G4V7K1_SCHMA Loading...

Mediator of RNA polymerase II transcription subunit 9

AlphaFold DB , UniProt , Accession G4V7K1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 116 aa.

						>G4V7K1_SCHMA|G4V7K1
MHRSFPVEENNDFKGIIPIIDHDEEKPITVPQTLLNDSNISDGEKCDKTDNINCIVDALRCALVSFERHIQAENNCTNDIKNLCNEAKSLQAKLRDKKGLIINHFQNVVSNLSEEK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57	Low	51.3	Low	241 Å²	241	162.1 Å²	162.1	100%	1.187	82%	0.817	S	S	*	*				0	99	0	-69.5	-177.6	179.6	0	0	108
2	H	52.7	Low	51	Low	197 Å²	197	160.3 Å²	160.3	91%	0.912	81%	0.811	S	S	*	*			trans	-80.5	119.6	176	-84	-83.3	0	0	0	109
3	R	44.9	Very low	50.5	Low	218 Å²	218	163.5 Å²	163.5	82%	0.823	82%	0.817	S	S	*	*			trans	-85.5	112	170	-80.7	-175.7	179.2	-166.8	-0.8	108.4
4	S	51.8	Low	49.8	Very low	117 Å²	117	166.5 Å²	166.5	82%	0.818	82%	0.823	S	S	*	*	P	Polyproline II helix	trans	-93.8	127.6	162.4	-56.7	0	0	0	0	107.6
5	F	56.2	Low	49	Very low	168 Å²	168	158.6 Å²	158.6	74%	0.737	80%	0.801	S	S	*	*	P	Polyproline II helix	trans	-89.7	137.1	173.2	-69.7	-86.2	0	0	0	109.2
6	P	53.2	Low	48.3	Very low	112 Å²	112	158.8 Å²	158.8	73%	0.727	80%	0.802	S	S	*	*	P	Polyproline II helix	trans	-73.5	129.7	171.7	29.1	-26.3	0	0	0	108.8	E8	P6-E8 PolarHBondContact O-N 3.21Å
7	V	53.8	Low	48	Very low	134 Å²	134	157.4 Å²	157.4	81%	0.812	80%	0.796	S	S	*	*			trans	-72.5	104.2	166.7	171.6	0	0	0	0	106.3	E9	V7-E9 PolarHBondContact O-N 3.28Å
8	E	55.5	Low	47.5	Very low	156 Å²	156	154 Å²	154	73%	0.729	79%	0.787	S	S	*	*			trans	-71.9	111	165.6	-72.8	-173	162.8	0	0	108.2	P6 N10	P6-E8 PolarHBondContact O-N 3.21Å; E8-N10 PolarHBondContact O-N 3.17Å
9	E	45.7	Very low	47.1	Very low	165 Å²	165	152.9 Å²	152.9	77%	0.771	78%	0.781	S	S	*	*			trans	-65.2	94.9	165.8	-77.1	179.7	156.5	0	0	108.8	V7 N11	V7-E9 PolarHBondContact O-N 3.28Å; E9-N11 PolarHBondContact O-N 2.74Å
10	N	48	Very low	46.7	Very low	136 Å²	136	151.3 Å²	151.3	73%	0.727	77%	0.773	S	S	*	*			trans	-70.3	94.8	168.6	-80.3	-41.7	0	0	0	109.7	E8 D12	E8-N10 PolarHBondContact O-N 3.17Å; N10-D12 PolarHBondContact O-N 3.41Å
11	N	45.4	Very low	46.4	Very low	139 Å²	139	150.4 Å²	150.4	74%	0.743	77%	0.77	S	S	*	*			trans	-73.3	45.6	174.5	-89.3	-39.6	0	0	0	113.7	E9	E9-N11 PolarHBondContact O-N 2.74Å
12	D	47.9	Very low	45.9	Very low	140 Å²	140	147 Å²	147	75%	0.749	75%	0.751	S	S	*	*			trans	-113	16.9	-170.8	-94	-12	0	0	0	116.1	N10	N10-D12 PolarHBondContact O-N 3.41Å
13	F	44	Very low	45.6	Very low	203 Å²	203	141.7 Å²	141.7	89%	0.89	73%	0.729	S	S	*	*			trans	-119	62.7	165.8	-85.9	-88.9	0	0	0	111.8	G15	F13-G15 PolarHBondContact O-N 3.37Å
14	K	41.3	Very low	45.7	Very low	205 Å²	205	140.8 Å²	140.8	89%	0.891	73%	0.734	S	S	*	*			trans	-74.7	56.4	150	-88.1	-177.3	175.4	178.1	0	109.6	I16	K14-I16 PolarHBondContact O-N 3.48Å
15	G	38.2	Very low	45.7	Very low	48 Å²	48	141.1 Å²	141.1	50%	0.495	72%	0.723	S	S	.	*			trans	-81.7	106.5	162.6	0	0	0	0	0	106.8	F13 I17	F13-G15 PolarHBondContact O-N 3.37Å; G15-I17 PolarHBondContact O-N 3.3Å
16	I	36.8	Very low	45.7	Very low	161 Å²	161	141.9 Å²	141.9	83%	0.826	73%	0.726	S	S	*	*			trans	-61.8	91.9	166.2	-59.8	171.2	0	0	0	105.4	K14 P18	K14-I16 PolarHBondContact O-N 3.48Å; I16-P18 VanDerWaalsContact O-CD 3.27Å; I16-P18 WeakPolarHBondContact O-CD 3.4Å
17	I	44	Very low	45.5	Very low	136 Å²	136	142.1 Å²	142.1	70%	0.697	73%	0.728	S	S	*	*			trans	-69.6	115.8	162.6	-58.8	179.6	0	0	0	103.8	G15 I19	G15-I17 PolarHBondContact O-N 3.3Å; I17-I19 HydrophobicContact CG2-CG1 4.42Å; I17-I19 PolarHBondContact O-N 2.97Å
18	P	38.9	Very low	45.4	Very low	96 Å²	96	140.9 Å²	140.9	62%	0.623	72%	0.715	S	S	*	*			trans	-67.7	95.7	165.6	29	-27	0	0	0	105.1	I16 I20	I16-P18 VanDerWaalsContact O-CD 3.27Å; I16-P18 WeakPolarHBondContact O-CD 3.4Å; P18-I20 HydrophobicContact CB-CG1 4.25Å; P18-I20 PolarHBondContact O-N 3.02Å
19	I	39.4	Very low	45	Very low	133 Å²	133	139.5 Å²	139.5	68%	0.682	72%	0.718	S	S	*	*			trans	-65.9	91.5	155.3	-56.2	176	0	0	0	102.8	I17 D21	I17-I19 HydrophobicContact CG2-CG1 4.42Å; I17-I19 PolarHBondContact O-N 2.97Å; I19-D21 HydrophobicContact CG2-CB 4.32Å; I19-D21 PolarHBondContact O-N 2.65Å
20	I	38.7	Very low	45.2	Very low	120 Å²	120	136.2 Å²	136.2	62%	0.615	71%	0.709	S	S	*	*			trans	-69.1	85	161	-54.4	179.4	0	0	0	103.5	P18 H22	P18-I20 HydrophobicContact CB-CG1 4.25Å; P18-I20 PolarHBondContact O-N 3.02Å; I20-H22 HydrophobicContact CG2-CB 4.34Å; I20-H22 WeakPolarHBondContact CG2-CD2 3.32Å; I20-H22 WeakPolarHBondContact CG2-NE2 3.49Å; I20-H22 PolarHBondContact O-N 3.37Å
21	D	40.9	Very low	45.4	Very low	134 Å²	134	132.3 Å²	132.3	72%	0.717	69%	0.691	S	S	*	*			trans	-65.7	80.1	164.5	-115.4	-11.1	0	0	0	105.9	I19 D23	I19-D21 HydrophobicContact CG2-CB 4.32Å; I19-D21 PolarHBondContact O-N 2.65Å; D21-D23 PolarHBondContact O-N 2.94Å
22	H	45.6	Very low	45.6	Very low	168 Å²	168	135 Å²	135	78%	0.778	70%	0.699	S	S	*	*			trans	-88.9	60.7	161.4	-85.9	-41.2	0	0	0	108.1	I20	I20-H22 HydrophobicContact CG2-CB 4.34Å; I20-H22 WeakPolarHBondContact CG2-CD2 3.32Å; I20-H22 WeakPolarHBondContact CG2-NE2 3.49Å; I20-H22 PolarHBondContact O-N 3.37Å
23	D	47.8	Very low	45.6	Very low	87 Å²	87	132.6 Å²	132.6	47%	0.465	69%	0.69	S	S	.	*			trans	-146.5	88.2	152.5	-119.1	-24.9	0	0	0	107.3	D21 E25	D21-D23 PolarHBondContact O-N 2.94Å; D23-E25 HydrophobicContact CB-CG 4.4Å; D23-E25 PolarHBondContact O-N 3.1Å
24	E	46.8	Very low	45.7	Very low	199 Å²	199	131.5 Å²	131.5	93%	0.93	69%	0.692	S	S	*	*			trans	-67	68	151.5	-72.7	-166.6	171.8	0	0	107.4	K26	E24-K26 PolarHBondContact O-N 3.5Å
25	E	52.3	Low	45.9	Very low	124 Å²	124	128.7 Å²	128.7	58%	0.579	69%	0.686	S	S	*	*			trans	-67	89.1	163.1	-91.2	-163.2	165.3	0	0	106.4	D23 S65	D23-E25 HydrophobicContact CB-CG 4.4Å; D23-E25 PolarHBondContact O-N 3.1Å; E25-S65 PolarHBondContact OE1-OG 2.92Å
26	K	56.3	Low	46.4	Very low	183 Å²	183	133.1 Å²	133.1	80%	0.796	70%	0.698	S	S	*	*			trans	-45.9	127.2	168.3	-132.5	177.8	-172.8	177.8	0	107.7	E24 I28	E24-K26 PolarHBondContact O-N 3.5Å; K26-I28 PolarHBondContact O-N 3.45Å; K26-I28 VanDerWaalsContact O-N 3.08Å
