%	0.556	S	S	*	*	H	α-helix	trans	-68.3	-38.1	176.2	-74.3	-179.9	177.6	-151	-1.5	112.6	R77 L78 N79 M84 R85	R77-R81 WeakPolarHBondContact O-CG 2.81Å; R77-R81 PolarHBondContact O-N 2.99Å; R77-R81 VanDerWaalsContact O-N 3.09Å; L78-R81 WeakPolarHBondContact O-CA 3.47Å; L78-R81 WeakPolarHBondContact O-CB 3.29Å; L78-R81 PolarHBondContact O-N 3.34Å; N79-R81 VanDerWaalsContact C-N 3.27Å; N79-R81 PolarHBondContact O-N 3.33Å; R81-M84 HydrophobicContact CB-CE 4.46Å; R81-M84 HydrophobicContact CG-CE 4.08Å; R81-R85 WeakPolarHBondContact O-CG 3.42Å; R81-R85 PolarHBondContact O-N 3.22Å
82	L	89.1	Confident	81.8	Confident	99 Å²	99	121.9 Å²	121.9	52%	0.518	58%	0.583	S	S	.	*	H	α-helix	trans	-66.5	-46.7	175.4	-75.6	166.1	0	0	0	111.1	L78 N79 M84 R85 L86	L78-L82 PolarHBondContact O-N 3.07Å; N79-L82 WeakPolarHBondContact O-CB 3.37Å; N79-L82 PolarHBondContact O-N 3.3Å; N79-L82 VanDerWaalsContact O-N 3.08Å; L82-M84 VanDerWaalsContact C-N 3.32Å; L82-M84 PolarHBondContact O-N 3.44Å; L82-R85 PolarHBondContact O-N 3.45Å; L82-L86 WeakPolarHBondContact O-CB 3.4Å; L82-L86 WeakPolarHBondContact O-CG 3.33Å; L82-L86 PolarHBondContact O-N 3.4Å
83	D	89.1	Confident	81.7	Confident	102 Å²	102	125.2 Å²	125.2	55%	0.545	59%	0.593	S	S	.	*	H	α-helix	trans	-59.7	-42.6	177.9	-67.7	-25.8	0	0	0	111.3	N79 L86 S87	N79-D83 WeakPolarHBondContact O-CB 3.41Å; N79-D83 VanDerWaalsContact O-CG 3.25Å; N79-D83 PolarHBondContact O-N 3.05Å; D83-L86 PolarHBondContact O-N 2.89Å; D83-S87 WeakPolarHBondContact O-CB 3.32Å; D83-S87 PolarHBondContact O-N 3.42Å; D83-S87 PolarHBondContact O-OG 3.44Å
84	M	86.5	Confident	81.5	Confident	86 Å²	86	127.3 Å²	127.3	42%	0.424	60%	0.601	S	S	.	*	H	α-helix	trans	-59.8	-48.9	175	-73.9	-176.4	-51.1	0	0	111.6	K80 R81 L82 L86 S87 E88	K80-M84 VanDerWaalsContact O-CG 3.25Å; K80-M84 WeakPolarHBondContact O-CG 3.34Å; K80-M84 PolarHBondContact O-N 3.45Å; K80-M84 VanDerWaalsContact O-N 3.07Å; R81-M84 HydrophobicContact CB-CE 4.46Å; R81-M84 HydrophobicContact CG-CE 4.08Å; L82-M84 VanDerWaalsContact C-N 3.32Å; L82-M84 PolarHBondContact O-N 3.44Å; M84-L86 PolarHBondContact O-N 2.92Å; M84-S87 WeakPolarHBondContact CA-OG 3.39Å; M84-S87 PolarHBondContact O-N 3.26Å; M84-S87 PolarHBondContact O-OG 2.86Å; M84-E88 WeakPolarHBondContact O-CG 3.24Å; M84-E88 PolarHBondContact O-N 2.92Å
85	R	84.9	Confident	81.4	Confident	182 Å²	182	126.2 Å²	126.2	69%	0.687	60%	0.602	S	S	*	*	H	α-helix	trans	-64.3	-40.8	179	-70.4	-160.6	-176.7	-128	0.6	112.9	R81 L82 S87 E88 D89	R81-R85 WeakPolarHBondContact O-CG 3.42Å; R81-R85 PolarHBondContact O-N 3.22Å; L82-R85 PolarHBondContact O-N 3.45Å; R85-S87 VanDerWaalsContact C-N 3.26Å; R85-S87 PolarHBondContact O-N 3.46Å; R85-E88 PolarHBondContact O-N 3.43Å; R85-D89 PolarHBondContact O-N 3.04Å
