G4V7E7_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession G4V7E7, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 62 aa.

						>G4V7E7_SCHMA|G4V7E7
MNANVNAMPNSYARTSGMTELILRTVIWVMRISHTILIHYQIQLINSVSPNGNVINPFAKKL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.3	Very low	60.1	Low	245 Å²	245	116 Å²	116	100%	1.207	67%	0.671	S	S	*	*				0	110.9	0	-75.2	168.8	167.8	0	0	107.8	A3	M1-A3 PolarHBondContact O-N 3.47Å
2	N	50.4	Low	61.3	Low	110 Å²	110	118.4 Å²	118.4	59%	0.588	66%	0.662	S	S	*	*			trans	-76.8	102.5	-173.5	-175	9.1	0	0	0	109.6	N4 V5	N2-N4 PolarHBondContact O-N 2.87Å; N2-N4 WeakPolarHBondContact OD1-CB 3.34Å; N2-N4 PolarHBondContact OD1-N 2.92Å; N2-V5 HydrophobicContact CB-CG2 4.25Å; N2-V5 WeakPolarHBondContact O-CG2 3.29Å; N2-V5 PolarHBondContact O-N 3.34Å
3	A	57.6	Low	62.4	Low	89 Å²	89	113.4 Å²	113.4	74%	0.736	65%	0.645	S	S	*	*	G	3₁₀ helix	trans	-62.5	-11.1	177.8	0	0	0	0	0	113.3	M1	M1-A3 PolarHBondContact O-N 3.47Å
4	N	56	Low	63.5	Low	121 Å²	121	116.4 Å²	116.4	65%	0.647	64%	0.641	S	S	*	*	G	3₁₀ helix	trans	-78.7	-18.9	-178.6	-161.1	17.4	0	0	0	114.2	N2 N6	N2-N4 PolarHBondContact O-N 2.87Å; N2-N4 WeakPolarHBondContact OD1-CB 3.34Å; N2-N4 PolarHBondContact OD1-N 2.92Å; N4-N6 VanDerWaalsContact C-N 3.27Å; N4-N6 PolarHBondContact O-N 3.07Å
5	V	52.6	Low	64.6	Low	116 Å²	116	114.1 Å²	114.1	70%	0.703	63%	0.631	S	S	*	*	G	3₁₀ helix	trans	-74.6	-15	177.9	-91.9	0	0	0	0	113.7	N2	N2-V5 HydrophobicContact CB-CG2 4.25Å; N2-V5 WeakPolarHBondContact O-CG2 3.29Å; N2-V5 PolarHBondContact O-N 3.34Å
6	N	60.2	Low	65.8	Low	149 Å²	149	111.4 Å²	111.4	80%	0.797	62%	0.623	S	S	*	*	G	3₁₀ helix	trans	-105.5	3.1	177.4	-71.7	-25	0	0	0	113.6	N4 M8	N4-N6 VanDerWaalsContact C-N 3.27Å; N4-N6 PolarHBondContact O-N 3.07Å; N6-M8 VanDerWaalsContact C-N 3.29Å; N6-M8 PolarHBondContact O-N 3.43Å
7	A	59.7	Low	67.1	Low	61 Å²	61	106.8 Å²	106.8	50%	0.504	61%	0.606	S	S	.	*			trans	-78.7	82.6	174	0	0	0	0	0	108.8	P9	A7-P9 WeakPolarHBondContact O-CD 3.42Å; A7-P9 VanDerWaalsContact O-N 3.14Å
8	M	63.1	Low	68.3	Low	127 Å²	127	106.9 Å²	106.9	63%	0.626	60%	0.603	S	S	*	*			trans	-52.7	122.8	166.1	-170	143.2	170.7	0	0	107.1	N6 N10 Y12	N6-M8 VanDerWaalsContact C-N 3.29Å; N6-M8 PolarHBondContact O-N 3.43Å; M8-N10 PolarHBondContact O-N 3.26Å; M8-Y12 HydrophobicContact CE-CG 4.38Å
9	P	67.1	Low	69.6	Low	68 Å²	68	105.6 Å²	105.6	44%	0.442	60%	0.597	S	S	.	*			trans	-56.6	134.2	-173.5	-20.1	26.8	0	0	0	108.6	A7 S11 Y12 A13	A7-P9 WeakPolarHBondContact O-CD 3.42Å; A7-P9 VanDerWaalsContact O-N 3.14Å; P9-S11 CarbonylContact O-C 3.56Å; P9-S11 PolarHBondContact O-N 2.93Å; P9-Y12 HydrophobicContact CB-CD2 3.79Å; P9-Y12 HydrophobicContact CB-CE2 4.32Å; P9-Y12 HydrophobicContact CG-CD2 3.54Å; P9-Y12 HydrophobicContact CG-CE2 3.8Å; P9-Y12 PolarHBondContact O-N 3.11Å; P9-A13 PolarHBondContact O-N 2.89Å
10	N	71.8	Confident	70.7	Confident	120 Å²	120	105.1 Å²	105.1	64%	0.642	59%	0.59	S	S	*	*	H	α-helix	trans	-49.8	-27.7	-177	-174	32.3	0	0	0	112.5	M8 R14	M8-N10 PolarHBondContact O-N 3.26Å; N10-R14 WeakPolarHBondContact O-CB 3.34Å; N10-R14 WeakPolarHBondContact O-CG 3.39Å; N10-R14 PolarHBondContact O-N 3.39Å
11	S	72.8	Confident	71.8	Confident	70 Å²	70	105.4 Å²	105.4	49%	0.49	59%	0.59	S	S	.	*	H	α-helix	trans	-59.5	-48	170.6	52.3	0	0	0	0	113.5	P9 R14 T15	P9-S11 CarbonylContact O-C 3.56Å; P9-S11 PolarHBondContact O-N 2.93Å; S11-R14 PolarHBondContact O-N 3.34Å; S11-T15 WeakPolarHBondContact O-CB 3.31Å; S11-T15 PolarHBondContact O-N 3.26Å; S11-T15 PolarHBondContact O-OG1 3.32Å
