G4V891_SCHMA Loading...

Transmembrane protein 42

AlphaFold DB , UniProt , Accession G4V891, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 127 aa.

						>G4V891_SCHMA|G4V891
MISNKMGYPLAVISGFCAACTSLYGKLLSEGYILTKLLACFPDANKNFLVFSSYGGAIVLNVVMWLALVTALSISQKSVAALATNTLSNFAFSAAFGRCIFQEELTGNWFLGMLCLSIGIIFLVCEK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.1	Very low	71.1	Confident	218 Å²	218	86.1 Å²	86.1	100%	1.074	44%	0.438	S	S	*	.				0	-26.6	0	-146.5	171.9	177.1	0	0	113.9
2	I	47.1	Very low	73	Confident	139 Å²	139	83.8 Å²	83.8	71%	0.713	43%	0.431	S	S	*	.			trans	-67.7	-33.4	174.9	-67	165	0	0	0	112.5	N4 K5 M6	I2-N4 PolarHBondContact O-N 3.37Å; I2-K5 PolarHBondContact O-N 3.46Å; I2-M6 HydrophobicContact CG2-SD 4.34Å
3	S	52.8	Low	74.5	Confident	66 Å²	66	84.6 Å²	84.6	46%	0.462	44%	0.435	S	S	.	.	H	α-helix	trans	-50.7	-47.3	-179.7	-157.5	0	0	0	0	113.5	K5 M6 I74	S3-K5 VanDerWaalsContact C-N 3.32Å; S3-K5 PolarHBondContact O-N 3.37Å; S3-M6 PolarHBondContact O-N 2.96Å; S3-I74 WeakPolarHBondContact O-CG2 3.44Å; S3-I74 WeakPolarHBondContact OG-CG2 3.29Å
4	N	57.1	Low	75.9	Confident	69 Å²	69	78.6 Å²	78.6	37%	0.369	40%	0.404	S	S	.	.	H	α-helix	trans	-71.5	-22.3	-173.2	-70.6	-7	0	0	0	114.4	I2 Q76	I2-N4 PolarHBondContact O-N 3.37Å; N4-Q76 PolarHBondContact ND2-OE1 3.48Å
5	K	63.7	Low	77.2	Confident	175 Å²	175	73.3 Å²	73.3	76%	0.761	38%	0.377	S	S	*	.	H	α-helix	trans	-79.6	-22.3	-179.9	-70.4	-162.4	177.2	-165.3	0	112.9	I2 S3 P9	I2-K5 PolarHBondContact O-N 3.46Å; S3-K5 VanDerWaalsContact C-N 3.32Å; S3-K5 PolarHBondContact O-N 3.37Å; K5-P9 WeakPolarHBondContact O-CD 3.35Å; K5-P9 WeakPolarHBondContact O-CG 3.3Å
6	M	77.2	Confident	78.3	Confident	108 Å²	108	74.3 Å²	74.3	53%	0.532	38%	0.378	S	S	.	.	H	α-helix	trans	-88	-18.9	-176.1	-68.4	-175.6	67.7	0	0	113.8	I2 S3 P9 L10	I2-M6 HydrophobicContact CG2-SD 4.34Å; S3-M6 PolarHBondContact O-N 2.96Å; M6-P9 WeakPolarHBondContact O-CD 3.49Å; M6-L10 WeakPolarHBondContact O-CB 3.31Å; M6-L10 PolarHBondContact O-N 2.86Å; M6-L10 VanDerWaalsContact O-N 3.11Å
7	G	82	Confident	79.3	Confident	0 Å²	0	71.6 Å²	71.6	0%	0	37%	0.367	C	S	.	.	H	α-helix	trans	-59.8	-48.7	-177.9	0	0	0	0	0	114.1	L10 A11 S75	G7-L10 PolarHBondContact O-N 3.42Å; G7-A11 PolarHBondContact O-N 3.35Å; G7-S75 VanDerWaalsContact CA-OG 3.26Å; G7-S75 WeakPolarHBondContact CA-OG 3.35Å
8	Y	85.6	Confident	80.2	Confident	62 Å²	62	67.8 Å²	67.8	24%	0.243	35%	0.348	C	S	.	.	H	α-helix	trans	-68.1	-45.2	-179.9	-56.6	-68.9	0	0	0	113.7	L10 A11 V12 A80 V124	Y8-L10 VanDerWaalsContact C-N 3.25Å; Y8-L10 PolarHBondContact O-N 3.36Å; Y8-A11 WeakPolarHBondContact O-CB 3.31Å; Y8-A11 PolarHBondContact O-N 3.02Å; Y8-A11 VanDerWaalsContact O-N 3.13Å; Y8-V12 WeakPolarHBondContact O-CG2 3.43Å; Y8-V12 PolarHBondContact O-N 3.34Å; Y8-A80 HydrophobicContact CE1-CB 3.86Å; Y8-V124 HydrophobicContact CE1-CG2 3.86Å; Y8-V124 HydrophobicContact CE2-CG1 4.36Å
9	P	89.7	Confident	81	Confident	69 Å²	69	64.2 Å²	64.2	45%	0.448	33%	0.33	S	S	.	.	H	α-helix	trans	-54	-42.1	171.1	-27.5	33.7	0	0	0	112.9	K5 M6 A11 V12 I13	K5-P9 WeakPolarHBondContact O-CD 3.35Å; K5-P9 WeakPolarHBondContact O-CG 3.3Å; M6-P9 WeakPolarHBondContact O-CD 3.49Å; P9-A11 VanDerWaalsContact C-N 3.35Å; P9-A11 PolarHBondContact O-N 3.09Å; P9-V12 PolarHBondContact O-N 3.19Å; P9-I13 WeakPolarHBondContact O-CG1 3.48Å; P9-I13 PolarHBondContact O-N 3.31Å
10	L	90.6	Very high	81.6	Confident	41 Å²	41	62.7 Å²	62.7	22%	0.215	33%	0.325	C	S	.	.	H	α-helix	trans	-66.4	-37.9	178.2	-137.9	83.5	0	0	0	112	M6 G7 Y8 V12 I13 S14 T70 A71	M6-L10 WeakPolarHBondContact O-CB 3.31Å; M6-L10 PolarHBondContact O-N 2.86Å; M6-L10 VanDerWaalsContact O-N 3.11Å; G7-L10 PolarHBondContact O-N 3.42Å; Y8-L10 VanDerWaalsContact C-N 3.25Å; Y8-L10 PolarHBondContact O-N 3.36Å; L10-V12 VanDerWaalsContact C-N 3.34Å; L10-I13 PolarHBondContact O-N 3.49Å; L10-S14 WeakPolarHBondContact O-CB 3.11Å; L10-S14 PolarHBondContact O-N 2.94Å; L10-T70 HydrophobicContact CD2-CG2 3.43Å; L10-T70 VanDerWaalsContact CD2-CG2 3.43Å; L10-A71 HydrophobicContact CB-CB 3.96Å; L10-A71 HydrophobicContact CD2-CB 4.31Å
11	A	92	Very high	82.2	Confident	0 Å²	0	60.5 Å²	60.5	0%	0	31%	0.314	C	S	.	.	H	α-helix	trans	-61.8	-41.2	173.4	0	0	0	0	0	111.9	G7 Y8 P9 S14 G15 A71 A81 T84 N85	G7-A11 PolarHBondContact O-N 3.35Å; Y8-A11 WeakPolarHBondContact O-CB 3.31Å; Y8-A11 PolarHBondContact O-N 3.02Å; Y8-A11 VanDerWaalsContact O-N 3.13Å; P9-A11 VanDerWaalsContact C-N 3.35Å; P9-A11 PolarHBondContact O-N 3.09Å; A11-S14 PolarHBondContact O-N 3.27Å; A11-G15 PolarHBondContact O-N 2.97Å; A11-A71 HydrophobicContact CB-CB 4.1Å; A11-A81 HydrophobicContact CB-CB 4.42Å; A11-A81 WeakPolarHBondContact CB-O 3.34Å; A11-T84 HydrophobicContact CB-CG2 4.25Å; A11-N85 HydrophobicContact CB-CB 4.23Å; A11-N85 WeakPolarHBondContact O-CA 3.38Å; A11-N85 PolarHBondContact O-ND2 3.41Å
12	V	93.7	Very high	84.5	Confident	59 Å²	59	53.4 Å²	53.4	36%	0.358	29%	0.286	S	S	.	.	H	α-helix	trans	-62.6	-47.7	175.1	174.8	0	0	0	0	110.8	Y8 P9 L10 S14 G15 F16 T84 S88 F92	Y8-V12 WeakPolarHBondContact O-CG2 3.43Å; Y8-V12 PolarHBondContact O-N 3.34Å; P9-V12 PolarHBondContact O-N 3.19Å; L10-V12 VanDerWaalsContact C-N 3.34Å; V12-S14 VanDerWaalsContact C-N 3.33Å; V12-S14 PolarHBondContact O-N 2.61Å; V12-G15 PolarHBondContact O-N 2.89Å; V12-G15 VanDerWaalsContact O-N 3.08Å; V12-F16 PolarHBondContact O-N 3.27Å; V12-T84 HydrophobicContact CG2-CG2 3.7Å; V12-S88 PolarHBondContact O-OG 3.36Å; V12-F92 HydrophobicContact CG1-CE2 4.41Å
13	I	93.7	Very high	86.7	Confident	94 Å²	94	48.2 Å²	48.2	48%	0.482	26%	0.259	S	S	.	.	H	α-helix	trans	-59.5	-45.2	177.2	-67.4	166.1	0	0	0	110.7	P9 L10 G15 F16 C17	P9-I13 WeakPolarHBondContact O-CG1 3.48Å; P9-I13 PolarHBondContact O-N 3.31Å; L10-I13 PolarHBondContact O-N 3.49Å; I13-G15 VanDerWaalsContact C-N 3.26Å; I13-G15 PolarHBondContact O-N 3.24Å; I13-F16 WeakPolarHBondContact O-CB 3.41Å; I13-F16 PolarHBondContact O-N 3.43Å; I13-C17 PolarHBondContact O-N 2.92Å