27	P	47.5	Very low	47.2	Very low	118 Å²	118	131.1 Å²	131.1	77%	0.766	69%	0.689	S	S	*	*			trans	-57.1	122.2	177.8	20.3	-29.7	0	0	0	109.2	T29	P27-T29 PolarHBondContact O-N 3.07Å; P27-T29 VanDerWaalsContact O-N 3.07Å
28	I	53.1	Low	47.9	Very low	107 Å²	107	129.8 Å²	129.8	55%	0.549	69%	0.692	S	S	.	*			trans	-70.4	103.3	175.3	-64.9	163.6	0	0	0	107.3	K26 V30 A58	K26-I28 PolarHBondContact O-N 3.45Å; K26-I28 VanDerWaalsContact O-N 3.08Å; I28-V30 HydrophobicContact CG2-CG2 4.4Å; I28-V30 PolarHBondContact O-N 3.38Å; I28-A58 HydrophobicContact CD1-CB 4.19Å; I28-A58 HydrophobicContact CG2-CB 3.91Å
29	T	46.9	Very low	48.7	Very low	127 Å²	127	133 Å²	133	78%	0.779	70%	0.704	S	S	*	*			trans	-71.6	109.4	170.7	-53.3	0	0	0	0	108.8	P27 P31	P27-T29 PolarHBondContact O-N 3.07Å; P27-T29 VanDerWaalsContact O-N 3.07Å; T29-P31 WeakPolarHBondContact O-CD 3.47Å
30	V	48.5	Very low	49.5	Very low	96 Å²	96	128 Å²	128	58%	0.582	68%	0.678	S	S	*	*			trans	-85.4	117.3	172	-173.3	0	0	0	0	108.8	I28 Q32	I28-V30 HydrophobicContact CG2-CG2 4.4Å; I28-V30 PolarHBondContact O-N 3.38Å; V30-Q32 PolarHBondContact O-N 3Å
31	P	52.3	Low	50.4	Low	55 Å²	55	126.2 Å²	126.2	36%	0.357	68%	0.676	S	S	.	*			trans	-68.3	122.2	175.3	19.6	-24.7	0	0	0	111.3	T29 T33 N51 I55	T29-P31 WeakPolarHBondContact O-CD 3.47Å; P31-T33 PolarHBondContact O-N 3.48Å; P31-T33 VanDerWaalsContact O-N 3.14Å; P31-N51 VanDerWaalsContact CG-CG 3.47Å; P31-N51 VanDerWaalsContact CG-ND2 3.3Å; P31-N51 WeakPolarHBondContact CG-ND2 3.5Å; P31-N51 WeakPolarHBondContact CG-OD1 3.46Å; P31-I55 HydrophobicContact CG-CD1 4.47Å
32	Q	49.9	Very low	51.3	Low	194 Å²	194	125.5 Å²	125.5	91%	0.907	67%	0.673	S	S	*	*			trans	-78.7	83.4	176.4	-71.4	-175.8	-15.7	0	0	111.2	V30	V30-Q32 PolarHBondContact O-N 3Å
33	T	48.8	Very low	51.9	Low	91 Å²	91	119.7 Å²	119.7	56%	0.558	66%	0.658	S	S	*	*			trans	-144.9	74	167.9	45.4	0	0	0	0	112.5	P31	P31-T33 PolarHBondContact O-N 3.48Å; P31-T33 VanDerWaalsContact O-N 3.14Å
34	L	45.2	Very low	52.3	Low	180 Å²	180	120.7 Å²	120.7	94%	0.942	66%	0.66	S	S	*	*			trans	-102.8	77.7	159.1	-71.4	176.6	0	0	0	109
35	L	44.9	Very low	52.8	Low	146 Å²	146	116.2 Å²	116.2	76%	0.764	64%	0.637	S	S	*	*			trans	-141	112	172.1	-96.1	161.1	0	0	0	110.6
36	N	50.5	Low	53.2	Low	141 Å²	141	113.6 Å²	113.6	75%	0.754	63%	0.632	S	S	*	*			trans	42.9	103.8	162.1	-73.4	-3.4	0	0	0	120.1	S38	N36-S38 PolarHBondContact O-N 3.49Å
37	D	52.9	Low	53.7	Low	118 Å²	118	110.3 Å²	110.3	63%	0.631	62%	0.623	S	S	*	*			trans	-81.8	13.3	-179.8	-77	-28.3	0	0	0	116.7	N39 I40 K48	D37-N39 PolarHBondContact O-N 3.3Å; D37-I40 HydrophobicContact CB-CD1 4.4Å; D37-I40 VanDerWaalsContact OD1-CD1 3.22Å; D37-I40 WeakPolarHBondContact OD1-CD1 3.28Å; D37-K48 IonicContact OD1-NZ 2.83Å; D37-K48 PolarHBondContact OD1-NZ 3.29Å
38	S	58.6	Low	54.8	Low	109 Å²	109	107.3 Å²	107.3	76%	0.762	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.6	-5	-168.5	-59.7	0	0	0	0	116.6	N36	N36-S38 PolarHBondContact O-N 3.49Å
39	N	56.6	Low	56	Low	164 Å²	164	105.8 Å²	105.8	88%	0.877	59%	0.594	S	S	*	*	T	Hydrogen-bonded Turn	trans	-142.1	26.6	-175.6	-80.3	-32.1	0	0	0	115.1	D37	D37-N39 PolarHBondContact O-N 3.3Å
40	I	54.9	Low	57.6	Low	27 Å²	27	103.8 Å²	103.8	14%	0.138	58%	0.578	C	S	.	*			trans	-90.8	125.1	-165.9	-60.1	-173.4	0	0	0	111.3	D37 E44 K45 K48	D37-I40 HydrophobicContact CB-CD1 4.4Å; D37-I40 VanDerWaalsContact OD1-CD1 3.22Å; D37-I40 WeakPolarHBondContact OD1-CD1 3.28Å; I40-E44 HydrophobicContact CG2-CB 3.25Å; I40-E44 HydrophobicContact CG2-CG 4.38Å; I40-E44 WeakPolarHBondContact CG2-OE2 3.31Å; I40-K45 HydrophobicContact CB-CG 4.45Å; I40-K45 HydrophobicContact CG2-CG 3.9Å; I40-K45 WeakPolarHBondContact O-CE 3.34Å; I40-K48 HydrophobicContact CD1-CD 3.99Å
41	S	58.1	Low	59.3	Low	82 Å²	82	101.3 Å²	101.3	57%	0.573	56%	0.562	S	S	*	*			trans	-58.8	146.7	173.9	173.6	0	0	0	0	110.6	G43 E44 K45	S41-G43 PolarHBondContact O-N 2.9Å; S41-E44 PolarHBondContact O-N 3.47Å; S41-K45 PolarHBondContact O-N 3.47Å; S41-K45 VanDerWaalsContact O-N 3.09Å
42	D	60.2	Low	60.9	Low	120 Å²	120	103.3 Å²	103.3	64%	0.642	57%	0.568	S	S	*	*	H	α-helix	trans	-57.4	-24.9	-179.2	-71.8	-27.8	0	0	0	113.1	K45 C46	D42-K45 PolarHBondContact O-N 3.01Å; D42-K45 IonicContact OD1-NZ 2.67Å; D42-K45 PolarHBondContact OD1-NZ 3.29Å; D42-C46 PolarHBondContact O-N 3.45Å
43	G	57.1	Low	62.7	Low	45 Å²	45	98 Å²	98	46%	0.464	55%	0.546	S	S	.	.	H	α-helix	trans	-66.7	-42.7	171	0	0	0	0	0	113.7	S41 K45 C46 D47	S41-G43 PolarHBondContact O-N 2.9Å; G43-K45 VanDerWaalsContact C-N 3.33Å; G43-K45 PolarHBondContact O-N 2.89Å; G43-C46 WeakPolarHBondContact O-CB 3.33Å; G43-C46 PolarHBondContact O-N 3.45Å; G43-D47 PolarHBondContact O-N 2.92Å
44	E	57.3	Low	64.6	Low	109 Å²	109	97.7 Å²	97.7	51%	0.509	55%	0.547	S	S	.	.	H	α-helix	trans	-72.8	-26.1	176.4	-78.9	-179.3	154.1	0	0	112	I40 S41 C46 K48	I40-E44 HydrophobicContact CG2-CB 3.25Å; I40-E44 HydrophobicContact CG2-CG 4.38Å; I40-E44 WeakPolarHBondContact CG2-OE2 3.31Å; S41-E44 PolarHBondContact O-N 3.47Å; E44-C46 VanDerWaalsContact C-N 3.33Å; E44-K48 WeakPolarHBondContact O-CB 3.24Å; E44-K48 WeakPolarHBondContact O-CG 3.38Å; E44-K48 PolarHBondContact O-N 3.34Å
45	K	57.4	Low	66.6	Low	104 Å²	104	91.7 Å²	91.7	45%	0.452	52%	0.515	S	S	.	.	H	α-helix	trans	-65.9	-35.8	170	-67.8	-178.4	-167.3	152.5	0	111.9	I40 S41 D42 G43 T49	I40-K45 HydrophobicContact CB-CG 4.45Å; I40-K45 HydrophobicContact CG2-CG 3.9Å; I40-K45 WeakPolarHBondContact O-CE 3.34Å; S41-K45 PolarHBondContact O-N 3.47Å; S41-K45 VanDerWaalsContact O-N 3.09Å; D42-K45 PolarHBondContact O-N 3.01Å; D42-K45 IonicContact OD1-NZ 2.67Å; D42-K45 PolarHBondContact OD1-NZ 3.29Å; G43-K45 VanDerWaalsContact C-N 3.33Å; G43-K45 PolarHBondContact O-N 2.89Å; K45-T49 WeakPolarHBondContact O-CB 3.37Å; K45-T49 PolarHBondContact O-N 3.4Å; K45-T49 PolarHBondContact O-OG1 3.24Å
46	C	59.9	Low	68.9	Low	69 Å²	69	87.2 Å²	87.2	47%	0.466	49%	0.494	S	S	.	.	H	α-helix	trans	-63.1	-50.6	174.7	-164	0	0	0	0	110.3	D42 G43 E44 K48 T49 D50	D42-C46 PolarHBondContact O-N 3.45Å; G43-C46 WeakPolarHBondContact O-CB 3.33Å; G43-C46 PolarHBondContact O-N 3.45Å; E44-C46 VanDerWaalsContact C-N 3.33Å; C46-K48 VanDerWaalsContact C-N 3.31Å; C46-K48 PolarHBondContact O-N 2.92Å; C46-T49 PolarHBondContact O-N 3.31Å; C46-D50 PolarHBondContact O-N 2.99Å