12	Y	74.9	Confident	74	Confident	145 Å²	145	98.9 Å²	98.9	57%	0.569	56%	0.558	S	S	*	*	H	α-helix	trans	-65.5	-40.5	178.5	-74.1	-85.7	0	0	0	112.2	M8 P9 R14 T15 S16	M8-Y12 HydrophobicContact CE-CG 4.38Å; P9-Y12 HydrophobicContact CB-CD2 3.79Å; P9-Y12 HydrophobicContact CB-CE2 4.32Å; P9-Y12 HydrophobicContact CG-CD2 3.54Å; P9-Y12 HydrophobicContact CG-CE2 3.8Å; P9-Y12 PolarHBondContact O-N 3.11Å; Y12-R14 VanDerWaalsContact C-N 3.34Å; Y12-R14 PolarHBondContact O-N 2.91Å; Y12-T15 PolarHBondContact O-N 2.88Å; Y12-S16 VanDerWaalsContact O-CB 3.3Å; Y12-S16 WeakPolarHBondContact O-CB 3.31Å; Y12-S16 PolarHBondContact O-N 3.49Å
13	A	75.2	Confident	76.2	Confident	53 Å²	53	98.5 Å²	98.5	44%	0.438	56%	0.556	S	S	.	*	H	α-helix	trans	-62	-43.5	176	0	0	0	0	0	111.3	P9 S16 G17	P9-A13 PolarHBondContact O-N 2.89Å; A13-S16 PolarHBondContact O-N 2.87Å; A13-G17 PolarHBondContact O-N 2.88Å
14	R	78.4	Confident	78	Confident	156 Å²	156	101.7 Å²	101.7	59%	0.589	55%	0.549	S	S	*	.	H	α-helix	trans	-64.9	-46.1	175.5	-71.3	176.9	74.5	-167.4	3.2	112.3	N10 S11 Y12 S16 G17 M18	N10-R14 WeakPolarHBondContact O-CB 3.34Å; N10-R14 WeakPolarHBondContact O-CG 3.39Å; N10-R14 PolarHBondContact O-N 3.39Å; S11-R14 PolarHBondContact O-N 3.34Å; Y12-R14 VanDerWaalsContact C-N 3.34Å; Y12-R14 PolarHBondContact O-N 2.91Å; R14-S16 VanDerWaalsContact C-N 3.35Å; R14-S16 PolarHBondContact O-N 2.58Å; R14-G17 PolarHBondContact O-N 3.02Å; R14-M18 WeakPolarHBondContact O-CG 3.23Å; R14-M18 PolarHBondContact O-N 3.48Å
15	T	80.7	Confident	79.8	Confident	81 Å²	81	99.9 Å²	99.9	50%	0.497	54%	0.542	S	S	.	.	H	α-helix	trans	-60.7	-45.4	176.9	-59.4	0	0	0	0	110.7	S11 Y12 G17 M18 T19	S11-T15 WeakPolarHBondContact O-CB 3.31Å; S11-T15 PolarHBondContact O-N 3.26Å; S11-T15 PolarHBondContact O-OG1 3.32Å; Y12-T15 PolarHBondContact O-N 2.88Å; T15-G17 VanDerWaalsContact C-N 3.34Å; T15-G17 PolarHBondContact O-N 2.69Å; T15-M18 PolarHBondContact O-N 3.49Å; T15-T19 PolarHBondContact O-N 3.29Å; T15-T19 PolarHBondContact O-OG1 2.93Å
16	S	83	Confident	81.8	Confident	71 Å²	71	97.8 Å²	97.8	50%	0.497	53%	0.529	S	S	.	.	H	α-helix	trans	-60.3	-42.5	177.6	-171	0	0	0	0	112	Y12 A13 R14 T19 E20	Y12-S16 VanDerWaalsContact O-CB 3.3Å; Y12-S16 WeakPolarHBondContact O-CB 3.31Å; Y12-S16 PolarHBondContact O-N 3.49Å; A13-S16 PolarHBondContact O-N 2.87Å; R14-S16 VanDerWaalsContact C-N 3.35Å; R14-S16 PolarHBondContact O-N 2.58Å; S16-T19 PolarHBondContact O-N 3.45Å; S16-E20 WeakPolarHBondContact O-CB 3.12Å; S16-E20 PolarHBondContact O-N 3.16Å
17	G	87.7	Confident	83.5	Confident	33 Å²	33	94.5 Å²	94.5	34%	0.34	51%	0.511	S	S	.	.	H	α-helix	trans	-64.4	-41.2	175.8	0	0	0	0	0	112.8	A13 R14 T15 E20 L21	A13-G17 PolarHBondContact O-N 2.88Å; R14-G17 PolarHBondContact O-N 3.02Å; T15-G17 VanDerWaalsContact C-N 3.34Å; T15-G17 PolarHBondContact O-N 2.69Å; G17-E20 PolarHBondContact O-N 3.46Å; G17-L21 WeakPolarHBondContact O-CG 3.36Å; G17-L21 PolarHBondContact O-N 3.31Å
18	M	89.8	Confident	85.1	Confident	110 Å²	110	99.8 Å²	99.8	54%	0.542	52%	0.518	S	S	.	.	H	α-helix	trans	-63.6	-44.9	174.7	-72.1	179.9	175	0	0	111.8	R14 T15 E20 L21 I22	R14-M18 WeakPolarHBondContact O-CG 3.23Å; R14-M18 PolarHBondContact O-N 3.48Å; T15-M18 PolarHBondContact O-N 3.49Å; M18-E20 VanDerWaalsContact C-N 3.33Å; M18-E20 PolarHBondContact O-N 3.04Å; M18-L21 PolarHBondContact O-N 2.92Å; M18-I22 VanDerWaalsContact O-CG1 3.3Å; M18-I22 WeakPolarHBondContact O-CG1 3.24Å; M18-I22 PolarHBondContact O-N 3.11Å
19	T	91.4	Very high	86.6	Confident	81 Å²	81	97.2 Å²	97.2	50%	0.497	51%	0.509	S	S	.	.	H	α-helix	trans	-61.9	-40.5	176.3	-57.3	0	0	0	0	111.4	T15 S16 I22 L23	T15-T19 PolarHBondContact O-N 3.29Å; T15-T19 PolarHBondContact O-OG1 2.93Å; S16-T19 PolarHBondContact O-N 3.45Å; T19-I22 PolarHBondContact O-N 2.96Å; T19-L23 WeakPolarHBondContact O-CB 3.28Å; T19-L23 PolarHBondContact O-N 3.36Å