14	S	93.9	Very high	88.6	Confident	0 Å²	0	47.5 Å²	47.5	0%	0	25%	0.247	C	C	.	.	H	α-helix	trans	-60.2	-38.7	175.8	174.2	0	0	0	0	111.4	L10 A11 V12 C17 A18 M64 L68 N85	L10-S14 WeakPolarHBondContact O-CB 3.11Å; L10-S14 PolarHBondContact O-N 2.94Å; A11-S14 PolarHBondContact O-N 3.27Å; V12-S14 VanDerWaalsContact C-N 3.33Å; V12-S14 PolarHBondContact O-N 2.61Å; S14-C17 PolarHBondContact O-N 3.46Å; S14-A18 WeakPolarHBondContact O-CB 3.31Å; S14-A18 PolarHBondContact O-N 2.92Å; S14-M64 WeakPolarHBondContact O-CG 3.43Å; S14-M64 PolarHBondContact OG-O 2.82Å; S14-L68 WeakPolarHBondContact OG-CB 3.39Å; S14-L68 PolarHBondContact OG-N 3.2Å; S14-N85 WeakPolarHBondContact CB-ND2 3.38Å; S14-N85 PolarHBondContact OG-ND2 3.45Å
15	G	95.1	Very high	90.1	Very high	0 Å²	0	45.8 Å²	45.8	0%	0	25%	0.245	C	C	.	.	H	α-helix	trans	-67.6	-37.8	178.4	0	0	0	0	0	112	A11 V12 I13 A18 A19 N85 N89	A11-G15 PolarHBondContact O-N 2.97Å; V12-G15 PolarHBondContact O-N 2.89Å; V12-G15 VanDerWaalsContact O-N 3.08Å; I13-G15 VanDerWaalsContact C-N 3.26Å; I13-G15 PolarHBondContact O-N 3.24Å; G15-A18 WeakPolarHBondContact O-CB 3.2Å; G15-A18 PolarHBondContact O-N 3.28Å; G15-A19 PolarHBondContact O-N 2.86Å; G15-N85 WeakPolarHBondContact CA-ND2 3.48Å; G15-N85 WeakPolarHBondContact CA-O 3.15Å; G15-N85 PolarHBondContact N-ND2 3.27Å; G15-N89 WeakPolarHBondContact O-CA 3.28Å
16	F	95.4	Very high	91.4	Very high	88 Å²	88	41 Å²	41	39%	0.386	22%	0.224	S	C	.	.	H	α-helix	trans	-62	-47.1	171.1	175.8	-100.2	0	0	0	111.8	V12 I13 A18 A19 C20 F92 F96	V12-F16 PolarHBondContact O-N 3.27Å; I13-F16 WeakPolarHBondContact O-CB 3.41Å; I13-F16 PolarHBondContact O-N 3.43Å; F16-A18 PolarHBondContact O-N 3.26Å; F16-A19 PolarHBondContact O-N 2.96Å; F16-C20 PolarHBondContact O-N 3.01Å; F16-C20 PolarHBondContact O-SG 3.12Å; F16-C20 VanDerWaalsContact O-SG 3.41Å; F16-F92 HydrophobicContact CB-CD2 3.76Å; F16-F92 HydrophobicContact CB-CE2 3.78Å; F16-F92 HydrophobicContact CB-CG 4.45Å; F16-F92 HydrophobicContact CB-CZ 4.46Å; F16-F92 HydrophobicContact CD2-CB 4.42Å; F16-F92 AromaticContact CD2-CD1 3.76Å; F16-F92 HydrophobicContact CD2-CD1 3.76Å; F16-F92 AromaticContact CD2-CD2 3.88Å; F16-F92 HydrophobicContact CD2-CD2 3.88Å; F16-F92 AromaticContact CD2-CE1 3.89Å; F16-F92 HydrophobicContact CD2-CE1 3.89Å; F16-F92 HydrophobicContact CD2-CE2 4.02Å; F16-F92 AromaticContact CD2-CG 3.77Å; F16-F92 HydrophobicContact CD2-CG 3.77Å; F16-F92 HydrophobicContact CD2-CZ 4.02Å; F16-F92 HydrophobicContact CE2-CD1 4.31Å; F16-F92 HydrophobicContact CE2-CE1 4.45Å; F16-F92 HydrophobicContact CG-CD2 4.34Å; F16-F92 HydrophobicContact CG-CE2 4.38Å; F16-F96 HydrophobicContact CD2-CZ 4.45Å; F16-F96 AromaticContact CE2-CZ 3.77Å; F16-F96 HydrophobicContact CE2-CZ 3.77Å; F16-F96 HydrophobicContact CZ-CZ 4.36Å
17	C	94.4	Very high	92	Very high	29 Å²	29	37.2 Å²	37.2	20%	0.196	21%	0.206	C	C	.	.	H	α-helix	trans	-60.9	-34.7	175.1	-72.9	0	0	0	0	112.3	I13 S14 C20 T21 M64	I13-C17 PolarHBondContact O-N 2.92Å; S14-C17 PolarHBondContact O-N 3.46Å; C17-C20 PolarHBondContact O-N 3.44Å; C17-T21 WeakPolarHBondContact O-CB 3.36Å; C17-T21 PolarHBondContact O-N 3Å; C17-T21 PolarHBondContact O-OG1 3.41Å; C17-M64 HydrophobicContact CB-CB 3.96Å; C17-M64 HydrophobicContact CB-CG 4.26Å
18	A	94.8	Very high	92.4	Very high	3 Å²	3	38.2 Å²	38.2	3%	0.025	21%	0.211	C	C	.	.	H	α-helix	trans	-62.9	-48.7	175.5	0	0	0	0	0	110.3	S14 G15 F16 C20 T21 S22 M64 N89	S14-A18 WeakPolarHBondContact O-CB 3.31Å; S14-A18 PolarHBondContact O-N 2.92Å; G15-A18 WeakPolarHBondContact O-CB 3.2Å; G15-A18 PolarHBondContact O-N 3.28Å; F16-A18 PolarHBondContact O-N 3.26Å; A18-C20 VanDerWaalsContact C-N 3.32Å; A18-C20 PolarHBondContact O-N 2.73Å; A18-T21 WeakPolarHBondContact O-CB 3.35Å; A18-T21 PolarHBondContact O-N 3.45Å; A18-T21 VanDerWaalsContact O-N 3.07Å; A18-S22 PolarHBondContact O-N 3.01Å; A18-S22 PolarHBondContact O-OG 3Å; A18-M64 HydrophobicContact CB-CG 3.68Å; A18-M64 HydrophobicContact CB-SD 3.38Å; A18-M64 WeakPolarHBondContact CB-SD 3.3Å; A18-N89 HydrophobicContact CB-CB 4.08Å
19	A	95.7	Very high	92.4	Very high	0 Å²	0	40.1 Å²	40.1	0%	0	23%	0.234	C	C	.	.	H	α-helix	trans	-60.6	-41	176.6	0	0	0	0	0	112.1	G15 F16 T21 S22 L23 N89 F92 S93 F96	G15-A19 PolarHBondContact O-N 2.86Å; F16-A19 PolarHBondContact O-N 2.96Å; A19-T21 VanDerWaalsContact C-N 3.33Å; A19-T21 PolarHBondContact O-N 3.27Å; A19-S22 PolarHBondContact O-N 3.5Å; A19-L23 WeakPolarHBondContact O-CB 3.44Å; A19-L23 PolarHBondContact O-N 3.25Å; A19-N89 WeakPolarHBondContact CA-OD1 3.26Å; A19-N89 PolarHBondContact N-OD1 3.25Å; A19-F92 HydrophobicContact CB-CB 3.49Å; A19-F92 VanDerWaalsContact CB-CB 3.49Å; A19-S93 WeakPolarHBondContact CA-OG 3.33Å; A19-S93 WeakPolarHBondContact CB-OG 3.4Å; A19-F96 HydrophobicContact CB-CD2 3.98Å; A19-F96 HydrophobicContact CB-CE2 3.79Å
20	C	94.1	Very high	92.3	Very high	34 Å²	34	42.8 Å²	42.8	23%	0.23	24%	0.24	C	C	.	.	H	α-helix	trans	-61.9	-39.9	173.5	-71.6	0	0	0	0	112.3	F16 C17 A18 L23 Y24	F16-C20 PolarHBondContact O-N 3.01Å; F16-C20 PolarHBondContact O-SG 3.12Å; F16-C20 VanDerWaalsContact O-SG 3.41Å; C17-C20 PolarHBondContact O-N 3.44Å; A18-C20 VanDerWaalsContact C-N 3.32Å; A18-C20 PolarHBondContact O-N 2.73Å; C20-L23 PolarHBondContact O-N 3.34Å; C20-Y24 VanDerWaalsContact O-CB 3.26Å; C20-Y24 WeakPolarHBondContact O-CB 3.37Å; C20-Y24 PolarHBondContact O-N 3.15Å
21	T	93.4	Very high	92	Very high	16 Å²	16	41.8 Å²	41.8	10%	0.098	24%	0.24	C	C	.	.	H	α-helix	trans	-66.4	-43.8	177.8	-55.1	0	0	0	0	110.8	C17 A18 A19 Y24 G25 L60 N61	C17-T21 WeakPolarHBondContact O-CB 3.36Å; C17-T21 PolarHBondContact O-N 3Å; C17-T21 PolarHBondContact O-OG1 3.41Å; A18-T21 WeakPolarHBondContact O-CB 3.35Å; A18-T21 PolarHBondContact O-N 3.45Å; A18-T21 VanDerWaalsContact O-N 3.07Å; A19-T21 VanDerWaalsContact C-N 3.33Å; A19-T21 PolarHBondContact O-N 3.27Å; T21-Y24 PolarHBondContact O-N 2.87Å; T21-G25 PolarHBondContact O-N 3.2Å; T21-L60 HydrophobicContact CG2-CB 4.44Å; T21-N61 HydrophobicContact CG2-CB 3.91Å