47	D	67.7	Low	70.9	Confident	115 Å²	115	84.3 Å²	84.3	62%	0.615	48%	0.479	S	S	*	.	H	α-helix	trans	-59.3	-40	178	-75.4	-12.5	0	0	0	112.5	G43 N51	G43-D47 PolarHBondContact O-N 2.92Å; D47-N51 VanDerWaalsContact O-CB 3.22Å; D47-N51 WeakPolarHBondContact O-CB 3.48Å; D47-N51 PolarHBondContact O-N 3.09Å
48	K	70.5	Confident	72.7	Confident	55 Å²	55	79.8 Å²	79.8	24%	0.239	46%	0.458	C	S	.	.	H	α-helix	trans	-66.1	-40.4	174.7	-76.7	-173	175.4	-158.8	0	112.6	D37 I40 E44 C46 N51 I52	D37-K48 IonicContact OD1-NZ 2.83Å; D37-K48 PolarHBondContact OD1-NZ 3.29Å; I40-K48 HydrophobicContact CD1-CD 3.99Å; E44-K48 WeakPolarHBondContact O-CB 3.24Å; E44-K48 WeakPolarHBondContact O-CG 3.38Å; E44-K48 PolarHBondContact O-N 3.34Å; C46-K48 VanDerWaalsContact C-N 3.31Å; C46-K48 PolarHBondContact O-N 2.92Å; K48-N51 PolarHBondContact O-N 3.39Å; K48-I52 WeakPolarHBondContact O-CB 3.37Å; K48-I52 VanDerWaalsContact O-CG1 3.23Å; K48-I52 WeakPolarHBondContact O-CG1 3.28Å; K48-I52 PolarHBondContact O-N 2.94Å
49	T	78.6	Confident	74.4	Confident	74 Å²	74	79.6 Å²	79.6	45%	0.454	45%	0.447	S	S	.	.	H	α-helix	trans	-66	-44.2	179.1	-55.8	0	0	0	0	110.5	K45 C46 N51 I52 N53	K45-T49 WeakPolarHBondContact O-CB 3.37Å; K45-T49 PolarHBondContact O-N 3.4Å; K45-T49 PolarHBondContact O-OG1 3.24Å; C46-T49 PolarHBondContact O-N 3.31Å; T49-N51 VanDerWaalsContact C-N 3.33Å; T49-N51 PolarHBondContact O-N 3.35Å; T49-I52 PolarHBondContact O-N 2.99Å; T49-N53 VanDerWaalsContact O-CG 3.29Å; T49-N53 PolarHBondContact O-N 2.97Å; T49-N53 PolarHBondContact O-ND2 3.48Å
50	D	78.8	Confident	76.2	Confident	85 Å²	85	78.9 Å²	78.9	46%	0.455	43%	0.432	S	S	.	.	H	α-helix	trans	-62.8	-41.6	175.7	-69.8	-24.3	0	0	0	111.4	C46 N53 C54	C46-D50 PolarHBondContact O-N 2.99Å; D50-N53 PolarHBondContact O-N 3.31Å; D50-C54 PolarHBondContact O-N 2.93Å; D50-C54 PolarHBondContact O-SG 2.93Å
51	N	84.5	Confident	78	Confident	44 Å²	44	81.7 Å²	81.7	24%	0.235	45%	0.453	C	S	.	.	H	α-helix	trans	-63.2	-43.9	175.1	-174.4	26.7	0	0	0	112.9	P31 D47 K48 T49 N53 C54 I55	P31-N51 VanDerWaalsContact CG-CG 3.47Å; P31-N51 VanDerWaalsContact CG-ND2 3.3Å; P31-N51 WeakPolarHBondContact CG-ND2 3.5Å; P31-N51 WeakPolarHBondContact CG-OD1 3.46Å; D47-N51 VanDerWaalsContact O-CB 3.22Å; D47-N51 WeakPolarHBondContact O-CB 3.48Å; D47-N51 PolarHBondContact O-N 3.09Å; K48-N51 PolarHBondContact O-N 3.39Å; T49-N51 VanDerWaalsContact C-N 3.33Å; T49-N51 PolarHBondContact O-N 3.35Å; N51-N53 VanDerWaalsContact C-N 3.32Å; N51-N53 PolarHBondContact O-N 3.33Å; N51-C54 WeakPolarHBondContact O-CB 3.39Å; N51-C54 PolarHBondContact O-N 3Å; N51-I55 WeakPolarHBondContact O-CG1 3.45Å; N51-I55 PolarHBondContact O-N 2.97Å
52	I	87.5	Confident	79.7	Confident	97 Å²	97	79.1 Å²	79.1	50%	0.497	44%	0.437	S	S	.	.	H	α-helix	trans	-60.9	-43.7	175.2	-70.7	164.3	0	0	0	110.3	K48 T49 C54 I55 V56	K48-I52 WeakPolarHBondContact O-CB 3.37Å; K48-I52 VanDerWaalsContact O-CG1 3.23Å; K48-I52 WeakPolarHBondContact O-CG1 3.28Å; K48-I52 PolarHBondContact O-N 2.94Å; T49-I52 PolarHBondContact O-N 2.99Å; I52-C54 PolarHBondContact O-N 3Å; I52-I55 PolarHBondContact O-N 3.3Å; I52-V56 HydrophobicContact CG2-CG2 4.27Å; I52-V56 WeakPolarHBondContact O-CB 3.35Å; I52-V56 VanDerWaalsContact O-CG2 3.3Å; I52-V56 WeakPolarHBondContact O-CG2 3.4Å; I52-V56 PolarHBondContact O-N 3.28Å
53	N	87.7	Confident	81.4	Confident	82 Å²	82	78.4 Å²	78.4	44%	0.439	43%	0.433	S	S	.	.	H	α-helix	trans	-61.1	-43.7	176.8	-70.5	-30	0	0	0	111.6	T49 D50 N51 I55 V56 D57	T49-N53 VanDerWaalsContact O-CG 3.29Å; T49-N53 PolarHBondContact O-N 2.97Å; T49-N53 PolarHBondContact O-ND2 3.48Å; D50-N53 PolarHBondContact O-N 3.31Å; N51-N53 VanDerWaalsContact C-N 3.32Å; N51-N53 PolarHBondContact O-N 3.33Å; N53-I55 PolarHBondContact O-N 3.44Å; N53-V56 PolarHBondContact O-N 3.46Å; N53-D57 WeakPolarHBondContact O-CB 3.37Å; N53-D57 PolarHBondContact O-N 3.46Å
54	C	86.8	Confident	83.2	Confident	85 Å²	85	80.1 Å²	80.1	57%	0.574	43%	0.434	S	S	*	.	H	α-helix	trans	-58.7	-43.2	173.6	-72.7	0	0	0	0	112.5	D50 N51 I52 D57 A58	D50-C54 PolarHBondContact O-N 2.93Å; D50-C54 PolarHBondContact O-SG 2.93Å; N51-C54 WeakPolarHBondContact O-CB 3.39Å; N51-C54 PolarHBondContact O-N 3Å; I52-C54 PolarHBondContact O-N 3Å; C54-D57 PolarHBondContact O-N 2.91Å; C54-A58 VanDerWaalsContact O-CB 3.3Å; C54-A58 WeakPolarHBondContact O-CB 3.49Å; C54-A58 PolarHBondContact O-N 2.88Å
55	I	88.6	Confident	85	Confident	54 Å²	54	75.1 Å²	75.1	28%	0.277	41%	0.411	S	S	.	.	H	α-helix	trans	-64.6	-44.6	176.4	-67.5	164.9	0	0	0	110.5	P31 N51 I52 N53 D57 A58 L59	P31-I55 HydrophobicContact CG-CD1 4.47Å; N51-I55 WeakPolarHBondContact O-CG1 3.45Å; N51-I55 PolarHBondContact O-N 2.97Å; I52-I55 PolarHBondContact O-N 3.3Å; N53-I55 PolarHBondContact O-N 3.44Å; I55-D57 VanDerWaalsContact C-N 3.34Å; I55-D57 PolarHBondContact O-N 3.34Å; I55-A58 PolarHBondContact O-N 3.06Å; I55-L59 HydrophobicContact CG2-CD1 3.98Å; I55-L59 HydrophobicContact CG2-CG 4.39Å; I55-L59 WeakPolarHBondContact O-CB 3.39Å; I55-L59 VanDerWaalsContact O-CG 3.26Å; I55-L59 WeakPolarHBondContact O-CG 3.38Å; I55-L59 PolarHBondContact O-N 3.02Å
56	V	92.5	Very high	86.7	Confident	52 Å²	52	76.4 Å²	76.4	32%	0.315	42%	0.417	S	S	.	.	H	α-helix	trans	-62.2	-42.7	178.4	169.2	0	0	0	0	110.9	I52 N53 L59 R60	I52-V56 HydrophobicContact CG2-CG2 4.27Å; I52-V56 WeakPolarHBondContact O-CB 3.35Å; I52-V56 VanDerWaalsContact O-CG2 3.3Å; I52-V56 WeakPolarHBondContact O-CG2 3.4Å; I52-V56 PolarHBondContact O-N 3.28Å; N53-V56 PolarHBondContact O-N 3.46Å; V56-L59 PolarHBondContact O-N 2.84Å; V56-R60 WeakPolarHBondContact O-CG 3.31Å; V56-R60 PolarHBondContact O-N 2.95Å
57	D	92.1	Very high	88.5	Confident	81 Å²	81	79.3 Å²	79.3	43%	0.433	42%	0.423	S	S	.	.	H	α-helix	trans	-69.1	-39.3	178.1	-72.8	-18.7	0	0	0	111.8	N53 C54 I55 L59 R60 C61	N53-D57 WeakPolarHBondContact O-CB 3.37Å; N53-D57 PolarHBondContact O-N 3.46Å; C54-D57 PolarHBondContact O-N 2.91Å; I55-D57 VanDerWaalsContact C-N 3.34Å; I55-D57 PolarHBondContact O-N 3.34Å; D57-L59 VanDerWaalsContact C-N 3.34Å; D57-L59 PolarHBondContact O-N 3.42Å; D57-R60 PolarHBondContact O-N 3.38Å; D57-R60 IonicContact OD1-CZ 3.99Å; D57-R60 IonicContact OD1-NH1 2.93Å; D57-R60 PolarHBondContact OD1-NH1 2.87Å; D57-C61 WeakPolarHBondContact O-CB 3.47Å; D57-C61 PolarHBondContact O-N 3.29Å; D57-C61 PolarHBondContact O-SG 2.98Å