20	E	93.1	Very high	88	Confident	95 Å²	95	99.3 Å²	99.3	44%	0.444	52%	0.515	S	S	.	.	H	α-helix	trans	-62.2	-44.9	175.6	-170.7	-176	126.4	0	0	111.7	S16 G17 M18 I22 L23 R24	S16-E20 WeakPolarHBondContact O-CB 3.12Å; S16-E20 PolarHBondContact O-N 3.16Å; G17-E20 PolarHBondContact O-N 3.46Å; M18-E20 VanDerWaalsContact C-N 3.33Å; M18-E20 PolarHBondContact O-N 3.04Å; E20-I22 PolarHBondContact O-N 3.47Å; E20-L23 PolarHBondContact O-N 3.25Å; E20-R24 WeakPolarHBondContact O-CB 3.14Å; E20-R24 WeakPolarHBondContact O-CG 3.44Å; E20-R24 PolarHBondContact O-N 3.47Å; E20-R24 IonicContact OE1-CZ 3.25Å; E20-R24 VanDerWaalsContact OE1-CZ 3.25Å; E20-R24 IonicContact OE1-NE 2.84Å; E20-R24 PolarHBondContact OE1-NE 2.91Å; E20-R24 IonicContact OE1-NH2 2.78Å; E20-R24 PolarHBondContact OE1-NH2 3.49Å
21	L	94	Very high	89	Confident	113 Å²	113	102.4 Å²	102.4	59%	0.592	52%	0.517	S	S	*	.	H	α-helix	trans	-61.7	-43.1	177	-73.6	170.4	0	0	0	112.2	G17 M18 R24 T25	G17-L21 WeakPolarHBondContact O-CG 3.36Å; G17-L21 PolarHBondContact O-N 3.31Å; M18-L21 PolarHBondContact O-N 2.92Å; L21-R24 PolarHBondContact O-N 2.9Å; L21-T25 WeakPolarHBondContact O-CB 3.46Å; L21-T25 PolarHBondContact O-N 3.02Å; L21-T25 PolarHBondContact O-OG1 3.44Å
22	I	94.8	Very high	90	Very high	107 Å²	107	102.1 Å²	102.1	55%	0.549	51%	0.51	S	S	.	.	H	α-helix	trans	-61.4	-47.9	175.2	-67.9	164.7	0	0	0	109.8	M18 T19 E20 R24 T25 V26	M18-I22 VanDerWaalsContact O-CG1 3.3Å; M18-I22 WeakPolarHBondContact O-CG1 3.24Å; M18-I22 PolarHBondContact O-N 3.11Å; T19-I22 PolarHBondContact O-N 2.96Å; E20-I22 PolarHBondContact O-N 3.47Å; I22-R24 PolarHBondContact O-N 3.24Å; I22-T25 WeakPolarHBondContact O-CB 3.44Å; I22-T25 PolarHBondContact O-N 3.17Å; I22-T25 VanDerWaalsContact O-N 3.15Å; I22-V26 HydrophobicContact CG2-CG2 4.29Å; I22-V26 WeakPolarHBondContact O-CG2 3.46Å; I22-V26 PolarHBondContact O-N 3.21Å
23	L	95.6	Very high	90.8	Very high	102 Å²	102	98.3 Å²	98.3	53%	0.534	50%	0.504	S	S	.	.	H	α-helix	trans	-60.8	-45	-179.8	-176.5	63.3	0	0	0	111.8	T19 E20 T25 V26 I27	T19-L23 WeakPolarHBondContact O-CB 3.28Å; T19-L23 PolarHBondContact O-N 3.36Å; E20-L23 PolarHBondContact O-N 3.25Å; L23-T25 VanDerWaalsContact C-N 3.3Å; L23-T25 PolarHBondContact O-N 2.99Å; L23-V26 PolarHBondContact O-N 3.37Å; L23-I27 HydrophobicContact CD1-CD1 4.2Å; L23-I27 HydrophobicContact CD1-CG1 4.49Å; L23-I27 HydrophobicContact CG-CD1 3.98Å; L23-I27 VanDerWaalsContact O-CG1 3.29Å; L23-I27 WeakPolarHBondContact O-CG1 3.39Å; L23-I27 PolarHBondContact O-N 2.94Å
24	R	95.7	Very high	91.7	Very high	157 Å²	157	101.2 Å²	101.2	59%	0.592	51%	0.509	S	S	*	.	H	α-helix	trans	-59.1	-42.5	174.9	-73.6	175.5	-177.4	-85.7	1.2	111.6	E20 L21 I22 I27 W28	E20-R24 WeakPolarHBondContact O-CB 3.14Å; E20-R24 WeakPolarHBondContact O-CG 3.44Å; E20-R24 PolarHBondContact O-N 3.47Å; E20-R24 IonicContact OE1-CZ 3.25Å; E20-R24 VanDerWaalsContact OE1-CZ 3.25Å; E20-R24 IonicContact OE1-NE 2.84Å; E20-R24 PolarHBondContact OE1-NE 2.91Å; E20-R24 IonicContact OE1-NH2 2.78Å; E20-R24 PolarHBondContact OE1-NH2 3.49Å; L21-R24 PolarHBondContact O-N 2.9Å; I22-R24 PolarHBondContact O-N 3.24Å; R24-I27 PolarHBondContact O-N 2.89Å; R24-W28 WeakPolarHBondContact O-CB 3.29Å; R24-W28 PolarHBondContact O-N 3.45Å
25	T	94.6	Very high	92.3	Very high	83 Å²	83	97.3 Å²	97.3	51%	0.509	50%	0.502	S	S	.	.	H	α-helix	trans	-64.2	-46.7	178.3	-56	0	0	0	0	111.3	L21 I22 L23 I27 W28 V29	L21-T25 WeakPolarHBondContact O-CB 3.46Å; L21-T25 PolarHBondContact O-N 3.02Å; L21-T25 PolarHBondContact O-OG1 3.44Å; I22-T25 WeakPolarHBondContact O-CB 3.44Å; I22-T25 PolarHBondContact O-N 3.17Å; I22-T25 VanDerWaalsContact O-N 3.15Å; L23-T25 VanDerWaalsContact C-N 3.3Å; L23-T25 PolarHBondContact O-N 2.99Å; T25-I27 PolarHBondContact O-N 3.34Å; T25-W28 PolarHBondContact O-N 2.91Å; T25-V29 WeakPolarHBondContact O-CG2 3.4Å; T25-V29 PolarHBondContact O-N 3.38Å