22	S	92.7	Very high	91.7	Very high	69 Å²	69	47.7 Å²	47.7	48%	0.483	26%	0.263	S	S	.	.	H	α-helix	trans	-62.9	-43.8	174.8	-65.1	0	0	0	0	112.1	A18 A19 G25 K26	A18-S22 PolarHBondContact O-N 3.01Å; A18-S22 PolarHBondContact O-OG 3Å; A19-S22 PolarHBondContact O-N 3.5Å; S22-G25 PolarHBondContact O-N 3.32Å; S22-K26 PolarHBondContact O-N 3.45Å
23	L	92.9	Very high	91.3	Very high	30 Å²	30	46 Å²	46	16%	0.157	25%	0.252	C	S	.	.	H	α-helix	trans	-59.8	-50.4	174.7	173.2	62.3	0	0	0	111.2	A19 C20 G25 K26 L27 F96 I100 F101	A19-L23 WeakPolarHBondContact O-CB 3.44Å; A19-L23 PolarHBondContact O-N 3.25Å; C20-L23 PolarHBondContact O-N 3.34Å; L23-G25 VanDerWaalsContact C-N 3.3Å; L23-G25 PolarHBondContact O-N 3.09Å; L23-K26 PolarHBondContact O-N 2.98Å; L23-L27 HydrophobicContact CD1-CD1 3.9Å; L23-L27 HydrophobicContact CD1-CG 4.03Å; L23-L27 HydrophobicContact CG-CD1 3.98Å; L23-L27 HydrophobicContact CG-CG 4.48Å; L23-L27 WeakPolarHBondContact O-CG 3.4Å; L23-L27 PolarHBondContact O-N 3.11Å; L23-F96 HydrophobicContact CB-CD2 4.25Å; L23-F96 HydrophobicContact CD1-CB 4.41Å; L23-F96 HydrophobicContact CD2-CB 4.23Å; L23-F96 HydrophobicContact CD2-CD1 4.26Å; L23-F96 HydrophobicContact CD2-CD2 4.04Å; L23-F96 HydrophobicContact CD2-CE2 4.46Å; L23-F96 HydrophobicContact CD2-CG 3.94Å; L23-I100 HydrophobicContact CD1-CD1 3.55Å; L23-I100 HydrophobicContact CD1-CG2 4.49Å; L23-I100 HydrophobicContact CD2-CD1 3.44Å; L23-I100 VanDerWaalsContact CD2-CD1 3.44Å; L23-I100 HydrophobicContact CG-CD1 4.11Å; L23-F101 HydrophobicContact CD1-CE2 3.56Å; L23-F101 HydrophobicContact CD1-CZ 3.95Å
24	Y	92.2	Very high	90.9	Very high	52 Å²	52	44.1 Å²	44.1	20%	0.204	24%	0.243	C	C	.	.	H	α-helix	trans	-59.2	-43.6	178.9	-170.3	-88.1	0	0	0	111.1	C20 T21 K26 L27 L28 I33 S53 A57 L60	C20-Y24 VanDerWaalsContact O-CB 3.26Å; C20-Y24 WeakPolarHBondContact O-CB 3.37Å; C20-Y24 PolarHBondContact O-N 3.15Å; T21-Y24 PolarHBondContact O-N 2.87Å; Y24-K26 PolarHBondContact O-N 3.25Å; Y24-L27 PolarHBondContact O-N 2.96Å; Y24-L28 HydrophobicContact CD1-CD1 4.37Å; Y24-L28 HydrophobicContact CE1-CD1 3.7Å; Y24-L28 WeakPolarHBondContact O-CB 3.13Å; Y24-L28 PolarHBondContact O-N 2.96Å; Y24-I33 HydrophobicContact CD1-CD1 4.36Å; Y24-I33 HydrophobicContact CD2-CD1 3.42Å; Y24-I33 VanDerWaalsContact CD2-CD1 3.42Å; Y24-I33 HydrophobicContact CE1-CD1 4.23Å; Y24-I33 HydrophobicContact CE2-CD1 3.28Å; Y24-I33 HydrophobicContact CG-CD1 3.98Å; Y24-S53 WeakPolarHBondContact CE1-O 3.41Å; Y24-S53 PolarHBondContact OH-O 2.71Å; Y24-A57 HydrophobicContact CD1-CB 3.77Å; Y24-A57 HydrophobicContact CE1-CB 3.87Å; Y24-L60 HydrophobicContact CD1-CD1 4.44Å; Y24-L60 HydrophobicContact CD2-CD1 4.14Å; Y24-L60 HydrophobicContact CG-CD1 3.96Å
25	G	90	Very high	90.6	Very high	32 Å²	32	48.7 Å²	48.7	33%	0.33	27%	0.271	S	S	.	.	H	α-helix	trans	-60.4	-43.5	175.5	0	0	0	0	0	113	T21 S22 L23 L28 S29	T21-G25 PolarHBondContact O-N 3.2Å; S22-G25 PolarHBondContact O-N 3.32Å; L23-G25 VanDerWaalsContact C-N 3.3Å; L23-G25 PolarHBondContact O-N 3.09Å; G25-L28 PolarHBondContact O-N 3.38Å; G25-S29 WeakPolarHBondContact O-CB 3.26Å; G25-S29 PolarHBondContact O-N 2.92Å
26	K	90.1	Very high	90.3	Very high	75 Å²	75	54.7 Å²	54.7	33%	0.326	30%	0.297	S	S	.	.	H	α-helix	trans	-64.5	-47.4	177.4	-168.1	169.8	176.6	-175.4	0	111.6	S22 L23 Y24 L28 S29 E30 F101 E103	S22-K26 PolarHBondContact O-N 3.45Å; L23-K26 PolarHBondContact O-N 2.98Å; Y24-K26 PolarHBondContact O-N 3.25Å; K26-L28 VanDerWaalsContact C-N 3.27Å; K26-L28 PolarHBondContact O-N 3.49Å; K26-S29 PolarHBondContact O-N 3.32Å; K26-E30 PolarHBondContact O-N 3.34Å; K26-F101 HydrophobicContact CB-CZ 4.16Å; K26-F101 HydrophobicContact CD-CD2 4.42Å; K26-F101 HydrophobicContact CD-CE1 4.02Å; K26-F101 HydrophobicContact CD-CE2 3.8Å; K26-F101 HydrophobicContact CD-CZ 3.58Å; K26-F101 HydrophobicContact CG-CE1 4.13Å; K26-F101 HydrophobicContact CG-CE2 4.43Å; K26-F101 HydrophobicContact CG-CZ 3.75Å; K26-E103 IonicContact NZ-OE1 2.66Å; K26-E103 PolarHBondContact NZ-OE1 3.18Å
27	L	90.4	Very high	89.8	Confident	28 Å²	28	52.5 Å²	52.5	15%	0.147	29%	0.289	C	S	.	.	H	α-helix	trans	-64.3	-31.5	177.2	-67	174.2	0	0	0	113.1	L23 Y24 G31 Y32 I33 I100 F101	L23-L27 HydrophobicContact CD1-CD1 3.9Å; L23-L27 HydrophobicContact CD1-CG 4.03Å; L23-L27 HydrophobicContact CG-CD1 3.98Å; L23-L27 HydrophobicContact CG-CG 4.48Å; L23-L27 WeakPolarHBondContact O-CG 3.4Å; L23-L27 PolarHBondContact O-N 3.11Å; Y24-L27 PolarHBondContact O-N 2.96Å; L27-G31 PolarHBondContact O-N 3.16Å; L27-Y32 HydrophobicContact CD2-CD1 4.21Å; L27-Y32 PolarHBondContact O-N 3.13Å; L27-I33 HydrophobicContact CB-CD1 3.94Å; L27-I33 HydrophobicContact CB-CG1 3.81Å; L27-I33 PolarHBondContact O-N 2.92Å; L27-I100 HydrophobicContact CD2-CG2 4.4Å; L27-F101 HydrophobicContact CD2-CE1 4.12Å; L27-F101 HydrophobicContact CD2-CZ 3.85Å; L27-F101 HydrophobicContact CG-CZ 4.26Å
28	L	89.6	Confident	89.5	Confident	21 Å²	21	53.5 Å²	53.5	11%	0.11	29%	0.292	C	S	.	.	H	α-helix	trans	-72.9	-40.6	175.1	-170.9	146.8	0	0	0	111.2	Y24 G25 K26 E30 G31 S53 Y54	Y24-L28 HydrophobicContact CD1-CD1 4.37Å; Y24-L28 HydrophobicContact CE1-CD1 3.7Å; Y24-L28 WeakPolarHBondContact O-CB 3.13Å; Y24-L28 PolarHBondContact O-N 2.96Å; G25-L28 PolarHBondContact O-N 3.38Å; K26-L28 VanDerWaalsContact C-N 3.27Å; K26-L28 PolarHBondContact O-N 3.49Å; L28-E30 VanDerWaalsContact C-N 3.35Å; L28-G31 WeakPolarHBondContact O-CA 3.44Å; L28-G31 PolarHBondContact O-N 3.39Å; L28-S53 VanDerWaalsContact CD1-C 3.5Å; L28-S53 VanDerWaalsContact CD1-CB 3.44Å; L28-Y54 HydrophobicContact CD2-CD1 3.87Å; L28-Y54 HydrophobicContact CD2-CD2 4.45Å; L28-Y54 HydrophobicContact CD2-CE1 3.35Å; L28-Y54 HydrophobicContact CD2-CE2 4.01Å; L28-Y54 HydrophobicContact CD2-CG 4.39Å; L28-Y54 VanDerWaalsContact CD2-CZ 3.42Å