58	A	91.5	Very high	89.8	Confident	23 Å²	23	80.6 Å²	80.6	19%	0.19	42%	0.42	C	S	.	.	H	α-helix	trans	-60.5	-42.5	172.1	0	0	0	0	0	112	I28 C54 I55 C61 A62	I28-A58 HydrophobicContact CD1-CB 4.19Å; I28-A58 HydrophobicContact CG2-CB 3.91Å; C54-A58 VanDerWaalsContact O-CB 3.3Å; C54-A58 WeakPolarHBondContact O-CB 3.49Å; C54-A58 PolarHBondContact O-N 2.88Å; I55-A58 PolarHBondContact O-N 3.06Å; A58-C61 PolarHBondContact O-N 3.21Å; A58-A62 WeakPolarHBondContact O-CB 3.46Å; A58-A62 PolarHBondContact O-N 3.04Å
59	L	94.4	Very high	91	Very high	104 Å²	104	82.3 Å²	82.3	55%	0.545	43%	0.428	S	S	.	.	H	α-helix	trans	-66	-39.6	175.2	-71.7	172.5	0	0	0	112.1	I55 V56 D57 A62 L63	I55-L59 HydrophobicContact CG2-CD1 3.98Å; I55-L59 HydrophobicContact CG2-CG 4.39Å; I55-L59 WeakPolarHBondContact O-CB 3.39Å; I55-L59 VanDerWaalsContact O-CG 3.26Å; I55-L59 WeakPolarHBondContact O-CG 3.38Å; I55-L59 PolarHBondContact O-N 3.02Å; V56-L59 PolarHBondContact O-N 2.84Å; D57-L59 VanDerWaalsContact C-N 3.34Å; D57-L59 PolarHBondContact O-N 3.42Å; L59-A62 PolarHBondContact O-N 3.12Å; L59-L63 WeakPolarHBondContact O-CG 3.46Å; L59-L63 PolarHBondContact O-N 3.33Å
60	R	94.2	Very high	91.9	Very high	150 Å²	150	83.2 Å²	83.2	57%	0.566	43%	0.43	S	S	*	.	H	α-helix	trans	-62.6	-44.4	173.9	-76.5	172.5	179.4	153.5	-2.2	111.6	V56 D57 A62 L63 V64	V56-R60 WeakPolarHBondContact O-CG 3.31Å; V56-R60 PolarHBondContact O-N 2.95Å; D57-R60 PolarHBondContact O-N 3.38Å; D57-R60 IonicContact OD1-CZ 3.99Å; D57-R60 IonicContact OD1-NH1 2.93Å; D57-R60 PolarHBondContact OD1-NH1 2.87Å; R60-A62 VanDerWaalsContact C-N 3.35Å; R60-L63 PolarHBondContact O-N 3.38Å; R60-V64 WeakPolarHBondContact O-CG2 3.43Å; R60-V64 PolarHBondContact O-N 3.11Å
61	C	93.4	Very high	92.8	Very high	86 Å²	86	85 Å²	85	58%	0.581	44%	0.435	S	S	*	.	H	α-helix	trans	-59.9	-45.7	175.2	-71.6	0	0	0	0	111.3	D57 A58 L63 V64 S65	D57-C61 WeakPolarHBondContact O-CB 3.47Å; D57-C61 PolarHBondContact O-N 3.29Å; D57-C61 PolarHBondContact O-SG 2.98Å; A58-C61 PolarHBondContact O-N 3.21Å; C61-L63 PolarHBondContact O-N 3.02Å; C61-V64 PolarHBondContact O-N 3.06Å; C61-S65 PolarHBondContact O-N 3.43Å
62	A	93.6	Very high	93.3	Very high	27 Å²	27	85.5 Å²	85.5	22%	0.223	45%	0.445	C	S	.	.	H	α-helix	trans	-61.2	-42.4	176.9	0	0	0	0	0	112.1	A58 L59 R60 S65 F66	A58-A62 WeakPolarHBondContact O-CB 3.46Å; A58-A62 PolarHBondContact O-N 3.04Å; L59-A62 PolarHBondContact O-N 3.12Å; R60-A62 VanDerWaalsContact C-N 3.35Å; A62-S65 WeakPolarHBondContact O-CB 3.35Å; A62-S65 PolarHBondContact O-N 2.93Å; A62-F66 HydrophobicContact CB-CE2 4.35Å; A62-F66 WeakPolarHBondContact O-CD2 3.5Å; A62-F66 WeakPolarHBondContact O-CG 3.48Å; A62-F66 PolarHBondContact O-N 3.43Å
63	L	95.2	Very high	93.8	Very high	106 Å²	106	87 Å²	87	56%	0.555	45%	0.45	S	S	*	.	H	α-helix	trans	-60.1	-47.3	175.8	-75.9	168.8	0	0	0	112	L59 R60 C61 S65 F66 E67	L59-L63 WeakPolarHBondContact O-CG 3.46Å; L59-L63 PolarHBondContact O-N 3.33Å; R60-L63 PolarHBondContact O-N 3.38Å; C61-L63 PolarHBondContact O-N 3.02Å; L63-S65 VanDerWaalsContact C-N 3.27Å; L63-S65 PolarHBondContact O-N 3.33Å; L63-F66 PolarHBondContact O-N 3.28Å; L63-E67 WeakPolarHBondContact O-CG 3.45Å; L63-E67 PolarHBondContact O-N 3.43Å
64	V	95.3	Very high	94.3	Very high	80 Å²	80	87.3 Å²	87.3	49%	0.485	45%	0.452	S	S	.	.	H	α-helix	trans	-63.1	-35	176.3	173.2	0	0	0	0	111.5	R60 C61 R68	R60-V64 WeakPolarHBondContact O-CG2 3.43Å; R60-V64 PolarHBondContact O-N 3.11Å; C61-V64 PolarHBondContact O-N 3.06Å; V64-R68 WeakPolarHBondContact O-CG 3.35Å; V64-R68 PolarHBondContact O-N 3.03Å; V64-R68 PolarHBondContact O-NE 3.37Å
65	S	94	Very high	94.9	Very high	4 Å²	4	87.3 Å²	87.3	3%	0.028	45%	0.446	C	S	.	.	H	α-helix	trans	-64.2	-50.6	173.9	-152.4	0	0	0	0	111.3	E25 C61 A62 L63 E67 R68 H69	E25-S65 PolarHBondContact OE1-OG 2.92Å; C61-S65 PolarHBondContact O-N 3.43Å; A62-S65 WeakPolarHBondContact O-CB 3.35Å; A62-S65 PolarHBondContact O-N 2.93Å; L63-S65 VanDerWaalsContact C-N 3.27Å; L63-S65 PolarHBondContact O-N 3.33Å; S65-E67 VanDerWaalsContact C-N 3.34Å; S65-E67 PolarHBondContact O-N 3.33Å; S65-R68 WeakPolarHBondContact O-CB 3.5Å; S65-R68 PolarHBondContact O-N 3.39Å; S65-R68 VanDerWaalsContact O-N 3.13Å; S65-R68 PolarHBondContact OG-NH2 3.19Å; S65-H69 PolarHBondContact O-CD2 3.42Å; S65-H69 PolarHBondContact O-N 2.89Å
66	F	95.1	Very high	95.3	Very high	131 Å²	131	87.9 Å²	87.9	58%	0.575	45%	0.454	S	S	*	.	H	α-helix	trans	-61.3	-38.9	178	-71.1	-47.4	0	0	0	113.2	A62 L63 R68 H69 I70	A62-F66 HydrophobicContact CB-CE2 4.35Å; A62-F66 WeakPolarHBondContact O-CD2 3.5Å; A62-F66 WeakPolarHBondContact O-CG 3.48Å; A62-F66 PolarHBondContact O-N 3.43Å; L63-F66 PolarHBondContact O-N 3.28Å; F66-R68 VanDerWaalsContact C-N 3.33Å; F66-R68 PolarHBondContact O-N 2.95Å; F66-H69 PolarHBondContact O-N 3Å; F66-I70 VanDerWaalsContact O-CG1 3.28Å; F66-I70 WeakPolarHBondContact O-CG1 3.42Å; F66-I70 PolarHBondContact O-N 3Å
67	E	96.2	Very high	95.6	Very high	131 Å²	131	89.5 Å²	89.5	61%	0.612	46%	0.464	S	S	*	.	H	α-helix	trans	-60.3	-42.4	174.7	-76.2	177.9	175.3	0	0	111.9	L63 S65 I70 Q71	L63-E67 WeakPolarHBondContact O-CG 3.45Å; L63-E67 PolarHBondContact O-N 3.43Å; S65-E67 VanDerWaalsContact C-N 3.34Å; S65-E67 PolarHBondContact O-N 3.33Å; E67-I70 PolarHBondContact O-N 2.93Å; E67-Q71 WeakPolarHBondContact O-CB 3.39Å; E67-Q71 PolarHBondContact O-N 3.32Å
68	R	95.6	Very high	95.8	Very high	141 Å²	141	89.7 Å²	89.7	53%	0.532	47%	0.465	S	S	.	.	H	α-helix	trans	-64.2	-42.4	174.8	-72.9	-176.4	-68.6	138.8	-1	111.9	V64 S65 F66 Q71 A72	V64-R68 WeakPolarHBondContact O-CG 3.35Å; V64-R68 PolarHBondContact O-N 3.03Å; V64-R68 PolarHBondContact O-NE 3.37Å; S65-R68 WeakPolarHBondContact O-CB 3.5Å; S65-R68 PolarHBondContact O-N 3.39Å; S65-R68 VanDerWaalsContact O-N 3.13Å; S65-R68 PolarHBondContact OG-NH2 3.19Å; F66-R68 VanDerWaalsContact C-N 3.33Å; F66-R68 PolarHBondContact O-N 2.95Å; R68-Q71 PolarHBondContact O-N 3.11Å; R68-A72 PolarHBondContact O-N 2.93Å