26	V	94.9	Very high	92.7	Very high	71 Å²	71	98.5 Å²	98.5	43%	0.43	50%	0.504	S	S	.	.	H	α-helix	trans	-61.6	-44.8	178.4	172.2	0	0	0	0	111.1	I22 L23 W28 V29 M30	I22-V26 HydrophobicContact CG2-CG2 4.29Å; I22-V26 WeakPolarHBondContact O-CG2 3.46Å; I22-V26 PolarHBondContact O-N 3.21Å; L23-V26 PolarHBondContact O-N 3.37Å; V26-W28 VanDerWaalsContact C-N 3.32Å; V26-W28 PolarHBondContact O-N 3.48Å; V26-V29 PolarHBondContact O-N 2.94Å; V26-M30 HydrophobicContact CG1-CE 4.06Å; V26-M30 WeakPolarHBondContact O-CG 3.44Å; V26-M30 PolarHBondContact O-N 3.49Å
27	I	94.9	Very high	93.1	Very high	80 Å²	80	99.8 Å²	99.8	41%	0.41	51%	0.505	S	S	.	.	H	α-helix	trans	-60.9	-42.5	176.1	-68.8	167.6	0	0	0	110.9	L23 R24 T25 M30 R31	L23-I27 HydrophobicContact CD1-CD1 4.2Å; L23-I27 HydrophobicContact CD1-CG1 4.49Å; L23-I27 HydrophobicContact CG-CD1 3.98Å; L23-I27 VanDerWaalsContact O-CG1 3.29Å; L23-I27 WeakPolarHBondContact O-CG1 3.39Å; L23-I27 PolarHBondContact O-N 2.94Å; R24-I27 PolarHBondContact O-N 2.89Å; T25-I27 PolarHBondContact O-N 3.34Å; I27-M30 HydrophobicContact CG1-CE 4.24Å; I27-M30 PolarHBondContact O-N 2.94Å; I27-R31 WeakPolarHBondContact O-CG 3.36Å; I27-R31 PolarHBondContact O-N 3.08Å
28	W	94.8	Very high	93.2	Very high	172 Å²	172	101.8 Å²	101.8	65%	0.652	51%	0.507	S	S	*	.	H	α-helix	trans	-63.5	-45.2	178.8	-169.3	81.4	0	0	0	112.1	R24 T25 V26 M30 R31 I32	R24-W28 WeakPolarHBondContact O-CB 3.29Å; R24-W28 PolarHBondContact O-N 3.45Å; T25-W28 PolarHBondContact O-N 2.91Å; V26-W28 VanDerWaalsContact C-N 3.32Å; V26-W28 PolarHBondContact O-N 3.48Å; W28-M30 PolarHBondContact O-N 3.26Å; W28-R31 PolarHBondContact O-N 3.2Å; W28-I32 HydrophobicContact CD2-CD1 3.63Å; W28-I32 HydrophobicContact CE3-CD1 3.42Å; W28-I32 VanDerWaalsContact CE3-CD1 3.42Å; W28-I32 HydrophobicContact CH2-CD1 3.27Å; W28-I32 HydrophobicContact CZ2-CD1 3.48Å; W28-I32 VanDerWaalsContact CZ2-CD1 3.48Å; W28-I32 HydrophobicContact CZ3-CD1 3.23Å; W28-I32 WeakPolarHBondContact O-CG1 3.33Å; W28-I32 PolarHBondContact O-N 3.01Å; W28-I32 VanDerWaalsContact O-N 3.08Å
29	V	94.5	Very high	93	Very high	73 Å²	73	101.8 Å²	101.8	44%	0.442	51%	0.506	S	S	.	.	H	α-helix	trans	-60.9	-45.3	175.2	172.6	0	0	0	0	111.1	T25 V26 R31 I32 S33	T25-V29 WeakPolarHBondContact O-CG2 3.4Å; T25-V29 PolarHBondContact O-N 3.38Å; V26-V29 PolarHBondContact O-N 2.94Å; V29-R31 VanDerWaalsContact C-N 3.31Å; V29-R31 PolarHBondContact O-N 3.43Å; V29-I32 PolarHBondContact O-N 2.98Å; V29-S33 PolarHBondContact O-N 2.94Å; V29-S33 PolarHBondContact O-OG 3.36Å
30	M	94.7	Very high	92.6	Very high	113 Å²	113	103.5 Å²	103.5	56%	0.557	50%	0.504	S	S	*	.	H	α-helix	trans	-59.9	-40.7	177	-74.1	-167.7	-64.2	0	0	112.4	V26 I27 W28 S33 H34	V26-M30 HydrophobicContact CG1-CE 4.06Å; V26-M30 WeakPolarHBondContact O-CG 3.44Å; V26-M30 PolarHBondContact O-N 3.49Å; I27-M30 HydrophobicContact CG1-CE 4.24Å; I27-M30 PolarHBondContact O-N 2.94Å; W28-M30 PolarHBondContact O-N 3.26Å; M30-S33 PolarHBondContact O-N 3.47Å; M30-H34 WeakPolarHBondContact O-CB 3.34Å; M30-H34 PolarHBondContact O-N 2.96Å
31	R	94.2	Very high	92.1	Very high	184 Å²	184	103.5 Å²	103.5	69%	0.694	50%	0.504	S	S	*	.	H	α-helix	trans	-63.1	-43	176.7	-71.6	-178.3	107.6	-177.5	5.3	111.8	I27 W28 V29 H34 T35	I27-R31 WeakPolarHBondContact O-CG 3.36Å; I27-R31 PolarHBondContact O-N 3.08Å; W28-R31 PolarHBondContact O-N 3.2Å; V29-R31 VanDerWaalsContact C-N 3.31Å; V29-R31 PolarHBondContact O-N 3.43Å; R31-H34 PolarHBondContact O-N 2.93Å; R31-T35 PolarHBondContact O-N 2.88Å; R31-T35 PolarHBondContact O-OG1 3.42Å