29	S	87	Confident	89.2	Confident	103 Å²	103	57.2 Å²	57.2	72%	0.72	32%	0.323	S	S	*	.	H	α-helix	trans	-65.3	-36	176.4	-170.6	0	0	0	0	112.9	G25 K26 G31	G25-S29 WeakPolarHBondContact O-CB 3.26Å; G25-S29 PolarHBondContact O-N 2.92Å; K26-S29 PolarHBondContact O-N 3.32Å; S29-G31 PolarHBondContact O-N 2.95Å
30	E	86.9	Confident	88.9	Confident	124 Å²	124	61.3 Å²	61.3	58%	0.579	35%	0.351	S	S	*	.	T	Hydrogen-bonded Turn	trans	-76.9	-2	173.1	-69.5	-176.1	-171.3	0	0	112.7	K26 L28 Y32	K26-E30 PolarHBondContact O-N 3.34Å; L28-E30 VanDerWaalsContact C-N 3.35Å; E30-Y32 PolarHBondContact O-N 3.34Å
31	G	83.5	Confident	88.5	Confident	21 Å²	21	64.9 Å²	64.9	22%	0.216	36%	0.362	C	S	.	.	T	Hydrogen-bonded Turn	trans	76.5	-6.7	179.3	0	0	0	0	0	114.5	L27 L28 S29 I33 L34 T35	L27-G31 PolarHBondContact O-N 3.16Å; L28-G31 WeakPolarHBondContact O-CA 3.44Å; L28-G31 PolarHBondContact O-N 3.39Å; S29-G31 PolarHBondContact O-N 2.95Å; G31-I33 VanDerWaalsContact C-N 3.31Å; G31-I33 PolarHBondContact O-N 3.3Å; G31-L34 WeakPolarHBondContact O-CA 3.03Å; G31-L34 WeakPolarHBondContact O-CB 3.48Å; G31-L34 PolarHBondContact O-N 3.38Å; G31-T35 PolarHBondContact O-N 3.47Å; G31-T35 PolarHBondContact O-OG1 3.31Å
32	Y	86.7	Confident	88	Confident	124 Å²	124	68.9 Å²	68.9	49%	0.486	39%	0.388	S	S	.	.	H	α-helix	trans	-51.1	-46.3	-176	179.1	-97.7	0	0	0	113.2	L27 E30 L34 T35 K36	L27-Y32 HydrophobicContact CD2-CD1 4.21Å; L27-Y32 PolarHBondContact O-N 3.13Å; E30-Y32 PolarHBondContact O-N 3.34Å; Y32-L34 VanDerWaalsContact C-N 3.34Å; Y32-T35 PolarHBondContact O-N 2.95Å; Y32-K36 HydrophobicContact CE1-CG 4.12Å; Y32-K36 HydrophobicContact CE2-CG 4.42Å; Y32-K36 WeakPolarHBondContact O-CG 3.29Å; Y32-K36 PolarHBondContact O-N 3.38Å; Y32-K36 VanDerWaalsContact OH-CE 3.28Å; Y32-K36 WeakPolarHBondContact OH-CE 3.38Å
33	I	84.7	Confident	87.7	Confident	24 Å²	24	73.4 Å²	73.4	12%	0.123	41%	0.407	C	S	.	.	H	α-helix	trans	-64.5	-42	178.5	-61.7	-165.8	0	0	0	110.9	Y24 L27 G31 K36 L37	Y24-I33 HydrophobicContact CD1-CD1 4.36Å; Y24-I33 HydrophobicContact CD2-CD1 3.42Å; Y24-I33 VanDerWaalsContact CD2-CD1 3.42Å; Y24-I33 HydrophobicContact CE1-CD1 4.23Å; Y24-I33 HydrophobicContact CE2-CD1 3.28Å; Y24-I33 HydrophobicContact CG-CD1 3.98Å; L27-I33 HydrophobicContact CB-CD1 3.94Å; L27-I33 HydrophobicContact CB-CG1 3.81Å; L27-I33 PolarHBondContact O-N 2.92Å; G31-I33 VanDerWaalsContact C-N 3.31Å; G31-I33 PolarHBondContact O-N 3.3Å; I33-K36 PolarHBondContact O-N 3.37Å; I33-L37 HydrophobicContact CG2-CD1 4.06Å; I33-L37 WeakPolarHBondContact O-CB 3.38Å; I33-L37 PolarHBondContact O-N 3.21Å
34	L	85.3	Confident	87.4	Confident	53 Å²	53	73.6 Å²	73.6	28%	0.277	41%	0.413	S	S	.	.	H	α-helix	trans	-65.2	-44	179.9	-174.8	64.6	0	0	0	110.9	G31 Y32 K36 L37 L38 L49 V50	G31-L34 WeakPolarHBondContact O-CA 3.03Å; G31-L34 WeakPolarHBondContact O-CB 3.48Å; G31-L34 PolarHBondContact O-N 3.38Å; Y32-L34 VanDerWaalsContact C-N 3.34Å; L34-K36 VanDerWaalsContact C-N 3.33Å; L34-K36 PolarHBondContact O-N 2.94Å; L34-L37 PolarHBondContact O-N 2.99Å; L34-L38 HydrophobicContact CD1-CD1 3.67Å; L34-L38 HydrophobicContact CG-CD1 3.76Å; L34-L38 WeakPolarHBondContact O-CD1 3.31Å; L34-L38 PolarHBondContact O-N 3.42Å; L34-L49 HydrophobicContact CD1-CB 3.96Å; L34-V50 HydrophobicContact CD1-CB 4.49Å; L34-V50 HydrophobicContact CD1-CG2 3.58Å; L34-V50 HydrophobicContact CD2-CG2 3.68Å; L34-V50 HydrophobicContact CG-CG2 4.29Å
35	T	87.4	Confident	87.2	Confident	96 Å²	96	76.1 Å²	76.1	59%	0.589	43%	0.431	S	S	*	.	H	α-helix	trans	-62.6	-41	177.2	-16.8	0	0	0	0	111.5	G31 Y32 A39	G31-T35 PolarHBondContact O-N 3.47Å; G31-T35 PolarHBondContact O-OG1 3.31Å; Y32-T35 PolarHBondContact O-N 2.95Å; T35-A39 WeakPolarHBondContact O-CB 3.3Å; T35-A39 PolarHBondContact O-N 2.94Å
36	K	88.3	Confident	87.1	Confident	126 Å²	126	81.2 Å²	81.2	55%	0.548	44%	0.443	S	S	.	.	H	α-helix	trans	-65.5	-40.6	175.6	-75.4	-70	-173.8	-178.6	0	112.3	Y32 I33 L34 A39 C40	Y32-K36 HydrophobicContact CE1-CG 4.12Å; Y32-K36 HydrophobicContact CE2-CG 4.42Å; Y32-K36 WeakPolarHBondContact O-CG 3.29Å; Y32-K36 PolarHBondContact O-N 3.38Å; Y32-K36 VanDerWaalsContact OH-CE 3.28Å; Y32-K36 WeakPolarHBondContact OH-CE 3.38Å; I33-K36 PolarHBondContact O-N 3.37Å; L34-K36 VanDerWaalsContact C-N 3.33Å; L34-K36 PolarHBondContact O-N 2.94Å; K36-A39 PolarHBondContact O-N 2.87Å; K36-C40 PolarHBondContact O-N 3.37Å; K36-C40 VanDerWaalsContact O-N 3.07Å
37	L	85.8	Confident	87	Confident	42 Å²	42	83.6 Å²	83.6	22%	0.22	46%	0.46	C	S	.	.	H	α-helix	trans	-65	-45.2	175.7	-93.8	163	0	0	0	112	I33 L34 A39 C40 F41 L49 S53	I33-L37 HydrophobicContact CG2-CD1 4.06Å; I33-L37 WeakPolarHBondContact O-CB 3.38Å; I33-L37 PolarHBondContact O-N 3.21Å; L34-L37 PolarHBondContact O-N 2.99Å; L37-A39 VanDerWaalsContact C-N 3.27Å; L37-A39 PolarHBondContact O-N 3.5Å; L37-C40 PolarHBondContact O-N 3.31Å; L37-F41 HydrophobicContact CD2-CD2 3.91Å; L37-F41 HydrophobicContact CD2-CE2 3.97Å; L37-F41 PolarHBondContact O-N 2.92Å; L37-L49 HydrophobicContact CB-CD1 4.33Å; L37-L49 HydrophobicContact CB-CD2 4.25Å; L37-L49 HydrophobicContact CD2-CD2 4.06Å; L37-S53 WeakPolarHBondContact CD1-OG 3.23Å
38	L	87.8	Confident	87	Confident	51 Å²	51	88.8 Å²	88.8	27%	0.267	48%	0.481	S	S	.	.	H	α-helix	trans	-61	-37.3	174.5	-94.5	88.5	0	0	0	111.9	L34 C40 F41 P42 K46 L49	L34-L38 HydrophobicContact CD1-CD1 3.67Å; L34-L38 HydrophobicContact CG-CD1 3.76Å; L34-L38 WeakPolarHBondContact O-CD1 3.31Å; L34-L38 PolarHBondContact O-N 3.42Å; L38-C40 VanDerWaalsContact C-N 3.32Å; L38-C40 PolarHBondContact O-N 2.93Å; L38-F41 CarbonylContact O-C 3.42Å; L38-F41 PolarHBondContact O-N 3.43Å; L38-P42 VanDerWaalsContact O-CA 3.3Å; L38-P42 WeakPolarHBondContact O-CA 3.21Å; L38-P42 VanDerWaalsContact O-N 3.16Å; L38-K46 HydrophobicContact CD2-CD 4.26Å; L38-K46 HydrophobicContact CD2-CG 4.12Å; L38-L49 HydrophobicContact CD1-CD1 3.65Å; L38-L49 HydrophobicContact CG-CD1 3.91Å