69	H	96.1	Very high	96.2	Very high	91 Å²	91	93.2 Å²	93.2	42%	0.421	48%	0.481	S	S	.	.	H	α-helix	trans	-62.3	-46.2	176.4	-73.2	-61.6	0	0	0	112	S65 F66 Q71 A72 E73	S65-H69 PolarHBondContact O-CD2 3.42Å; S65-H69 PolarHBondContact O-N 2.89Å; F66-H69 PolarHBondContact O-N 3Å; H69-Q71 VanDerWaalsContact C-N 3.28Å; H69-Q71 PolarHBondContact O-N 3.4Å; H69-A72 WeakPolarHBondContact O-CB 3.45Å; H69-A72 PolarHBondContact O-N 2.86Å; H69-A72 VanDerWaalsContact O-N 3.11Å; H69-E73 WeakPolarHBondContact O-CG 3.34Å; H69-E73 PolarHBondContact O-N 3.19Å
70	I	96.7	Very high	96.4	Very high	94 Å²	94	92.8 Å²	92.8	48%	0.482	48%	0.478	S	S	.	.	H	α-helix	trans	-59.2	-41.6	175.9	-69.9	165.6	0	0	0	110.6	F66 E67 E73 N74	F66-I70 VanDerWaalsContact O-CG1 3.28Å; F66-I70 WeakPolarHBondContact O-CG1 3.42Å; F66-I70 PolarHBondContact O-N 3Å; E67-I70 PolarHBondContact O-N 2.93Å; I70-E73 PolarHBondContact O-N 3.23Å; I70-N74 WeakPolarHBondContact O-CB 3.28Å; I70-N74 VanDerWaalsContact O-CG 3.27Å; I70-N74 PolarHBondContact O-N 3.26Å; I70-N74 PolarHBondContact O-ND2 3.44Å
71	Q	97.2	Very high	96.6	Very high	122 Å²	122	91.9 Å²	91.9	57%	0.57	48%	0.478	S	S	*	.	H	α-helix	trans	-63.1	-43.4	175.9	-171.8	-179.9	1.9	0	0	111.8	E67 R68 H69 N74 N75	E67-Q71 WeakPolarHBondContact O-CB 3.39Å; E67-Q71 PolarHBondContact O-N 3.32Å; R68-Q71 PolarHBondContact O-N 3.11Å; H69-Q71 VanDerWaalsContact C-N 3.28Å; H69-Q71 PolarHBondContact O-N 3.4Å; Q71-N74 PolarHBondContact O-N 3.01Å; Q71-N75 VanDerWaalsContact O-CG 3.26Å; Q71-N75 PolarHBondContact O-N 3.37Å; Q71-N75 PolarHBondContact O-ND2 2.81Å
72	A	96.7	Very high	96.8	Very high	55 Å²	55	92.3 Å²	92.3	46%	0.455	48%	0.475	S	S	.	.	H	α-helix	trans	-63.7	-42.7	176.8	0	0	0	0	0	112.1	R68 H69 N75 C76	R68-A72 PolarHBondContact O-N 2.93Å; H69-A72 WeakPolarHBondContact O-CB 3.45Å; H69-A72 PolarHBondContact O-N 2.86Å; H69-A72 VanDerWaalsContact O-N 3.11Å; A72-N75 PolarHBondContact O-N 2.95Å; A72-C76 WeakPolarHBondContact O-CB 3.49Å; A72-C76 PolarHBondContact O-N 3.04Å
73	E	97.9	Very high	97	Very high	129 Å²	129	96.2 Å²	96.2	60%	0.603	49%	0.491	S	S	*	.	H	α-helix	trans	-62.6	-41.7	175.6	-74.8	-176.8	174.3	0	0	112.2	H69 I70 C76 T77	H69-E73 WeakPolarHBondContact O-CG 3.34Å; H69-E73 PolarHBondContact O-N 3.19Å; I70-E73 PolarHBondContact O-N 3.23Å; E73-C76 PolarHBondContact O-N 3.02Å; E73-T77 WeakPolarHBondContact O-CB 3.48Å; E73-T77 PolarHBondContact O-N 3.39Å; E73-T77 PolarHBondContact O-OG1 2.84Å
74	N	98.1	Very high	97.2	Very high	87 Å²	87	94.1 Å²	94.1	47%	0.465	49%	0.485	S	S	.	.	H	α-helix	trans	-63.6	-41.5	175.9	-78	-39	0	0	0	111.8	I70 Q71 T77 N78	I70-N74 WeakPolarHBondContact O-CB 3.28Å; I70-N74 VanDerWaalsContact O-CG 3.27Å; I70-N74 PolarHBondContact O-N 3.26Å; I70-N74 PolarHBondContact O-ND2 3.44Å; Q71-N74 PolarHBondContact O-N 3.01Å; N74-T77 PolarHBondContact O-N 3.3Å; N74-N78 VanDerWaalsContact O-CG 3.32Å; N74-N78 PolarHBondContact O-N 2.93Å; N74-N78 PolarHBondContact O-ND2 2.92Å
75	N	97.7	Very high	97.3	Very high	85 Å²	85	94.3 Å²	94.3	46%	0.455	48%	0.483	S	S	.	.	H	α-helix	trans	-62.9	-48.5	175.2	-69.9	-18.3	0	0	0	111.2	Q71 A72 T77 N78 D79	Q71-N75 VanDerWaalsContact O-CG 3.26Å; Q71-N75 PolarHBondContact O-N 3.37Å; Q71-N75 PolarHBondContact O-ND2 2.81Å; A72-N75 PolarHBondContact O-N 2.95Å; N75-T77 VanDerWaalsContact C-N 3.32Å; N75-T77 PolarHBondContact O-N 3.45Å; N75-N78 WeakPolarHBondContact O-CB 3.42Å; N75-N78 PolarHBondContact O-N 2.81Å; N75-N78 VanDerWaalsContact O-N 3.11Å; N75-D79 PolarHBondContact O-N 3.37Å
76	C	97.8	Very high	97.5	Very high	67 Å²	67	99.6 Å²	99.6	45%	0.453	51%	0.508	S	S	.	.	H	α-helix	trans	-57.9	-43.9	176.5	-177	0	0	0	0	111.9	A72 E73 N78 D79 I80	A72-C76 WeakPolarHBondContact O-CB 3.49Å; A72-C76 PolarHBondContact O-N 3.04Å; E73-C76 PolarHBondContact O-N 3.02Å; C76-N78 VanDerWaalsContact C-N 3.31Å; C76-N78 PolarHBondContact O-N 3.02Å; C76-D79 PolarHBondContact O-N 2.99Å; C76-I80 WeakPolarHBondContact O-CG1 3.17Å; C76-I80 PolarHBondContact O-N 3.35Å
77	T	98.1	Very high	97.7	Very high	85 Å²	85	96 Å²	96	52%	0.521	50%	0.502	S	S	.	.	H	α-helix	trans	-60.9	-40.8	176.6	-60.4	0	0	0	0	111.7	E73 N74 N75 K81	E73-T77 WeakPolarHBondContact O-CB 3.48Å; E73-T77 PolarHBondContact O-N 3.39Å; E73-T77 PolarHBondContact O-OG1 2.84Å; N74-T77 PolarHBondContact O-N 3.3Å; N75-T77 VanDerWaalsContact C-N 3.32Å; N75-T77 PolarHBondContact O-N 3.45Å; T77-K81 WeakPolarHBondContact O-CB 3.46Å; T77-K81 PolarHBondContact O-N 3.3Å
78	N	98.1	Very high	97.8	Very high	85 Å²	85	96.1 Å²	96.1	46%	0.455	50%	0.501	S	S	.	.	H	α-helix	trans	-66.2	-41.6	175.8	-74.5	-33.3	0	0	0	112.2	N74 N75 C76 K81 N82	N74-N78 VanDerWaalsContact O-CG 3.32Å; N74-N78 PolarHBondContact O-N 2.93Å; N74-N78 PolarHBondContact O-ND2 2.92Å; N75-N78 WeakPolarHBondContact O-CB 3.42Å; N75-N78 PolarHBondContact O-N 2.81Å; N75-N78 VanDerWaalsContact O-N 3.11Å; C76-N78 VanDerWaalsContact C-N 3.31Å; C76-N78 PolarHBondContact O-N 3.02Å; N78-K81 WeakPolarHBondContact O-CB 3.27Å; N78-K81 PolarHBondContact O-N 3.4Å; N78-N82 VanDerWaalsContact O-CG 3.28Å; N78-N82 PolarHBondContact O-N 3.25Å; N78-N82 PolarHBondContact O-ND2 3.42Å
79	D	98.2	Very high	98	Very high	97 Å²	97	92.1 Å²	92.1	52%	0.519	50%	0.495	S	S	.	.	H	α-helix	trans	-62.8	-45.3	177	-70	-20.8	0	0	0	111.5	N75 C76 K81 N82 L83	N75-D79 PolarHBondContact O-N 3.37Å; C76-D79 PolarHBondContact O-N 2.99Å; D79-K81 VanDerWaalsContact C-N 3.31Å; D79-K81 PolarHBondContact O-N 3.46Å; D79-N82 WeakPolarHBondContact O-CB 3.41Å; D79-N82 PolarHBondContact O-N 2.98Å; D79-L83 WeakPolarHBondContact O-CG 3.32Å; D79-L83 PolarHBondContact O-N 2.83Å
80	I	98.3	Very high	98.1	Very high	96 Å²	96	91.9 Å²	91.9	49%	0.492	50%	0.496	S	S	.	.	H	α-helix	trans	-58.6	-44.4	174.6	-68.9	167.7	0	0	0	110.6	C76 N82 L83 C84	C76-I80 WeakPolarHBondContact O-CG1 3.17Å; C76-I80 PolarHBondContact O-N 3.35Å; I80-N82 VanDerWaalsContact C-N 3.33Å; I80-N82 PolarHBondContact O-N 3.45Å; I80-L83 PolarHBondContact O-N 3.45Å; I80-C84 WeakPolarHBondContact O-CB 3.43Å; I80-C84 PolarHBondContact O-N 3.38Å; I80-C84 PolarHBondContact O-SG 3.2Å; I80-C84 VanDerWaalsContact O-SG 3.37Å