32	I	93.8	Very high	91.5	Very high	64 Å²	64	102.1 Å²	102.1	33%	0.328	50%	0.496	S	S	.	.	H	α-helix	trans	-64.2	-48.6	177.5	-69.5	172	0	0	0	110.9	W28 V29 H34 T35 I36	W28-I32 HydrophobicContact CD2-CD1 3.63Å; W28-I32 HydrophobicContact CE3-CD1 3.42Å; W28-I32 VanDerWaalsContact CE3-CD1 3.42Å; W28-I32 HydrophobicContact CH2-CD1 3.27Å; W28-I32 HydrophobicContact CZ2-CD1 3.48Å; W28-I32 VanDerWaalsContact CZ2-CD1 3.48Å; W28-I32 HydrophobicContact CZ3-CD1 3.23Å; W28-I32 WeakPolarHBondContact O-CG1 3.33Å; W28-I32 PolarHBondContact O-N 3.01Å; W28-I32 VanDerWaalsContact O-N 3.08Å; V29-I32 PolarHBondContact O-N 2.98Å; I32-H34 VanDerWaalsContact C-N 3.27Å; I32-H34 PolarHBondContact O-N 2.78Å; I32-T35 PolarHBondContact O-N 2.99Å; I32-T35 VanDerWaalsContact O-N 3.17Å; I32-I36 HydrophobicContact CG2-CD1 3.7Å; I32-I36 HydrophobicContact CG2-CG1 4.35Å; I32-I36 WeakPolarHBondContact O-CG1 3.35Å; I32-I36 PolarHBondContact O-N 3.38Å
33	S	91.8	Very high	90.8	Very high	66 Å²	66	101.3 Å²	101.3	46%	0.462	49%	0.49	S	S	.	.	H	α-helix	trans	-58.7	-41	178.4	-63.3	0	0	0	0	111.7	V29 M30 I36 L37	V29-S33 PolarHBondContact O-N 2.94Å; V29-S33 PolarHBondContact O-OG 3.36Å; M30-S33 PolarHBondContact O-N 3.47Å; S33-I36 PolarHBondContact O-N 3.22Å; S33-L37 WeakPolarHBondContact O-CB 3.38Å; S33-L37 PolarHBondContact O-N 3.17Å
34	H	92.3	Very high	89.9	Confident	114 Å²	114	99.9 Å²	99.9	53%	0.528	48%	0.483	S	S	.	.	H	α-helix	trans	-64.9	-44.2	176.3	-171.6	-170.3	0	0	0	112	M30 R31 I32 I36 L37 I38	M30-H34 WeakPolarHBondContact O-CB 3.34Å; M30-H34 PolarHBondContact O-N 2.96Å; R31-H34 PolarHBondContact O-N 2.93Å; I32-H34 VanDerWaalsContact C-N 3.27Å; I32-H34 PolarHBondContact O-N 2.78Å; H34-I36 PolarHBondContact O-N 2.84Å; H34-L37 PolarHBondContact O-N 3.49Å; H34-I38 WeakPolarHBondContact NE2-CD1 3.29Å; H34-I38 WeakPolarHBondContact O-CG1 3.41Å; H34-I38 PolarHBondContact O-N 3.28Å
35	T	91.9	Very high	88.9	Confident	73 Å²	73	98 Å²	98	45%	0.448	48%	0.483	S	S	.	.	H	α-helix	trans	-60.8	-44	175.9	-59.9	0	0	0	0	111.9	R31 I32 L37 I38 H39	R31-T35 PolarHBondContact O-N 2.88Å; R31-T35 PolarHBondContact O-OG1 3.42Å; I32-T35 PolarHBondContact O-N 2.99Å; I32-T35 VanDerWaalsContact O-N 3.17Å; T35-L37 VanDerWaalsContact C-N 3.33Å; T35-L37 PolarHBondContact O-N 3.15Å; T35-I38 PolarHBondContact O-N 3.44Å; T35-H39 WeakPolarHBondContact O-CB 3.38Å; T35-H39 PolarHBondContact O-CD2 3.29Å; T35-H39 PolarHBondContact O-N 2.89Å
36	I	89.8	Confident	87.8	Confident	106 Å²	106	99.8 Å²	99.8	54%	0.544	49%	0.489	S	S	.	.	H	α-helix	trans	-61.2	-44.4	176.4	-67.6	168.4	0	0	0	110.3	I32 S33 H34 H39 Y40	I32-I36 HydrophobicContact CG2-CD1 3.7Å; I32-I36 HydrophobicContact CG2-CG1 4.35Å; I32-I36 WeakPolarHBondContact O-CG1 3.35Å; I32-I36 PolarHBondContact O-N 3.38Å; S33-I36 PolarHBondContact O-N 3.22Å; H34-I36 PolarHBondContact O-N 2.84Å; I36-H39 PolarHBondContact O-N 2.88Å; I36-Y40 WeakPolarHBondContact O-CB 3.33Å; I36-Y40 PolarHBondContact O-N 3.38Å
37	L	91.2	Very high	86.3	Confident	98 Å²	98	97 Å²	97	51%	0.513	47%	0.473	S	S	.	.	H	α-helix	trans	-61.9	-46	178.2	-176.4	65.9	0	0	0	111.6	S33 H34 T35 H39 Y40 Q41	S33-L37 WeakPolarHBondContact O-CB 3.38Å; S33-L37 PolarHBondContact O-N 3.17Å; H34-L37 PolarHBondContact O-N 3.49Å; T35-L37 VanDerWaalsContact C-N 3.33Å; T35-L37 PolarHBondContact O-N 3.15Å; L37-H39 PolarHBondContact O-N 3.03Å; L37-Y40 PolarHBondContact O-N 3.49Å; L37-Q41 VanDerWaalsContact O-CG 3.29Å; L37-Q41 WeakPolarHBondContact O-CG 3.5Å; L37-Q41 PolarHBondContact O-N 3.47Å