39	A	89.2	Confident	86.9	Confident	81 Å²	81	88.2 Å²	88.2	67%	0.669	48%	0.478	S	S	*	.	H	α-helix	trans	-66.6	-34	176.7	0	0	0	0	0	112.7	T35 K36 L37	T35-A39 WeakPolarHBondContact O-CB 3.3Å; T35-A39 PolarHBondContact O-N 2.94Å; K36-A39 PolarHBondContact O-N 2.87Å; L37-A39 VanDerWaalsContact C-N 3.27Å; L37-A39 PolarHBondContact O-N 3.5Å
40	C	88.5	Confident	87	Confident	86 Å²	86	85.7 Å²	85.7	58%	0.581	46%	0.458	S	S	*	.	H	α-helix	trans	-78.7	-30.8	176.5	-166.9	0	0	0	0	112.6	K36 L37 L38	K36-C40 PolarHBondContact O-N 3.37Å; K36-C40 VanDerWaalsContact O-N 3.07Å; L37-C40 PolarHBondContact O-N 3.31Å; L38-C40 VanDerWaalsContact C-N 3.32Å; L38-C40 PolarHBondContact O-N 2.93Å
41	F	87.3	Confident	87.1	Confident	108 Å²	108	87.2 Å²	87.2	47%	0.474	46%	0.463	S	S	.	.			trans	-131.9	74.2	-176.7	-55.8	-74.8	0	0	0	110.3	L37 L38 D43 A44	L37-F41 HydrophobicContact CD2-CD2 3.91Å; L37-F41 HydrophobicContact CD2-CE2 3.97Å; L37-F41 PolarHBondContact O-N 2.92Å; L38-F41 CarbonylContact O-C 3.42Å; L38-F41 PolarHBondContact O-N 3.43Å; F41-D43 VanDerWaalsContact C-N 3.27Å; F41-D43 PolarHBondContact O-N 2.92Å; F41-A44 HydrophobicContact CB-CB 3.71Å; F41-A44 WeakPolarHBondContact O-CB 3.49Å; F41-A44 PolarHBondContact O-N 3.34Å
42	P	82	Confident	87.4	Confident	100 Å²	100	88.9 Å²	88.9	65%	0.649	47%	0.472	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.9	-31.8	-175.2	23.1	-32.4	0	0	0	113.1	L38 A44	L38-P42 VanDerWaalsContact O-CA 3.3Å; L38-P42 WeakPolarHBondContact O-CA 3.21Å; L38-P42 VanDerWaalsContact O-N 3.16Å; P42-A44 VanDerWaalsContact C-N 3.34Å
43	D	87.2	Confident	87.5	Confident	164 Å²	164	83.1 Å²	83.1	88%	0.877	45%	0.45	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86	-3.7	-179.5	-58.3	-54.6	0	0	0	113.6	F41	F41-D43 VanDerWaalsContact C-N 3.27Å; F41-D43 PolarHBondContact O-N 2.92Å
44	A	84.9	Confident	87.8	Confident	35 Å²	35	88.3 Å²	88.3	29%	0.289	47%	0.469	S	S	.	.	S	Bend	trans	-75.4	146.6	-177.9	0	0	0	0	0	112.1	F41 P42 K46 L49	F41-A44 HydrophobicContact CB-CB 3.71Å; F41-A44 WeakPolarHBondContact O-CB 3.49Å; F41-A44 PolarHBondContact O-N 3.34Å; P42-A44 VanDerWaalsContact C-N 3.34Å; A44-K46 PolarHBondContact O-N 3.49Å; A44-L49 HydrophobicContact CB-CD1 3.98Å; A44-L49 HydrophobicContact CB-CD2 4.18Å; A44-L49 HydrophobicContact CB-CG 4.03Å
45	N	89.7	Confident	88	Confident	105 Å²	105	87 Å²	87	56%	0.561	47%	0.469	S	S	*	.			trans	-64.6	121.1	175.9	-174.8	-15.6	0	0	0	110.3	N47 F48 L49	N45-N47 VanDerWaalsContact C-N 3.26Å; N45-N47 PolarHBondContact O-N 2.86Å; N45-N47 PolarHBondContact OD1-N 3.48Å; N45-N47 VanDerWaalsContact OD1-N 3.07Å; N45-F48 HydrophobicContact CB-CB 4.07Å; N45-F48 WeakPolarHBondContact O-CA 3.27Å; N45-F48 WeakPolarHBondContact O-CB 3.31Å; N45-F48 PolarHBondContact O-N 3.36Å; N45-L49 PolarHBondContact O-N 2.97Å
46	K	86.7	Confident	88.1	Confident	138 Å²	138	83.7 Å²	83.7	60%	0.6	45%	0.453	S	S	*	.	H	α-helix	trans	-53.3	-42.4	179.7	-62.5	-174.6	-178.4	177.7	0	112.4	L38 A44 F48 L49 V50	L38-K46 HydrophobicContact CD2-CD 4.26Å; L38-K46 HydrophobicContact CD2-CG 4.12Å; A44-K46 PolarHBondContact O-N 3.49Å; K46-F48 VanDerWaalsContact C-N 3.27Å; K46-F48 PolarHBondContact O-N 2.95Å; K46-L49 PolarHBondContact O-N 3.28Å; K46-V50 VanDerWaalsContact O-CG2 3.3Å; K46-V50 WeakPolarHBondContact O-CG2 3.12Å; K46-V50 PolarHBondContact O-N 3.48Å
47	N	88.8	Confident	88.2	Confident	126 Å²	126	78.6 Å²	78.6	67%	0.674	44%	0.435	S	S	*	.	H	α-helix	trans	-63.5	-37.1	179.5	-69	-19.7	0	0	0	111.5	N45 F51	N45-N47 VanDerWaalsContact C-N 3.26Å; N45-N47 PolarHBondContact O-N 2.86Å; N45-N47 PolarHBondContact OD1-N 3.48Å; N45-N47 VanDerWaalsContact OD1-N 3.07Å; N47-F51 VanDerWaalsContact O-CB 3.3Å; N47-F51 WeakPolarHBondContact O-CB 3.49Å; N47-F51 PolarHBondContact O-N 2.86Å
48	F	89.7	Confident	88.6	Confident	136 Å²	136	81.9 Å²	81.9	60%	0.596	45%	0.451	S	S	*	.	H	α-helix	trans	-68.3	-42.9	176.7	-177.5	-99.3	0	0	0	111.6	N45 K46 F51 S52	N45-F48 HydrophobicContact CB-CB 4.07Å; N45-F48 WeakPolarHBondContact O-CA 3.27Å; N45-F48 WeakPolarHBondContact O-CB 3.31Å; N45-F48 PolarHBondContact O-N 3.36Å; K46-F48 VanDerWaalsContact C-N 3.27Å; K46-F48 PolarHBondContact O-N 2.95Å; F48-F51 PolarHBondContact O-N 2.8Å; F48-S52 VanDerWaalsContact O-CB 3.25Å; F48-S52 WeakPolarHBondContact O-CB 3.4Å; F48-S52 PolarHBondContact O-N 3.19Å
49	L	88.7	Confident	88.8	Confident	9 Å²	9	83.9 Å²	83.9	5%	0.047	47%	0.466	C	S	.	.	H	α-helix	trans	-63	-42.5	176.3	-69.6	179.7	0	0	0	112.2	L34 L37 L38 A44 N45 K46 S52 S53	L34-L49 HydrophobicContact CD1-CB 3.96Å; L37-L49 HydrophobicContact CB-CD1 4.33Å; L37-L49 HydrophobicContact CB-CD2 4.25Å; L37-L49 HydrophobicContact CD2-CD2 4.06Å; L38-L49 HydrophobicContact CD1-CD1 3.65Å; L38-L49 HydrophobicContact CG-CD1 3.91Å; A44-L49 HydrophobicContact CB-CD1 3.98Å; A44-L49 HydrophobicContact CB-CD2 4.18Å; A44-L49 HydrophobicContact CB-CG 4.03Å; N45-L49 PolarHBondContact O-N 2.97Å; K46-L49 PolarHBondContact O-N 3.28Å; L49-S52 PolarHBondContact O-N 3.4Å; L49-S53 WeakPolarHBondContact O-CB 3.39Å; L49-S53 PolarHBondContact O-N 2.91Å; L49-S53 PolarHBondContact O-OG 3.29Å
50	V	87.9	Confident	89	Confident	50 Å²	50	83.1 Å²	83.1	30%	0.303	45%	0.45	S	S	.	.	H	α-helix	trans	-60	-51.3	174.4	172.7	0	0	0	0	110.1	L34 K46 S52 S53 Y54	L34-V50 HydrophobicContact CD1-CB 4.49Å; L34-V50 HydrophobicContact CD1-CG2 3.58Å; L34-V50 HydrophobicContact CD2-CG2 3.68Å; L34-V50 HydrophobicContact CG-CG2 4.29Å; K46-V50 VanDerWaalsContact O-CG2 3.3Å; K46-V50 WeakPolarHBondContact O-CG2 3.12Å; K46-V50 PolarHBondContact O-N 3.48Å; V50-S52 VanDerWaalsContact C-N 3.34Å; V50-S52 PolarHBondContact O-N 3.38Å; V50-S53 PolarHBondContact O-N 3.49Å; V50-S53 VanDerWaalsContact O-N 3.15Å; V50-Y54 HydrophobicContact CG1-CD2 3.71Å; V50-Y54 HydrophobicContact CG1-CE2 3.57Å; V50-Y54 VanDerWaalsContact O-CD2 3.26Å; V50-Y54 WeakPolarHBondContact O-CD2 3.32Å; V50-Y54 PolarHBondContact O-N 2.88Å