81	K	98.4	Very high	98.2	Very high	130 Å²	130	93 Å²	93	57%	0.565	50%	0.499	S	S	*	.	H	α-helix	trans	-61.3	-41.5	177.9	-173.1	-178.5	179.6	-178.5	0	111.9	T77 N78 D79 C84 N85	T77-K81 WeakPolarHBondContact O-CB 3.46Å; T77-K81 PolarHBondContact O-N 3.3Å; N78-K81 WeakPolarHBondContact O-CB 3.27Å; N78-K81 PolarHBondContact O-N 3.4Å; D79-K81 VanDerWaalsContact C-N 3.31Å; D79-K81 PolarHBondContact O-N 3.46Å; K81-C84 PolarHBondContact O-N 2.88Å; K81-N85 VanDerWaalsContact O-CG 3.28Å; K81-N85 PolarHBondContact O-N 3.04Å; K81-N85 PolarHBondContact O-ND2 3.48Å
82	N	98.3	Very high	98.2	Very high	96 Å²	96	89 Å²	89	51%	0.513	49%	0.487	S	S	.	.	H	α-helix	trans	-63.5	-47.2	176.5	-70.4	-25.3	0	0	0	111.4	N78 D79 I80 C84 N85 E86	N78-N82 VanDerWaalsContact O-CG 3.28Å; N78-N82 PolarHBondContact O-N 3.25Å; N78-N82 PolarHBondContact O-ND2 3.42Å; D79-N82 WeakPolarHBondContact O-CB 3.41Å; D79-N82 PolarHBondContact O-N 2.98Å; I80-N82 VanDerWaalsContact C-N 3.33Å; I80-N82 PolarHBondContact O-N 3.45Å; N82-C84 VanDerWaalsContact C-N 3.34Å; N82-C84 PolarHBondContact O-N 3.11Å; N82-N85 WeakPolarHBondContact O-CB 3.46Å; N82-N85 PolarHBondContact O-N 3.32Å; N82-N85 VanDerWaalsContact O-N 3.11Å; N82-E86 PolarHBondContact O-N 2.93Å
83	L	98.5	Very high	98.3	Very high	108 Å²	108	92.3 Å²	92.3	57%	0.565	49%	0.491	S	S	*	.	H	α-helix	trans	-60	-41.6	175.9	-71.6	171.5	0	0	0	112.1	D79 I80 N85 E86 A87	D79-L83 WeakPolarHBondContact O-CG 3.32Å; D79-L83 PolarHBondContact O-N 2.83Å; I80-L83 PolarHBondContact O-N 3.45Å; L83-N85 VanDerWaalsContact C-N 3.33Å; L83-N85 PolarHBondContact O-N 3.27Å; L83-E86 PolarHBondContact O-N 3.13Å; L83-A87 WeakPolarHBondContact O-CB 3.46Å; L83-A87 PolarHBondContact O-N 3.23Å
84	C	98.5	Very high	98.3	Very high	63 Å²	63	91.9 Å²	91.9	43%	0.426	49%	0.492	S	S	.	.	H	α-helix	trans	-61.9	-39.3	174.6	-74.9	0	0	0	0	112.5	I80 K81 N82 K88	I80-C84 WeakPolarHBondContact O-CB 3.43Å; I80-C84 PolarHBondContact O-N 3.38Å; I80-C84 PolarHBondContact O-SG 3.2Å; I80-C84 VanDerWaalsContact O-SG 3.37Å; K81-C84 PolarHBondContact O-N 2.88Å; N82-C84 VanDerWaalsContact C-N 3.34Å; N82-C84 PolarHBondContact O-N 3.11Å; C84-K88 VanDerWaalsContact O-CG 3.31Å; C84-K88 WeakPolarHBondContact O-CG 3.32Å; C84-K88 PolarHBondContact O-N 2.92Å
85	N	98.4	Very high	98.3	Very high	83 Å²	83	95.3 Å²	95.3	44%	0.444	50%	0.499	S	S	.	.	H	α-helix	trans	-68.4	-41	177.2	-70.6	-26.5	0	0	0	111.6	K81 N82 L83 K88 S89	K81-N85 VanDerWaalsContact O-CG 3.28Å; K81-N85 PolarHBondContact O-N 3.04Å; K81-N85 PolarHBondContact O-ND2 3.48Å; N82-N85 WeakPolarHBondContact O-CB 3.46Å; N82-N85 PolarHBondContact O-N 3.32Å; N82-N85 VanDerWaalsContact O-N 3.11Å; L83-N85 VanDerWaalsContact C-N 3.33Å; L83-N85 PolarHBondContact O-N 3.27Å; N85-K88 PolarHBondContact O-N 3.1Å; N85-S89 WeakPolarHBondContact O-CB 3.43Å; N85-S89 PolarHBondContact O-N 2.92Å
86	E	98.5	Very high	98.3	Very high	115 Å²	115	96.3 Å²	96.3	54%	0.537	50%	0.504	S	S	.	.	H	α-helix	trans	-62.1	-46.4	174.6	-171.8	179.6	173.7	0	0	111.3	N82 L83 K88 S89 L90	N82-E86 PolarHBondContact O-N 2.93Å; L83-E86 PolarHBondContact O-N 3.13Å; E86-K88 VanDerWaalsContact C-N 3.33Å; E86-K88 PolarHBondContact O-N 2.87Å; E86-S89 WeakPolarHBondContact O-CB 3.26Å; E86-S89 PolarHBondContact O-N 3.45Å; E86-S89 VanDerWaalsContact O-N 3.12Å; E86-L90 HydrophobicContact CG-CD1 4.02Å; E86-L90 WeakPolarHBondContact O-CG 3.4Å; E86-L90 PolarHBondContact O-N 3.35Å
87	A	98.4	Very high	98.3	Very high	56 Å²	56	99.7 Å²	99.7	46%	0.463	51%	0.511	S	S	.	.	H	α-helix	trans	-58.7	-42.6	176.4	0	0	0	0	0	112.1	L83 L90 Q91	L83-A87 WeakPolarHBondContact O-CB 3.46Å; L83-A87 PolarHBondContact O-N 3.23Å; A87-L90 PolarHBondContact O-N 2.84Å; A87-Q91 WeakPolarHBondContact O-CB 3.48Å; A87-Q91 PolarHBondContact O-N 2.87Å
88	K	98.6	Very high	98.3	Very high	134 Å²	134	102.4 Å²	102.4	58%	0.583	52%	0.516	S	S	*	.	H	α-helix	trans	-63.4	-41.9	174.2	-75	172.7	-178.3	175.5	0	112.2	C84 N85 E86 Q91 A92	C84-K88 VanDerWaalsContact O-CG 3.31Å; C84-K88 WeakPolarHBondContact O-CG 3.32Å; C84-K88 PolarHBondContact O-N 2.92Å; N85-K88 PolarHBondContact O-N 3.1Å; E86-K88 VanDerWaalsContact C-N 3.33Å; E86-K88 PolarHBondContact O-N 2.87Å; K88-Q91 PolarHBondContact O-N 3.46Å; K88-A92 PolarHBondContact O-N 2.88Å
89	S	98.5	Very high	98.3	Very high	57 Å²	57	100.2 Å²	100.2	40%	0.399	51%	0.513	S	S	.	.	H	α-helix	trans	-62.7	-45.2	176.3	-177.9	0	0	0	0	111.6	N85 E86 A92 K93	N85-S89 WeakPolarHBondContact O-CB 3.43Å; N85-S89 PolarHBondContact O-N 2.92Å; E86-S89 WeakPolarHBondContact O-CB 3.26Å; E86-S89 PolarHBondContact O-N 3.45Å; E86-S89 VanDerWaalsContact O-N 3.12Å; S89-A92 PolarHBondContact O-N 3.31Å; S89-K93 WeakPolarHBondContact O-CG 3.13Å; S89-K93 PolarHBondContact O-N 3.48Å
90	L	98.5	Very high	98.3	Very high	86 Å²	86	101.3 Å²	101.3	45%	0.45	52%	0.518	S	S	.	.	H	α-helix	trans	-61.2	-43.6	174.3	-76.4	162.1	0	0	0	111.6	E86 A87 A92 K93 L94	E86-L90 HydrophobicContact CG-CD1 4.02Å; E86-L90 WeakPolarHBondContact O-CG 3.4Å; E86-L90 PolarHBondContact O-N 3.35Å; A87-L90 PolarHBondContact O-N 2.84Å; L90-A92 VanDerWaalsContact C-N 3.33Å; L90-A92 PolarHBondContact O-N 3.35Å; L90-K93 PolarHBondContact O-N 2.89Å; L90-L94 WeakPolarHBondContact O-CB 3.3Å; L90-L94 WeakPolarHBondContact O-CG 3.44Å; L90-L94 PolarHBondContact O-N 3.25Å
91	Q	98.4	Very high	98.3	Very high	116 Å²	116	101.2 Å²	101.2	54%	0.542	52%	0.518	S	S	.	.	H	α-helix	trans	-60.3	-41.9	176.4	-170.7	-174.4	25.9	0	0	112	A87 K88 L94 R95	A87-Q91 WeakPolarHBondContact O-CB 3.48Å; A87-Q91 PolarHBondContact O-N 2.87Å; K88-Q91 PolarHBondContact O-N 3.46Å; Q91-L94 PolarHBondContact O-N 2.87Å; Q91-R95 PolarHBondContact O-N 3.45Å