38	I	89	Confident	84.7	Confident	75 Å²	75	97 Å²	97	39%	0.385	48%	0.477	S	S	.	.	H	α-helix	trans	-60.2	-46.9	175.9	-70.3	166.8	0	0	0	110.4	H34 T35 Y40 Q41 I42	H34-I38 WeakPolarHBondContact NE2-CD1 3.29Å; H34-I38 WeakPolarHBondContact O-CG1 3.41Å; H34-I38 PolarHBondContact O-N 3.28Å; T35-I38 PolarHBondContact O-N 3.44Å; I38-Y40 VanDerWaalsContact C-N 3.28Å; I38-Y40 PolarHBondContact O-N 3.47Å; I38-Q41 PolarHBondContact O-N 3.33Å; I38-I42 HydrophobicContact CG2-CD1 3.64Å; I38-I42 HydrophobicContact CG2-CG1 4.26Å; I38-I42 VanDerWaalsContact O-CG1 3.31Å; I38-I42 WeakPolarHBondContact O-CG1 3.43Å; I38-I42 PolarHBondContact O-N 2.77Å
39	H	86.6	Confident	82.9	Confident	111 Å²	111	90.1 Å²	90.1	51%	0.514	46%	0.455	S	S	.	.	H	α-helix	trans	-59.1	-41.1	177.6	-84.1	-150.5	0	0	0	111.7	T35 I36 L37 I42 Q43	T35-H39 WeakPolarHBondContact O-CB 3.38Å; T35-H39 PolarHBondContact O-CD2 3.29Å; T35-H39 PolarHBondContact O-N 2.89Å; I36-H39 PolarHBondContact O-N 2.88Å; L37-H39 PolarHBondContact O-N 3.03Å; H39-I42 PolarHBondContact O-N 3.4Å; H39-Q43 WeakPolarHBondContact O-CB 3.45Å; H39-Q43 VanDerWaalsContact O-CG 3.28Å; H39-Q43 WeakPolarHBondContact O-CG 3.38Å; H39-Q43 PolarHBondContact O-N 3.3Å
40	Y	81.8	Confident	81.3	Confident	117 Å²	117	92.9 Å²	92.9	46%	0.459	47%	0.474	S	S	.	.	H	α-helix	trans	-65.5	-43	176.5	-172.1	-104.7	0	0	0	112.1	I36 L37 I38 Q43 L44	I36-Y40 WeakPolarHBondContact O-CB 3.33Å; I36-Y40 PolarHBondContact O-N 3.38Å; L37-Y40 PolarHBondContact O-N 3.49Å; I38-Y40 VanDerWaalsContact C-N 3.28Å; I38-Y40 PolarHBondContact O-N 3.47Å; Y40-Q43 PolarHBondContact O-N 3.02Å; Y40-L44 HydrophobicContact CD1-CD1 3.74Å; Y40-L44 HydrophobicContact CD1-CG 4.27Å; Y40-L44 HydrophobicContact CE1-CD1 3.41Å; Y40-L44 VanDerWaalsContact CE1-CD1 3.41Å; Y40-L44 HydrophobicContact CE1-CD2 4.48Å; Y40-L44 HydrophobicContact CE1-CG 3.99Å; Y40-L44 WeakPolarHBondContact O-CG 3.49Å; Y40-L44 PolarHBondContact O-N 3.42Å
41	Q	82.6	Confident	79.8	Confident	95 Å²	95	94.1 Å²	94.1	44%	0.444	48%	0.483	S	S	.	.	H	α-helix	trans	-62.9	-43.5	175.7	-69.9	-68.3	-24.2	0	0	112	L37 I38 Q43 L44 I45	L37-Q41 VanDerWaalsContact O-CG 3.29Å; L37-Q41 WeakPolarHBondContact O-CG 3.5Å; L37-Q41 PolarHBondContact O-N 3.47Å; I38-Q41 PolarHBondContact O-N 3.33Å; Q41-Q43 VanDerWaalsContact C-N 3.34Å; Q41-Q43 PolarHBondContact O-N 2.92Å; Q41-L44 PolarHBondContact O-N 3.49Å; Q41-I45 VanDerWaalsContact O-CG1 3.29Å; Q41-I45 WeakPolarHBondContact O-CG1 3.35Å; Q41-I45 PolarHBondContact O-N 2.84Å
42	I	82.1	Confident	78.1	Confident	83 Å²	83	88.2 Å²	88.2	43%	0.426	48%	0.479	S	S	.	.	H	α-helix	trans	-62.2	-43.9	175.2	-68	168.8	0	0	0	110.4	I38 H39 L44 I45 N46	I38-I42 HydrophobicContact CG2-CD1 3.64Å; I38-I42 HydrophobicContact CG2-CG1 4.26Å; I38-I42 VanDerWaalsContact O-CG1 3.31Å; I38-I42 WeakPolarHBondContact O-CG1 3.43Å; I38-I42 PolarHBondContact O-N 2.77Å; H39-I42 PolarHBondContact O-N 3.4Å; I42-L44 VanDerWaalsContact C-N 3.34Å; I42-L44 PolarHBondContact O-N 3.48Å; I42-I45 PolarHBondContact O-N 3.21Å; I42-N46 WeakPolarHBondContact CG2-ND2 3.39Å; I42-N46 WeakPolarHBondContact O-CB 3.34Å; I42-N46 VanDerWaalsContact O-CG 3.26Å; I42-N46 PolarHBondContact O-N 2.85Å; I42-N46 PolarHBondContact O-ND2 3.39Å
43	Q	80.2	Confident	76.6	Confident	91 Å²	91	90.7 Å²	90.7	43%	0.425	49%	0.493	S	S	.	.	H	α-helix	trans	-60.8	-43.9	175.8	-76.3	178.3	39.3	0	0	111.3	H39 Y40 Q41 N46 S47	H39-Q43 WeakPolarHBondContact O-CB 3.45Å; H39-Q43 VanDerWaalsContact O-CG 3.28Å; H39-Q43 WeakPolarHBondContact O-CG 3.38Å; H39-Q43 PolarHBondContact O-N 3.3Å; Y40-Q43 PolarHBondContact O-N 3.02Å; Q41-Q43 VanDerWaalsContact C-N 3.34Å; Q41-Q43 PolarHBondContact O-N 2.92Å; Q43-N46 PolarHBondContact O-N 3.46Å; Q43-S47 VanDerWaalsContact O-CB 3.24Å; Q43-S47 WeakPolarHBondContact O-CB 3.48Å; Q43-S47 PolarHBondContact O-N 2.97Å; Q43-S47 PolarHBondContact O-OG 3.05Å