51	F	89.9	Confident	89.2	Confident	156 Å²	156	83 Å²	83	68%	0.684	44%	0.443	S	S	*	.	H	α-helix	trans	-59.9	-43.9	179.9	-172.2	-95.2	0	0	0	112.2	N47 F48 S53 Y54 G55	N47-F51 VanDerWaalsContact O-CB 3.3Å; N47-F51 WeakPolarHBondContact O-CB 3.49Å; N47-F51 PolarHBondContact O-N 2.86Å; F48-F51 PolarHBondContact O-N 2.8Å; F51-S53 VanDerWaalsContact C-N 3.33Å; F51-S53 PolarHBondContact O-N 2.94Å; F51-Y54 PolarHBondContact O-N 3.34Å; F51-G55 PolarHBondContact O-N 3.15Å
52	S	89.1	Confident	89.5	Confident	57 Å²	57	81.4 Å²	81.4	40%	0.399	44%	0.442	S	S	.	.	H	α-helix	trans	-59.2	-42.8	175.1	165.2	0	0	0	0	112.1	F48 L49 V50 G55 G56	F48-S52 VanDerWaalsContact O-CB 3.25Å; F48-S52 WeakPolarHBondContact O-CB 3.4Å; F48-S52 PolarHBondContact O-N 3.19Å; L49-S52 PolarHBondContact O-N 3.4Å; V50-S52 VanDerWaalsContact C-N 3.34Å; V50-S52 PolarHBondContact O-N 3.38Å; S52-G55 WeakPolarHBondContact O-CA 3.33Å; S52-G55 PolarHBondContact O-N 3.22Å; S52-G56 PolarHBondContact O-N 3.28Å
53	S	89.6	Confident	90.1	Very high	3 Å²	3	80.1 Å²	80.1	2%	0.021	43%	0.432	C	S	.	.	H	α-helix	trans	-65.7	-45.7	-179.5	-54.1	0	0	0	0	111	Y24 L28 L37 L49 V50 F51 G55 G56 A57	Y24-S53 WeakPolarHBondContact CE1-O 3.41Å; Y24-S53 PolarHBondContact OH-O 2.71Å; L28-S53 VanDerWaalsContact CD1-C 3.5Å; L28-S53 VanDerWaalsContact CD1-CB 3.44Å; L37-S53 WeakPolarHBondContact CD1-OG 3.23Å; L49-S53 WeakPolarHBondContact O-CB 3.39Å; L49-S53 PolarHBondContact O-N 2.91Å; L49-S53 PolarHBondContact O-OG 3.29Å; V50-S53 PolarHBondContact O-N 3.49Å; V50-S53 VanDerWaalsContact O-N 3.15Å; F51-S53 VanDerWaalsContact C-N 3.33Å; F51-S53 PolarHBondContact O-N 2.94Å; S53-G55 VanDerWaalsContact C-N 3.3Å; S53-G55 PolarHBondContact O-N 3.32Å; S53-G56 PolarHBondContact O-N 2.9Å; S53-A57 PolarHBondContact O-N 3.45Å; S53-A57 VanDerWaalsContact O-N 3.1Å
54	Y	89.9	Confident	90.3	Very high	132 Å²	132	73.8 Å²	73.8	52%	0.518	40%	0.398	S	S	.	.	H	α-helix	trans	-62.9	-37.3	172.6	-77.3	-71	0	0	0	112.2	L28 V50 F51 G56 A57 I58	L28-Y54 HydrophobicContact CD2-CD1 3.87Å; L28-Y54 HydrophobicContact CD2-CD2 4.45Å; L28-Y54 HydrophobicContact CD2-CE1 3.35Å; L28-Y54 HydrophobicContact CD2-CE2 4.01Å; L28-Y54 HydrophobicContact CD2-CG 4.39Å; L28-Y54 VanDerWaalsContact CD2-CZ 3.42Å; V50-Y54 HydrophobicContact CG1-CD2 3.71Å; V50-Y54 HydrophobicContact CG1-CE2 3.57Å; V50-Y54 VanDerWaalsContact O-CD2 3.26Å; V50-Y54 WeakPolarHBondContact O-CD2 3.32Å; V50-Y54 PolarHBondContact O-N 2.88Å; F51-Y54 PolarHBondContact O-N 3.34Å; Y54-G56 VanDerWaalsContact C-N 3.33Å; Y54-G56 PolarHBondContact O-N 3.12Å; Y54-A57 WeakPolarHBondContact O-CB 3.5Å; Y54-A57 PolarHBondContact O-N 3.41Å; Y54-I58 WeakPolarHBondContact O-CG1 3.45Å; Y54-I58 PolarHBondContact O-N 2.62Å
55	G	90.6	Very high	90.7	Very high	27 Å²	27	79 Å²	79	28%	0.278	41%	0.41	S	S	.	.	H	α-helix	trans	-57.7	-44.1	172.4	0	0	0	0	0	112.3	F51 S52 S53 A57 I58 V59	F51-G55 PolarHBondContact O-N 3.15Å; S52-G55 WeakPolarHBondContact O-CA 3.33Å; S52-G55 PolarHBondContact O-N 3.22Å; S53-G55 VanDerWaalsContact C-N 3.3Å; S53-G55 PolarHBondContact O-N 3.32Å; G55-A57 PolarHBondContact O-N 2.87Å; G55-I58 PolarHBondContact O-N 2.87Å; G55-V59 WeakPolarHBondContact O-CG2 3.41Å; G55-V59 PolarHBondContact O-N 3Å
56	G	89.5	Confident	91	Very high	25 Å²	25	78.2 Å²	78.2	26%	0.258	41%	0.405	S	S	.	.	H	α-helix	trans	-59.8	-43.1	174.1	0	0	0	0	0	112.9	S52 S53 Y54 I58 V59 L60	S52-G56 PolarHBondContact O-N 3.28Å; S53-G56 PolarHBondContact O-N 2.9Å; Y54-G56 VanDerWaalsContact C-N 3.33Å; Y54-G56 PolarHBondContact O-N 3.12Å; G56-I58 VanDerWaalsContact C-N 3.34Å; G56-I58 PolarHBondContact O-N 3.29Å; G56-V59 PolarHBondContact O-N 2.91Å; G56-L60 WeakPolarHBondContact O-CG 3.46Å; G56-L60 PolarHBondContact O-N 3.07Å
57	A	90.1	Very high	91.2	Very high	20 Å²	20	72.5 Å²	72.5	17%	0.165	38%	0.384	C	S	.	.	H	α-helix	trans	-61.2	-42	175.6	0	0	0	0	0	112.1	Y24 S53 Y54 G55 L60 N61	Y24-A57 HydrophobicContact CD1-CB 3.77Å; Y24-A57 HydrophobicContact CE1-CB 3.87Å; S53-A57 PolarHBondContact O-N 3.45Å; S53-A57 VanDerWaalsContact O-N 3.1Å; Y54-A57 WeakPolarHBondContact O-CB 3.5Å; Y54-A57 PolarHBondContact O-N 3.41Å; G55-A57 PolarHBondContact O-N 2.87Å; A57-L60 PolarHBondContact O-N 2.92Å; A57-N61 WeakPolarHBondContact O-CB 3.3Å; A57-N61 PolarHBondContact O-N 3.36Å
58	I	92.6	Very high	91.4	Very high	111 Å²	111	67.7 Å²	67.7	57%	0.569	36%	0.358	S	S	*	.	H	α-helix	trans	-63	-46.3	176.9	-67.3	166	0	0	0	110.5	Y54 G55 G56 L60 N61 V62	Y54-I58 WeakPolarHBondContact O-CG1 3.45Å; Y54-I58 PolarHBondContact O-N 2.62Å; G55-I58 PolarHBondContact O-N 2.87Å; G56-I58 VanDerWaalsContact C-N 3.34Å; G56-I58 PolarHBondContact O-N 3.29Å; I58-L60 PolarHBondContact O-N 3.22Å; I58-N61 WeakPolarHBondContact O-CB 3.4Å; I58-N61 PolarHBondContact O-N 3.31Å; I58-V62 HydrophobicContact CG2-CG2 4.34Å; I58-V62 WeakPolarHBondContact O-CG2 3.41Å; I58-V62 PolarHBondContact O-N 2.99Å
59	V	93.5	Very high	91.6	Very high	93 Å²	93	64 Å²	64	56%	0.564	35%	0.347	S	S	*	.	H	α-helix	trans	-59.9	-46.2	179.1	171.5	0	0	0	0	111.1	G55 G56 N61 V62 V63	G55-V59 WeakPolarHBondContact O-CG2 3.41Å; G55-V59 PolarHBondContact O-N 3Å; G56-V59 PolarHBondContact O-N 2.91Å; V59-N61 VanDerWaalsContact C-N 3.29Å; V59-N61 PolarHBondContact O-N 3.2Å; V59-V62 PolarHBondContact O-N 3.48Å; V59-V63 WeakPolarHBondContact O-CG2 3.39Å; V59-V63 PolarHBondContact O-N 3.42Å
60	L	92.4	Very high	91.8	Very high	64 Å²	64	66.4 Å²	66.4	34%	0.335	36%	0.362	S	S	.	.	H	α-helix	trans	-59.5	-41.4	176.6	-74.4	173.6	0	0	0	112	T21 Y24 G56 A57 I58 V63 M64	T21-L60 HydrophobicContact CG2-CB 4.44Å; Y24-L60 HydrophobicContact CD1-CD1 4.44Å; Y24-L60 HydrophobicContact CD2-CD1 4.14Å; Y24-L60 HydrophobicContact CG-CD1 3.96Å; G56-L60 WeakPolarHBondContact O-CG 3.46Å; G56-L60 PolarHBondContact O-N 3.07Å; A57-L60 PolarHBondContact O-N 2.92Å; I58-L60 PolarHBondContact O-N 3.22Å; L60-V63 PolarHBondContact O-N 2.96Å; L60-M64 PolarHBondContact O-N 2.81Å