92	A	98.3	Very high	98.3	Very high	40 Å²	40	98.8 Å²	98.8	33%	0.331	51%	0.51	S	S	.	.	H	α-helix	trans	-63.1	-49.1	175.1	0	0	0	0	0	111.4	K88 S89 L90 L94 R95 D96	K88-A92 PolarHBondContact O-N 2.88Å; S89-A92 PolarHBondContact O-N 3.31Å; L90-A92 VanDerWaalsContact C-N 3.33Å; L90-A92 PolarHBondContact O-N 3.35Å; A92-L94 VanDerWaalsContact C-N 3.28Å; A92-L94 PolarHBondContact O-N 3.37Å; A92-R95 WeakPolarHBondContact O-CB 3.23Å; A92-R95 PolarHBondContact O-N 3.36Å; A92-D96 PolarHBondContact O-N 3.28Å
93	K	98.4	Very high	98.2	Very high	124 Å²	124	98.2 Å²	98.2	54%	0.539	51%	0.507	S	S	.	.	H	α-helix	trans	-57.3	-40.1	176.6	-70.5	173.8	-175.2	177.1	0	112.6	S89 L90 K97	S89-K93 WeakPolarHBondContact O-CG 3.13Å; S89-K93 PolarHBondContact O-N 3.48Å; L90-K93 PolarHBondContact O-N 2.89Å; K93-K97 WeakPolarHBondContact O-CB 3.46Å; K93-K97 WeakPolarHBondContact O-CG 3.22Å; K93-K97 PolarHBondContact O-N 3.37Å
94	L	98.2	Very high	98.2	Very high	119 Å²	119	98.6 Å²	98.6	62%	0.623	51%	0.506	S	S	*	.	H	α-helix	trans	-66.7	-40.6	176.4	-76.3	172.4	0	0	0	111.9	L90 Q91 A92 K98	L90-L94 WeakPolarHBondContact O-CB 3.3Å; L90-L94 WeakPolarHBondContact O-CG 3.44Å; L90-L94 PolarHBondContact O-N 3.25Å; Q91-L94 PolarHBondContact O-N 2.87Å; A92-L94 VanDerWaalsContact C-N 3.28Å; A92-L94 PolarHBondContact O-N 3.37Å; L94-K98 WeakPolarHBondContact O-CB 3.46Å; L94-K98 PolarHBondContact O-N 3.31Å
95	R	98.3	Very high	98.1	Very high	160 Å²	160	101.6 Å²	101.6	60%	0.604	51%	0.512	S	S	*	.	H	α-helix	trans	-61.4	-45.6	175.4	-173.6	-172.9	-61.1	156.9	1.9	111.3	Q91 A92 K98 G99	Q91-R95 PolarHBondContact O-N 3.45Å; A92-R95 WeakPolarHBondContact O-CB 3.23Å; A92-R95 PolarHBondContact O-N 3.36Å; R95-K98 WeakPolarHBondContact O-CB 3.49Å; R95-K98 PolarHBondContact O-N 2.94Å; R95-G99 PolarHBondContact O-N 3.39Å
96	D	98.1	Very high	98	Very high	105 Å²	105	103 Å²	103	56%	0.561	52%	0.515	S	S	*	.	H	α-helix	trans	-65.1	-46.1	179.9	-64.1	-16.5	0	0	0	111.1	A92 K98 G99 L100	A92-D96 PolarHBondContact O-N 3.28Å; D96-K98 VanDerWaalsContact C-N 3.32Å; D96-K98 PolarHBondContact O-N 2.87Å; D96-G99 WeakPolarHBondContact O-CA 3.5Å; D96-G99 PolarHBondContact O-N 2.84Å; D96-G99 VanDerWaalsContact O-N 3.09Å; D96-L100 WeakPolarHBondContact O-CG 3.45Å; D96-L100 PolarHBondContact O-N 2.82Å
97	K	98.1	Very high	97.9	Very high	139 Å²	139	101.3 Å²	101.3	60%	0.604	51%	0.51	S	S	*	.	H	α-helix	trans	-58.2	-43	174.3	-78.6	-175.5	176.5	-173.6	0	112.2	K93 G99 L100 I101	K93-K97 WeakPolarHBondContact O-CB 3.46Å; K93-K97 WeakPolarHBondContact O-CG 3.22Å; K93-K97 PolarHBondContact O-N 3.37Å; K97-G99 VanDerWaalsContact C-N 3.32Å; K97-G99 PolarHBondContact O-N 3.08Å; K97-L100 PolarHBondContact O-N 3.43Å; K97-I101 VanDerWaalsContact O-CG1 3.28Å; K97-I101 WeakPolarHBondContact O-CG1 3.3Å; K97-I101 PolarHBondContact O-N 3.14Å
98	K	98.1	Very high	97.8	Very high	142 Å²	142	101.5 Å²	101.5	62%	0.617	51%	0.505	S	S	*	.	H	α-helix	trans	-58.9	-44.8	174.6	-179.3	-176.3	175.9	-178.7	0	111	L94 R95 D96 I101 I102	L94-K98 WeakPolarHBondContact O-CB 3.46Å; L94-K98 PolarHBondContact O-N 3.31Å; R95-K98 WeakPolarHBondContact O-CB 3.49Å; R95-K98 PolarHBondContact O-N 2.94Å; D96-K98 VanDerWaalsContact C-N 3.32Å; D96-K98 PolarHBondContact O-N 2.87Å; K98-I101 PolarHBondContact O-N 3.26Å; K98-I102 HydrophobicContact CG-CD1 4Å; K98-I102 WeakPolarHBondContact O-CG1 3.3Å; K98-I102 PolarHBondContact O-N 3.07Å
99	G	98.1	Very high	97.6	Very high	38 Å²	38	99.6 Å²	99.6	39%	0.392	51%	0.505	S	S	.	.	H	α-helix	trans	-59.5	-46.4	176.5	0	0	0	0	0	112.8	R95 D96 K97 I101 I102 N103	R95-G99 PolarHBondContact O-N 3.39Å; D96-G99 WeakPolarHBondContact O-CA 3.5Å; D96-G99 PolarHBondContact O-N 2.84Å; D96-G99 VanDerWaalsContact O-N 3.09Å; K97-G99 VanDerWaalsContact C-N 3.32Å; K97-G99 PolarHBondContact O-N 3.08Å; G99-I101 VanDerWaalsContact C-N 3.35Å; G99-I101 PolarHBondContact O-N 2.93Å; G99-I102 PolarHBondContact O-N 3.24Å; G99-N103 WeakPolarHBondContact O-CB 3.32Å; G99-N103 PolarHBondContact O-N 2.85Å
100	L	98	Very high	97.3	Very high	120 Å²	120	99.5 Å²	99.5	63%	0.628	50%	0.504	S	S	*	.	H	α-helix	trans	-60.4	-42.7	176.6	-69.6	173.7	0	0	0	112.4	D96 K97 N103 H104	D96-L100 WeakPolarHBondContact O-CG 3.45Å; D96-L100 PolarHBondContact O-N 2.82Å; K97-L100 PolarHBondContact O-N 3.43Å; L100-N103 PolarHBondContact O-N 3.21Å; L100-H104 WeakPolarHBondContact O-CB 3.34Å; L100-H104 PolarHBondContact O-N 3.31Å
101	I	97.7	Very high	97	Very high	95 Å²	95	99.7 Å²	99.7	49%	0.487	51%	0.506	S	S	.	.	H	α-helix	trans	-62.9	-47.5	177.3	-70.2	166.3	0	0	0	110.6	K97 K98 G99 N103 H104 F105	K97-I101 VanDerWaalsContact O-CG1 3.28Å; K97-I101 WeakPolarHBondContact O-CG1 3.3Å; K97-I101 PolarHBondContact O-N 3.14Å; K98-I101 PolarHBondContact O-N 3.26Å; G99-I101 VanDerWaalsContact C-N 3.35Å; G99-I101 PolarHBondContact O-N 2.93Å; I101-N103 PolarHBondContact O-N 2.93Å; I101-H104 PolarHBondContact O-N 3.46Å; I101-F105 HydrophobicContact CG2-CD2 3.63Å; I101-F105 HydrophobicContact CG2-CE2 3.54Å; I101-F105 VanDerWaalsContact O-CD2 3.24Å; I101-F105 WeakPolarHBondContact O-CD2 2.89Å; I101-F105 PolarHBondContact O-N 2.94Å
102	I	97.6	Very high	96.7	Very high	79 Å²	79	99 Å²	99	41%	0.405	51%	0.505	S	S	.	.	H	α-helix	trans	-60	-48.2	178.2	-69	171.3	0	0	0	110.4	K98 G99 H104 F105 Q106	K98-I102 HydrophobicContact CG-CD1 4Å; K98-I102 WeakPolarHBondContact O-CG1 3.3Å; K98-I102 PolarHBondContact O-N 3.07Å; G99-I102 PolarHBondContact O-N 3.24Å; I102-H104 VanDerWaalsContact C-N 3.31Å; I102-H104 PolarHBondContact O-N 2.93Å; I102-F105 PolarHBondContact O-N 3.48Å; I102-Q106 HydrophobicContact CG2-CG 4.31Å; I102-Q106 WeakPolarHBondContact O-CB 3.47Å; I102-Q106 VanDerWaalsContact O-CG 3.32Å; I102-Q106 WeakPolarHBondContact O-CG 3.36Å; I102-Q106 PolarHBondContact O-N 2.9Å
103	N	97.3	Very high	96.2	Very high	83 Å²	83	100.8 Å²	100.8	44%	0.444	52%	0.515	S	S	.	.	H	α-helix	trans	-60.3	-41.6	178.8	-172.1	61.9	0	0	0	111.7	G99 L100 I101 Q106 N107	G99-N103 WeakPolarHBondContact O-CB 3.32Å; G99-N103 PolarHBondContact O-N 2.85Å; L100-N103 PolarHBondContact O-N 3.21Å; I101-N103 PolarHBondContact O-N 2.93Å; N103-Q106 PolarHBondContact O-N 3.27Å; N103-N107 VanDerWaalsContact O-CG 3.26Å; N103-N107 PolarHBondContact O-N 2.86Å