86	L	82.8	Confident	81.1	Confident	94 Å²	94	129.6 Å²	129.6	49%	0.492	61%	0.613	S	S	.	*	H	α-helix	trans	-67.7	-27.1	176.5	-72.1	172.3	0	0	0	112.8	L82 D83 M84 R90	L82-L86 WeakPolarHBondContact O-CB 3.4Å; L82-L86 WeakPolarHBondContact O-CG 3.33Å; L82-L86 PolarHBondContact O-N 3.4Å; D83-L86 PolarHBondContact O-N 2.89Å; M84-L86 PolarHBondContact O-N 2.92Å; L86-R90 WeakPolarHBondContact O-CG 3.43Å
87	S	81	Confident	80.6	Confident	69 Å²	69	128.6 Å²	128.6	48%	0.483	61%	0.612	S	S	.	*	H	α-helix	trans	-78.4	-34.8	174.3	67.5	0	0	0	0	112.8	D83 M84 R85 R90 A91	D83-S87 WeakPolarHBondContact O-CB 3.32Å; D83-S87 PolarHBondContact O-N 3.42Å; D83-S87 PolarHBondContact O-OG 3.44Å; M84-S87 WeakPolarHBondContact CA-OG 3.39Å; M84-S87 PolarHBondContact O-N 3.26Å; M84-S87 PolarHBondContact O-OG 2.86Å; R85-S87 VanDerWaalsContact C-N 3.26Å; R85-S87 PolarHBondContact O-N 3.46Å; S87-R90 PolarHBondContact O-N 3.19Å; S87-A91 PolarHBondContact O-N 3.4Å
88	E	75.9	Confident	80.1	Confident	122 Å²	122	126.7 Å²	126.7	57%	0.57	61%	0.613	S	S	*	*	H	α-helix	trans	-64.6	-46.9	173.3	-72.8	167.7	176.5	0	0	110.4	M84 R85 R90 A91	M84-E88 WeakPolarHBondContact O-CG 3.24Å; M84-E88 PolarHBondContact O-N 2.92Å; R85-E88 PolarHBondContact O-N 3.43Å; E88-R90 PolarHBondContact O-N 2.96Å; E88-R90 VanDerWaalsContact O-N 3.08Å; E88-A91 PolarHBondContact O-N 3.36Å
89	D	69.3	Low	79.4	Confident	116 Å²	116	128.4 Å²	128.4	62%	0.62	62%	0.618	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.7	-17.9	177	-74.6	-8	0	0	0	114	R85	R85-D89 PolarHBondContact O-N 3.04Å
90	R	67.4	Low	78.8	Confident	215 Å²	215	131.8 Å²	131.8	81%	0.811	63%	0.632	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.9	-12.5	177	-74.4	-177.4	-167.8	-171.6	4.4	113.7	L86 S87 E88	L86-R90 WeakPolarHBondContact O-CG 3.43Å; S87-R90 PolarHBondContact O-N 3.19Å; E88-R90 PolarHBondContact O-N 2.96Å; E88-R90 VanDerWaalsContact O-N 3.08Å
91	A	65.9	Low	77.9	Confident	90 Å²	90	131 Å²	131	74%	0.744	63%	0.633	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.4	-12.1	-179.7	0	0	0	0	0	112.6	S87 E88	S87-A91 PolarHBondContact O-N 3.4Å; E88-A91 PolarHBondContact O-N 3.36Å
92	E	54.1	Low	76.9	Confident	227 Å²	227	127.5 Å²	127.5	100%	1.061	63%	0.632	S	S	*	*			trans	-89.8	0	167.3	-64.9	-173.7	172.2	0	0	111.7

Retrieved 92 of 92 residues in 218.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).