61	N	93.2	Very high	91.9	Very high	84 Å²	84	64 Å²	64	45%	0.449	35%	0.347	S	S	.	.	H	α-helix	trans	-65.5	-42.4	178.1	-155.9	-49.2	0	0	0	111.9	T21 A57 I58 V59 V63 M64 W65	T21-N61 HydrophobicContact CG2-CB 3.91Å; A57-N61 WeakPolarHBondContact O-CB 3.3Å; A57-N61 PolarHBondContact O-N 3.36Å; I58-N61 WeakPolarHBondContact O-CB 3.4Å; I58-N61 PolarHBondContact O-N 3.31Å; V59-N61 VanDerWaalsContact C-N 3.29Å; V59-N61 PolarHBondContact O-N 3.2Å; N61-V63 PolarHBondContact O-N 3.23Å; N61-M64 WeakPolarHBondContact O-CB 3.31Å; N61-M64 PolarHBondContact O-N 2.84Å; N61-W65 WeakPolarHBondContact O-CB 3.34Å; N61-W65 PolarHBondContact O-N 3.16Å
62	V	94.4	Very high	92	Very high	74 Å²	74	58.8 Å²	58.8	45%	0.448	33%	0.326	S	S	.	.	H	α-helix	trans	-61.3	-44.4	175.1	171.4	0	0	0	0	111.1	I58 V59 M64 W65 L66	I58-V62 HydrophobicContact CG2-CG2 4.34Å; I58-V62 WeakPolarHBondContact O-CG2 3.41Å; I58-V62 PolarHBondContact O-N 2.99Å; V59-V62 PolarHBondContact O-N 3.48Å; V62-M64 PolarHBondContact O-N 3.02Å; V62-W65 PolarHBondContact O-N 3.05Å; V62-L66 HydrophobicContact CG1-CD1 3.93Å; V62-L66 HydrophobicContact CG1-CG 4.3Å; V62-L66 WeakPolarHBondContact O-CG 3.14Å; V62-L66 PolarHBondContact O-N 3.39Å
63	V	92.9	Very high	92	Very high	73 Å²	73	60.3 Å²	60.3	44%	0.442	34%	0.337	S	S	.	.	H	α-helix	trans	-61.5	-45.3	177.4	171.6	0	0	0	0	111.2	V59 L60 N61 W65 L66 A67	V59-V63 WeakPolarHBondContact O-CG2 3.39Å; V59-V63 PolarHBondContact O-N 3.42Å; L60-V63 PolarHBondContact O-N 2.96Å; N61-V63 PolarHBondContact O-N 3.23Å; V63-W65 VanDerWaalsContact C-N 3.32Å; V63-W65 PolarHBondContact O-N 2.93Å; V63-L66 PolarHBondContact O-N 2.86Å; V63-A67 WeakPolarHBondContact O-CB 3.36Å; V63-A67 PolarHBondContact O-N 2.87Å
64	M	92.6	Very high	91.9	Very high	32 Å²	32	62.7 Å²	62.7	16%	0.158	35%	0.349	C	S	.	.	H	α-helix	trans	-56.5	-47.5	174.9	-179.6	-140.1	88.6	0	0	111.4	S14 C17 A18 L60 N61 V62 A67 L68	S14-M64 WeakPolarHBondContact O-CG 3.43Å; S14-M64 PolarHBondContact OG-O 2.82Å; C17-M64 HydrophobicContact CB-CB 3.96Å; C17-M64 HydrophobicContact CB-CG 4.26Å; A18-M64 HydrophobicContact CB-CG 3.68Å; A18-M64 HydrophobicContact CB-SD 3.38Å; A18-M64 WeakPolarHBondContact CB-SD 3.3Å; L60-M64 PolarHBondContact O-N 2.81Å; N61-M64 WeakPolarHBondContact O-CB 3.31Å; N61-M64 PolarHBondContact O-N 2.84Å; V62-M64 PolarHBondContact O-N 3.02Å; M64-A67 PolarHBondContact O-N 3.21Å; M64-L68 PolarHBondContact O-N 3.01Å
65	W	93.6	Very high	91.7	Very high	144 Å²	144	56.9 Å²	56.9	55%	0.545	33%	0.328	S	S	.	.	H	α-helix	trans	-65.1	-45.1	-177.9	-175.2	84.5	0	0	0	112	N61 V62 V63 A67 L68 V69	N61-W65 WeakPolarHBondContact O-CB 3.34Å; N61-W65 PolarHBondContact O-N 3.16Å; V62-W65 PolarHBondContact O-N 3.05Å; V63-W65 VanDerWaalsContact C-N 3.32Å; V63-W65 PolarHBondContact O-N 2.93Å; W65-A67 VanDerWaalsContact C-N 3.32Å; W65-A67 PolarHBondContact O-N 3.4Å; W65-L68 PolarHBondContact O-N 3.41Å; W65-L68 VanDerWaalsContact O-N 3.14Å; W65-V69 HydrophobicContact CD2-CG2 3.81Å; W65-V69 HydrophobicContact CE3-CG2 4.07Å; W65-V69 HydrophobicContact CG-CG2 4.47Å; W65-V69 HydrophobicContact CH2-CG2 3.88Å; W65-V69 HydrophobicContact CZ2-CG2 3.6Å; W65-V69 HydrophobicContact CZ3-CG2 4.1Å; W65-V69 WeakPolarHBondContact O-CG2 3.43Å; W65-V69 PolarHBondContact O-N 3.36Å
66	L	94.4	Very high	91.2	Very high	88 Å²	88	62.9 Å²	62.9	46%	0.461	35%	0.349	S	S	.	.	H	α-helix	trans	-60.9	-42	176.5	-71.2	173.7	0	0	0	111.7	V62 V63 L68 V69 T70	V62-L66 HydrophobicContact CG1-CD1 3.93Å; V62-L66 HydrophobicContact CG1-CG 4.3Å; V62-L66 WeakPolarHBondContact O-CG 3.14Å; V62-L66 PolarHBondContact O-N 3.39Å; V63-L66 PolarHBondContact O-N 2.86Å; L66-L68 VanDerWaalsContact C-N 3.33Å; L66-L68 PolarHBondContact O-N 3.33Å; L66-V69 PolarHBondContact O-N 3.08Å; L66-T70 VanDerWaalsContact O-CB 3.31Å; L66-T70 WeakPolarHBondContact O-CB 3.42Å; L66-T70 PolarHBondContact O-N 3.39Å; L66-T70 PolarHBondContact O-OG1 3.48Å
67	A	91.7	Very high	91.1	Very high	19 Å²	19	64 Å²	64	16%	0.157	35%	0.347	C	S	.	.	H	α-helix	trans	-63.1	-40	175.4	0	0	0	0	0	111.6	V63 M64 W65 A71	V63-A67 WeakPolarHBondContact O-CB 3.36Å; V63-A67 PolarHBondContact O-N 2.87Å; M64-A67 PolarHBondContact O-N 3.21Å; W65-A67 VanDerWaalsContact C-N 3.32Å; W65-A67 PolarHBondContact O-N 3.4Å; A67-A71 WeakPolarHBondContact O-CB 3.49Å; A67-A71 PolarHBondContact O-N 2.9Å
68	L	93.5	Very high	91.1	Very high	24 Å²	24	66 Å²	66	13%	0.126	36%	0.359	C	S	.	.	H	α-helix	trans	-66.1	-48.9	176.9	-176.1	55.9	0	0	0	111.8	S14 M64 W65 L66 T70 A71 L72 N85	S14-L68 WeakPolarHBondContact OG-CB 3.39Å; S14-L68 PolarHBondContact OG-N 3.2Å; M64-L68 PolarHBondContact O-N 3.01Å; W65-L68 PolarHBondContact O-N 3.41Å; W65-L68 VanDerWaalsContact O-N 3.14Å; L66-L68 VanDerWaalsContact C-N 3.33Å; L66-L68 PolarHBondContact O-N 3.33Å; L68-T70 VanDerWaalsContact C-N 3.25Å; L68-T70 PolarHBondContact O-N 3.27Å; L68-A71 WeakPolarHBondContact O-CA 3.48Å; L68-A71 WeakPolarHBondContact O-CB 3.23Å; L68-A71 PolarHBondContact O-N 2.86Å; L68-L72 HydrophobicContact CD1-CD1 4.38Å; L68-L72 HydrophobicContact CD1-CG 4.26Å; L68-L72 HydrophobicContact CG-CD1 4.09Å; L68-L72 HydrophobicContact CG-CG 4.41Å; L68-L72 VanDerWaalsContact O-CG 3.31Å; L68-L72 WeakPolarHBondContact O-CG 3.41Å; L68-L72 PolarHBondContact O-N 2.8Å; L68-N85 HydrophobicContact CD1-CB 3.84Å
69	V	94	Very high	91	Very high	59 Å²	59	65.3 Å²	65.3	36%	0.358	36%	0.36	S	S	.	.	H	α-helix	trans	-59.3	-41.8	179	171.4	0	0	0	0	110.6	W65 L66 A71 L72 S73	W65-V69 HydrophobicContact CD2-CG2 3.81Å; W65-V69 HydrophobicContact CE3-CG2 4.07Å; W65-V69 HydrophobicContact CG-CG2 4.47Å; W65-V69 HydrophobicContact CH2-CG2 3.88Å; W65-V69 HydrophobicContact CZ2-CG2 3.6Å; W65-V69 HydrophobicContact CZ3-CG2 4.1Å; W65-V69 WeakPolarHBondContact O-CG2 3.43Å; W65-V69 PolarHBondContact O-N 3.36Å; L66-V69 PolarHBondContact O-N 3.08Å; V69-A71 VanDerWaalsContact C-N 3.34Å; V69-L72 PolarHBondContact O-N 3.27Å; V69-S73 PolarHBondContact O-N 2.97Å; V69-S73 PolarHBondContact O-OG 3.39Å