104	H	97.6	Very high	95.5	Very high	116 Å²	116	102.2 Å²	102.2	54%	0.537	52%	0.524	S	S	.	.	H	α-helix	trans	-60.2	-48.8	175.3	178.8	70	0	0	0	111.9	L100 I101 I102 Q106 N107 V108	L100-H104 WeakPolarHBondContact O-CB 3.34Å; L100-H104 PolarHBondContact O-N 3.31Å; I101-H104 PolarHBondContact O-N 3.46Å; I102-H104 VanDerWaalsContact C-N 3.31Å; I102-H104 PolarHBondContact O-N 2.93Å; H104-Q106 PolarHBondContact O-N 3.47Å; H104-N107 PolarHBondContact O-N 3.31Å; H104-V108 WeakPolarHBondContact O-CG2 3.45Å; H104-V108 PolarHBondContact O-N 2.73Å
105	F	96.9	Very high	94.6	Very high	127 Å²	127	104 Å²	104	56%	0.557	53%	0.529	S	S	*	.	H	α-helix	trans	-64.4	-38.2	177.8	-80.4	-64	0	0	0	112.8	I101 I102 N107 V108 V109	I101-F105 HydrophobicContact CG2-CD2 3.63Å; I101-F105 HydrophobicContact CG2-CE2 3.54Å; I101-F105 VanDerWaalsContact O-CD2 3.24Å; I101-F105 WeakPolarHBondContact O-CD2 2.89Å; I101-F105 PolarHBondContact O-N 2.94Å; I102-F105 PolarHBondContact O-N 3.48Å; F105-N107 VanDerWaalsContact C-N 3.34Å; F105-N107 PolarHBondContact O-N 3.38Å; F105-V108 PolarHBondContact O-N 2.95Å; F105-V109 WeakPolarHBondContact O-CB 3.48Å; F105-V109 VanDerWaalsContact O-CG2 3.28Å; F105-V109 WeakPolarHBondContact O-CG2 3.41Å; F105-V109 PolarHBondContact O-N 2.91Å
106	Q	96.3	Very high	92.7	Very high	111 Å²	111	108.1 Å²	108.1	52%	0.519	55%	0.551	S	S	.	*	H	α-helix	trans	-61.8	-42	175.2	-74.7	172.3	-30.7	0	0	111.9	I102 N103 H104 V109 S110	I102-Q106 HydrophobicContact CG2-CG 4.31Å; I102-Q106 WeakPolarHBondContact O-CB 3.47Å; I102-Q106 VanDerWaalsContact O-CG 3.32Å; I102-Q106 WeakPolarHBondContact O-CG 3.36Å; I102-Q106 PolarHBondContact O-N 2.9Å; N103-Q106 PolarHBondContact O-N 3.27Å; H104-Q106 PolarHBondContact O-N 3.47Å; Q106-V109 PolarHBondContact O-N 3.48Å; Q106-S110 WeakPolarHBondContact O-CB 3.22Å; Q106-S110 PolarHBondContact O-N 3.3Å; Q106-S110 PolarHBondContact O-OG 3.4Å
107	N	96	Very high	92.4	Very high	81 Å²	81	108.3 Å²	108.3	43%	0.433	55%	0.551	S	S	.	*	H	α-helix	trans	-64.5	-44.7	175.5	-69.8	-13.2	0	0	0	111.8	N103 H104 F105 V109 S110 N111	N103-N107 VanDerWaalsContact O-CG 3.26Å; N103-N107 PolarHBondContact O-N 2.86Å; H104-N107 PolarHBondContact O-N 3.31Å; F105-N107 VanDerWaalsContact C-N 3.34Å; F105-N107 PolarHBondContact O-N 3.38Å; N107-V109 PolarHBondContact O-N 2.67Å; N107-S110 PolarHBondContact O-N 2.89Å; N107-N111 PolarHBondContact O-N 2.95Å; N107-N111 PolarHBondContact O-OD1 3.09Å
108	V	95.9	Very high	92.1	Very high	59 Å²	59	106.6 Å²	106.6	36%	0.358	55%	0.548	S	S	.	.	H	α-helix	trans	-60.6	-45.5	177.1	171.6	0	0	0	0	111.2	H104 F105 S110 N111 L112	H104-V108 WeakPolarHBondContact O-CG2 3.45Å; H104-V108 PolarHBondContact O-N 2.73Å; F105-V108 PolarHBondContact O-N 2.95Å; V108-S110 PolarHBondContact O-N 3.25Å; V108-N111 PolarHBondContact O-N 3.31Å; V108-L112 HydrophobicContact CG1-CD1 4.02Å; V108-L112 VanDerWaalsContact O-CG 3.31Å; V108-L112 WeakPolarHBondContact O-CG 3.37Å; V108-L112 PolarHBondContact O-N 2.91Å
109	V	94.9	Very high	91.8	Very high	94 Å²	94	104.7 Å²	104.7	57%	0.57	54%	0.544	S	S	*	.	H	α-helix	trans	-63.9	-40.3	177.9	170.4	0	0	0	0	111.6	F105 Q106 N107 L112 S113	F105-V109 WeakPolarHBondContact O-CB 3.48Å; F105-V109 VanDerWaalsContact O-CG2 3.28Å; F105-V109 WeakPolarHBondContact O-CG2 3.41Å; F105-V109 PolarHBondContact O-N 2.91Å; Q106-V109 PolarHBondContact O-N 3.48Å; N107-V109 PolarHBondContact O-N 2.67Å; V109-L112 PolarHBondContact O-N 3.03Å; V109-S113 PolarHBondContact O-N 3.23Å; V109-S113 VanDerWaalsContact O-N 3.1Å
110	S	93.3	Very high	91.4	Very high	55 Å²	55	108.6 Å²	108.6	39%	0.385	55%	0.553	S	S	.	*	H	α-helix	trans	-64.5	-47.5	178.7	-55.9	0	0	0	0	111	Q106 N107 V108 L112 S113 E114	Q106-S110 WeakPolarHBondContact O-CB 3.22Å; Q106-S110 PolarHBondContact O-N 3.3Å; Q106-S110 PolarHBondContact O-OG 3.4Å; N107-S110 PolarHBondContact O-N 2.89Å; V108-S110 PolarHBondContact O-N 3.25Å; S110-L112 VanDerWaalsContact C-N 3.33Å; S110-L112 PolarHBondContact O-N 3.06Å; S110-S113 PolarHBondContact O-N 3.31Å; S110-S113 PolarHBondContact O-OG 3Å; S110-E114 PolarHBondContact O-N 3.24Å; S110-E114 VanDerWaalsContact O-N 3.17Å
111	N	92	Very high	91	Very high	91 Å²	91	107.9 Å²	107.9	49%	0.487	55%	0.548	S	S	.	.	H	α-helix	trans	-60.7	-41.9	177.7	-65.5	-6.4	0	0	0	111.9	N107 V108 S113 E114 E115	N107-N111 PolarHBondContact O-N 2.95Å; N107-N111 PolarHBondContact O-OD1 3.09Å; V108-N111 PolarHBondContact O-N 3.31Å; N111-S113 PolarHBondContact O-N 2.83Å; N111-E114 PolarHBondContact O-N 3.5Å; N111-E115 PolarHBondContact O-N 3.26Å
112	L	91.3	Very high	90.5	Very high	100 Å²	100	108.7 Å²	108.7	52%	0.524	55%	0.552	S	S	.	*	H	α-helix	trans	-66	-23.6	176.1	-72.6	172	0	0	0	113.6	V108 V109 S110	V108-L112 HydrophobicContact CG1-CD1 4.02Å; V108-L112 VanDerWaalsContact O-CG 3.31Å; V108-L112 WeakPolarHBondContact O-CG 3.37Å; V108-L112 PolarHBondContact O-N 2.91Å; V109-L112 PolarHBondContact O-N 3.03Å; S110-L112 VanDerWaalsContact C-N 3.33Å; S110-L112 PolarHBondContact O-N 3.06Å
113	S	87.7	Confident	90	Very high	78 Å²	78	110.9 Å²	110.9	55%	0.545	56%	0.563	S	S	.	*	H	α-helix	trans	-81.7	-24.4	176	71.4	0	0	0	0	113.2	V109 S110 N111	V109-S113 PolarHBondContact O-N 3.23Å; V109-S113 VanDerWaalsContact O-N 3.1Å; S110-S113 PolarHBondContact O-N 3.31Å; S110-S113 PolarHBondContact O-OG 3Å; N111-S113 PolarHBondContact O-N 2.83Å
114	E	84.7	Confident	89.5	Confident	154 Å²	154	113 Å²	113	72%	0.72	57%	0.572	S	S	*	*	H	α-helix	trans	-81.2	-22.3	175.3	-67.7	178.4	-178.5	0	0	112.4	S110 N111 K116	S110-E114 PolarHBondContact O-N 3.24Å; S110-E114 VanDerWaalsContact O-N 3.17Å; N111-E114 PolarHBondContact O-N 3.5Å; E114-K116 VanDerWaalsContact C-N 3.29Å; E114-K116 PolarHBondContact O-N 3.5Å
115	E	78.2	Confident	88.8	Confident	158 Å²	158	112.8 Å²	112.8	74%	0.738	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.6	3.6	178.3	-72.4	179.2	-177.2	0	0	114.6	N111	N111-E115 PolarHBondContact O-N 3.26Å
116	K	58.3	Low	88	Confident	245 Å²	245	111.5 Å²	111.5	100%	1.065	58%	0.577	S	S	*	*			trans	-113	0	-179.4	-74.3	-174	178.5	-179.6	0	113.1	E114	E114-K116 VanDerWaalsContact C-N 3.29Å; E114-K116 PolarHBondContact O-N 3.5Å

Retrieved 116 of 116 residues in 368.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).