44	L	76	Confident	75.1	Confident	72 Å²	72	92.9 Å²	92.9	38%	0.377	50%	0.504	S	S	.	.	H	α-helix	trans	-61.2	-44.8	175.8	-76.1	174.8	0	0	0	112.4	Y40 Q41 I42 S47 V48	Y40-L44 HydrophobicContact CD1-CD1 3.74Å; Y40-L44 HydrophobicContact CD1-CG 4.27Å; Y40-L44 HydrophobicContact CE1-CD1 3.41Å; Y40-L44 VanDerWaalsContact CE1-CD1 3.41Å; Y40-L44 HydrophobicContact CE1-CD2 4.48Å; Y40-L44 HydrophobicContact CE1-CG 3.99Å; Y40-L44 WeakPolarHBondContact O-CG 3.49Å; Y40-L44 PolarHBondContact O-N 3.42Å; Q41-L44 PolarHBondContact O-N 3.49Å; I42-L44 VanDerWaalsContact C-N 3.34Å; I42-L44 PolarHBondContact O-N 3.48Å; L44-S47 VanDerWaalsContact O-CB 3.31Å; L44-S47 WeakPolarHBondContact O-CB 3.3Å; L44-S47 PolarHBondContact O-N 3.23Å; L44-S47 VanDerWaalsContact O-N 3.16Å; L44-V48 PolarHBondContact O-N 2.97Å
45	I	74.3	Confident	73.6	Confident	116 Å²	116	92.2 Å²	92.2	60%	0.595	50%	0.503	S	S	*	.	H	α-helix	trans	-63	-46	177.6	-67.3	164.2	0	0	0	110.4	Q41 I42 S47 V48	Q41-I45 VanDerWaalsContact O-CG1 3.29Å; Q41-I45 WeakPolarHBondContact O-CG1 3.35Å; Q41-I45 PolarHBondContact O-N 2.84Å; I42-I45 PolarHBondContact O-N 3.21Å; I45-S47 PolarHBondContact O-N 3.02Å; I45-V48 PolarHBondContact O-N 3.4Å; I45-V48 VanDerWaalsContact O-N 3.07Å
46	N	72.1	Confident	71.9	Confident	121 Å²	121	92.5 Å²	92.5	65%	0.647	50%	0.502	S	S	*	.	H	α-helix	trans	-68	-18.7	177.2	-70.4	-22.6	0	0	0	113.2	I42 Q43 V48	I42-N46 WeakPolarHBondContact CG2-ND2 3.39Å; I42-N46 WeakPolarHBondContact O-CB 3.34Å; I42-N46 VanDerWaalsContact O-CG 3.26Å; I42-N46 PolarHBondContact O-N 2.85Å; I42-N46 PolarHBondContact O-ND2 3.39Å; Q43-N46 PolarHBondContact O-N 3.46Å; N46-V48 VanDerWaalsContact C-N 3.27Å
47	S	63.2	Low	70.3	Confident	12 Å²	12	90.8 Å²	90.8	8%	0.084	50%	0.498	C	S	.	.	T	Hydrogen-bonded Turn	trans	-80.4	-8.2	174.6	-62.4	0	0	0	0	112.3	Q43 L44 I45 V54 I55 P57	Q43-S47 VanDerWaalsContact O-CB 3.24Å; Q43-S47 WeakPolarHBondContact O-CB 3.48Å; Q43-S47 PolarHBondContact O-N 2.97Å; Q43-S47 PolarHBondContact O-OG 3.05Å; L44-S47 VanDerWaalsContact O-CB 3.31Å; L44-S47 WeakPolarHBondContact O-CB 3.3Å; L44-S47 PolarHBondContact O-N 3.23Å; L44-S47 VanDerWaalsContact O-N 3.16Å; I45-S47 PolarHBondContact O-N 3.02Å; S47-V54 CarbonylContact O-C 3.55Å; S47-I55 WeakPolarHBondContact CB-O 3.3Å; S47-I55 CarbonylContact O-C 3.53Å; S47-I55 WeakPolarHBondContact O-CA 3.44Å; S47-I55 WeakPolarHBondContact O-CB 3.44Å; S47-I55 PolarHBondContact O-N 2.96Å; S47-I55 PolarHBondContact OG-O 3.38Å; S47-P57 VanDerWaalsContact OG-CD 3.23Å; S47-P57 WeakPolarHBondContact OG-CD 3.02Å; S47-P57 WeakPolarHBondContact OG-CG 3.12Å
48	V	61	Low	68.8	Low	81 Å²	81	93.2 Å²	93.2	49%	0.491	50%	0.504	S	S	.	.	B	Isolated β-bridge	trans	-96.7	108.5	173.9	-177.7	0	0	0	0	108.3	L44 I45 N46	L44-V48 PolarHBondContact O-N 2.97Å; I45-V48 PolarHBondContact O-N 3.4Å; I45-V48 VanDerWaalsContact O-N 3.07Å; N46-V48 VanDerWaalsContact C-N 3.27Å
49	S	58.6	Low	67.3	Low	27 Å²	27	93.2 Å²	93.2	19%	0.189	52%	0.515	C	S	.	.			trans	-63.4	144.3	171	-179.8	0	0	0	0	109.6	N51 G52 N53	S49-N51 PolarHBondContact O-N 3.23Å; S49-G52 PolarHBondContact O-N 2.89Å; S49-N53 WeakPolarHBondContact CB-O 3.39Å; S49-N53 PolarHBondContact N-O 3.41Å
50	P	60.4	Low	65.3	Low	131 Å²	131	97.2 Å²	97.2	85%	0.851	53%	0.531	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56	-16	174.7	21	-32.6	0	0	0	113.9	G52	P50-G52 VanDerWaalsContact C-N 3.28Å; P50-G52 PolarHBondContact O-N 2.77Å
51	N	62.7	Low	63.3	Low	140 Å²	140	101.4 Å²	101.4	75%	0.749	55%	0.552	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.1	8.7	174.6	-63.6	-8.4	0	0	0	113.8	S49 N53	S49-N51 PolarHBondContact O-N 3.23Å; N51-N53 VanDerWaalsContact C-N 3.26Å; N51-N53 PolarHBondContact O-N 3.4Å
52	G	59	Low	61.3	Low	59 Å²	59	108.7 Å²	108.7	61%	0.608	59%	0.593	S	S	*	*	S	Bend	trans	78.5	0.9	-179.1	0	0	0	0	0	115	S49 P50	S49-G52 PolarHBondContact O-N 2.89Å; P50-G52 VanDerWaalsContact C-N 3.28Å; P50-G52 PolarHBondContact O-N 2.77Å
53	N	62.8	Low	60.3	Low	116 Å²	116	110 Å²	110	62%	0.62	60%	0.601	S	S	*	*			trans	-78.3	123.5	174	-86.2	5.2	0	0	0	110.7	S49 N51 I55	S49-N53 WeakPolarHBondContact CB-O 3.39Å; S49-N53 PolarHBondContact N-O 3.41Å; N51-N53 VanDerWaalsContact C-N 3.26Å; N51-N53 PolarHBondContact O-N 3.4Å; N53-I55 PolarHBondContact O-N 2.85Å; N53-I55 VanDerWaalsContact O-N 3.11Å
54	V	58.8	Low	59.2	Low	113 Å²	113	111 Å²	111	69%	0.685	61%	0.61	S	S	*	*	B	Isolated β-bridge	trans	-72.2	100.2	167.3	-176.9	0	0	0	0	108.1	S47 N56	S47-V54 CarbonylContact O-C 3.55Å; V54-N56 PolarHBondContact O-N 3.5Å
55	I	60.8	Low	58.3	Low	99 Å²	99	113.2 Å²	113.2	51%	0.508	62%	0.623	S	S	.	*			trans	-72.9	82.3	164.1	-54.4	172.4	0	0	0	106.2	S47 N53 P57	S47-I55 WeakPolarHBondContact CB-O 3.3Å; S47-I55 CarbonylContact O-C 3.53Å; S47-I55 WeakPolarHBondContact O-CA 3.44Å; S47-I55 WeakPolarHBondContact O-CB 3.44Å; S47-I55 PolarHBondContact O-N 2.96Å; S47-I55 PolarHBondContact OG-O 3.38Å; N53-I55 PolarHBondContact O-N 2.85Å; N53-I55 VanDerWaalsContact O-N 3.11Å; I55-P57 WeakPolarHBondContact O-CD 3.2Å; I55-P57 VanDerWaalsContact O-N 3.07Å
56	N	57.8	Low	57.3	Low	79 Å²	79	113 Å²	113	42%	0.422	63%	0.625	S	S	.	*			trans	-62.3	113.3	171.7	178.1	6.2	0	0	0	108.6	V54 F58 A59	V54-N56 PolarHBondContact O-N 3.5Å; N56-F58 PolarHBondContact O-N 3.04Å; N56-F58 VanDerWaalsContact O-N 3.11Å; N56-F58 WeakPolarHBondContact OD1-CB 3.41Å; N56-F58 PolarHBondContact OD1-N 2.95Å; N56-A59 HydrophobicContact CB-CB 3.71Å; N56-A59 PolarHBondContact O-N 3.35Å
57	P	56.2	Low	56.4	Low	71 Å²	71	112.5 Å²	112.5	46%	0.461	62%	0.623	S	S	.	*	T	Hydrogen-bonded Turn	trans	-67.8	-14	-178.3	28.2	-31.2	0	0	0	111.4	S47 I55	S47-P57 VanDerWaalsContact OG-CD 3.23Å; S47-P57 WeakPolarHBondContact OG-CD 3.02Å; S47-P57 WeakPolarHBondContact OG-CG 3.12Å; I55-P57 WeakPolarHBondContact O-CD 3.2Å; I55-P57 VanDerWaalsContact O-N 3.07Å
58	F	59.3	Low	56	Low	149 Å²	149	119.2 Å²	119.2	65%	0.654	66%	0.659	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.7	-3.8	175.8	-54.4	-77.3	0	0	0	114.1	N56 K60	N56-F58 PolarHBondContact O-N 3.04Å; N56-F58 VanDerWaalsContact O-N 3.11Å; N56-F58 WeakPolarHBondContact OD1-CB 3.41Å; N56-F58 PolarHBondContact OD1-N 2.95Å; F58-K60 VanDerWaalsContact C-N 3.32Å; F58-K60 PolarHBondContact O-N 3.21Å
59	A	57.1	Low	55.6	Low	74 Å²	74	121.9 Å²	121.9	61%	0.612	67%	0.671	S	S	*	*			trans	-84	-0.2	-179.2	0	0	0	0	0	114.3	N56	N56-A59 HydrophobicContact CB-CB 3.71Å; N56-A59 PolarHBondContact O-N 3.35Å
60	K	43.6	Very low	55.4	Low	195 Å²	195	129.2 Å²	129.2	85%	0.848	71%	0.709	S	S	*	*	S	Bend	trans	-100.7	108.5	-179.2	-132	174.1	-176	178.7	0	110.2	F58	F58-K60 VanDerWaalsContact C-N 3.32Å; F58-K60 PolarHBondContact O-N 3.21Å
61	K	40.7	Very low	54.9	Low	206 Å²	206	129.1 Å²	129.1	90%	0.896	70%	0.697	S	S	*	*			trans	92.5	72.9	176.1	-66.6	-177.2	169.8	-177.8	0	117.2
62	L	40.5	Very low	54.2	Low	248 Å²	248	128.1 Å²	128.1	100%	1.298	69%	0.692	S	S	*	*				-123.5	0	126.1	-105.4	147.7	0	0	0	106.7

Retrieved 62 of 62 residues in 238.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).