70	T	91.6	Very high	90.8	Very high	59 Å²	59	61 Å²	61	36%	0.362	33%	0.334	S	S	.	.	H	α-helix	trans	-66.1	-37.5	176	-53.1	0	0	0	0	111.4	L10 L66 L68 S73 I74	L10-T70 HydrophobicContact CD2-CG2 3.43Å; L10-T70 VanDerWaalsContact CD2-CG2 3.43Å; L66-T70 VanDerWaalsContact O-CB 3.31Å; L66-T70 WeakPolarHBondContact O-CB 3.42Å; L66-T70 PolarHBondContact O-N 3.39Å; L66-T70 PolarHBondContact O-OG1 3.48Å; L68-T70 VanDerWaalsContact C-N 3.25Å; L68-T70 PolarHBondContact O-N 3.27Å; T70-S73 PolarHBondContact O-OG 2.95Å; T70-S73 VanDerWaalsContact O-OG 3.07Å; T70-I74 HydrophobicContact CG2-CD1 3.62Å; T70-I74 HydrophobicContact CG2-CG1 4.45Å; T70-I74 WeakPolarHBondContact O-CB 3.35Å; T70-I74 WeakPolarHBondContact O-CD1 3.39Å; T70-I74 VanDerWaalsContact O-CG1 3.23Å; T70-I74 WeakPolarHBondContact O-CG1 3.34Å; T70-I74 PolarHBondContact O-N 2.92Å
71	A	90.6	Very high	90.8	Very high	0 Å²	0	57.9 Å²	57.9	0%	0	32%	0.318	C	S	.	.	H	α-helix	trans	-63.9	-42.9	174.6	0	0	0	0	0	111.1	L10 A11 A67 L68 V69 S75	L10-A71 HydrophobicContact CB-CB 3.96Å; L10-A71 HydrophobicContact CD2-CB 4.31Å; A11-A71 HydrophobicContact CB-CB 4.1Å; A67-A71 WeakPolarHBondContact O-CB 3.49Å; A67-A71 PolarHBondContact O-N 2.9Å; L68-A71 WeakPolarHBondContact O-CA 3.48Å; L68-A71 WeakPolarHBondContact O-CB 3.23Å; L68-A71 PolarHBondContact O-N 2.86Å; V69-A71 VanDerWaalsContact C-N 3.34Å; A71-S75 WeakPolarHBondContact O-CB 3.49Å; A71-S75 PolarHBondContact O-N 3.06Å; A71-S75 PolarHBondContact O-OG 3.14Å
72	L	91.9	Very high	90.8	Very high	46 Å²	46	57.9 Å²	57.9	24%	0.241	32%	0.317	C	S	.	.	H	α-helix	trans	-68.2	-36.4	-179.5	-67.1	171.9	0	0	0	112.8	L68 V69 S78 A81 L82	L68-L72 HydrophobicContact CD1-CD1 4.38Å; L68-L72 HydrophobicContact CD1-CG 4.26Å; L68-L72 HydrophobicContact CG-CD1 4.09Å; L68-L72 HydrophobicContact CG-CG 4.41Å; L68-L72 VanDerWaalsContact O-CG 3.31Å; L68-L72 WeakPolarHBondContact O-CG 3.41Å; L68-L72 PolarHBondContact O-N 2.8Å; V69-L72 PolarHBondContact O-N 3.27Å; L72-S78 VanDerWaalsContact CD2-O 3.31Å; L72-S78 WeakPolarHBondContact CD2-O 3.1Å; L72-A81 HydrophobicContact CD2-CB 4.31Å; L72-L82 HydrophobicContact CD1-CD1 4.37Å; L72-L82 HydrophobicContact CD2-CB 4.17Å; L72-L82 HydrophobicContact CD2-CD1 4.25Å
73	S	89.5	Confident	90.8	Very high	90 Å²	90	55.4 Å²	55.4	63%	0.629	31%	0.305	S	S	*	.	H	α-helix	trans	-74.2	-31.1	-179.8	67.1	0	0	0	0	113.1	V69 T70	V69-S73 PolarHBondContact O-N 2.97Å; V69-S73 PolarHBondContact O-OG 3.39Å; T70-S73 PolarHBondContact O-OG 2.95Å; T70-S73 VanDerWaalsContact O-OG 3.07Å
74	I	87.9	Confident	90.8	Very high	52 Å²	52	52.8 Å²	52.8	27%	0.267	29%	0.289	S	S	.	.	H	α-helix	trans	-89.5	-26.2	-178.1	-63.4	175.3	0	0	0	111.5	S3 T70	S3-I74 WeakPolarHBondContact O-CG2 3.44Å; S3-I74 WeakPolarHBondContact OG-CG2 3.29Å; T70-I74 HydrophobicContact CG2-CD1 3.62Å; T70-I74 HydrophobicContact CG2-CG1 4.45Å; T70-I74 WeakPolarHBondContact O-CB 3.35Å; T70-I74 WeakPolarHBondContact O-CD1 3.39Å; T70-I74 VanDerWaalsContact O-CG1 3.23Å; T70-I74 WeakPolarHBondContact O-CG1 3.34Å; T70-I74 PolarHBondContact O-N 2.92Å
75	S	85.2	Confident	90.9	Very high	11 Å²	11	51.8 Å²	51.8	8%	0.077	28%	0.284	C	S	.	.			trans	-78.8	133.7	-177	-63.3	0	0	0	0	112.3	G7 A71 K77 A81	G7-S75 VanDerWaalsContact CA-OG 3.26Å; G7-S75 WeakPolarHBondContact CA-OG 3.35Å; A71-S75 WeakPolarHBondContact O-CB 3.49Å; A71-S75 PolarHBondContact O-N 3.06Å; A71-S75 PolarHBondContact O-OG 3.14Å; S75-K77 VanDerWaalsContact C-N 3.28Å; S75-K77 PolarHBondContact O-N 2.93Å; S75-A81 WeakPolarHBondContact OG-CB 3.42Å
76	Q	80.9	Confident	91	Very high	153 Å²	153	47.4 Å²	47.4	72%	0.715	27%	0.273	S	S	*	.	S	Bend	trans	-65.6	-31.7	176.8	-158.3	178.4	-11.1	0	0	112.7	N4	N4-Q76 PolarHBondContact ND2-OE1 3.48Å
77	K	85.9	Confident	91	Very high	49 Å²	49	45.1 Å²	45.1	21%	0.213	26%	0.261	C	S	.	.			trans	-118.5	98.1	173	-57.7	-148.6	-155.4	93.5	0	110.5	S75 V79 A80 A81 L123 V124 E126	S75-K77 VanDerWaalsContact C-N 3.28Å; S75-K77 PolarHBondContact O-N 2.93Å; K77-V79 PolarHBondContact O-N 3.38Å; K77-A80 HydrophobicContact CB-CB 3.87Å; K77-A80 PolarHBondContact O-N 3.35Å; K77-A80 VanDerWaalsContact O-N 3.15Å; K77-A81 PolarHBondContact O-N 3.03Å; K77-A81 VanDerWaalsContact O-N 3.12Å; K77-L123 PolarHBondContact NZ-O 3.15Å; K77-V124 PolarHBondContact NZ-O 3.04Å; K77-E126 WeakPolarHBondContact CE-O 3.3Å; K77-E126 PolarHBondContact NZ-O 3.23Å
78	S	89.8	Confident	91.2	Very high	61 Å²	61	44.7 Å²	44.7	43%	0.427	26%	0.257	S	S	.	.	H	α-helix	trans	-59	-36.6	-180	-46	0	0	0	0	112.1	L72 A81 L82	L72-S78 VanDerWaalsContact CD2-O 3.31Å; L72-S78 WeakPolarHBondContact CD2-O 3.1Å; S78-A81 PolarHBondContact O-N 2.71Å; S78-L82 WeakPolarHBondContact O-CB 3.43Å; S78-L82 PolarHBondContact O-N 2.97Å
79	V	90.7	Very high	91.3	Very high	97 Å²	97	45 Å²	45	59%	0.588	26%	0.259	S	S	*	.	H	α-helix	trans	-62	-44.8	176.8	179.6	0	0	0	0	111.5	K77 A81 L82 A83 L123	K77-V79 PolarHBondContact O-N 3.38Å; V79-A81 PolarHBondContact O-N 2.87Å; V79-L82 PolarHBondContact O-N 3.49Å; V79-A83 WeakPolarHBondContact O-CB 3.33Å; V79-A83 PolarHBondContact O-N 3.38Å; V79-L123 HydrophobicContact CG1-CD1 4.19Å; V79-L123 HydrophobicContact CG1-CD2 4.22Å
80	A	90.9	Very high	91.4	Very high	1 Å²	1	47 Å²	47	1%	0.008	26%	0.263	C	S	.	.	H	α-helix	trans	-66.4	-38.7	179	0	0	0	0	0	111.6	Y8 K77 T84 L123 V124	Y8-A80 HydrophobicContact CE1-CB 3.86Å; K77-A80 HydrophobicContact CB-CB 3.87Å; K77-A80 PolarHBondContact O-N 3.35Å; K77-A80 VanDerWaalsContact O-N 3.15Å; A80-T84 WeakPolarHBondContact O-CB 3.35Å; A80-T84 PolarHBondContact O-N 3.05Å; A80-T84 PolarHBondContact O-OG1 3.34Å; A80-L123 HydrophobicContact CB-CB 4.21Å; A80-V124 HydrophobicContact CB-CG2 3.96Å
81	A	92	Very high	91.6	Very high	0 Å²	0	46.1 Å²	46.1	0%	0	26%	0.262	C	S	.	.	H	α-helix	trans	-64.9	-44.9	174.7	0	0	0	0	0	112.1	A11 L72 S75 K77 S78 V79 A83 T84 N85	A11-A81 HydrophobicContact CB-CB 4.42Å; A11-A81 WeakPolarHBondContact CB-O 3.34Å; L72-A81 HydrophobicContact CD2-CB 4.31Å; S75-A81 WeakPolarHBondContact OG-CB 3.42Å; K77-A81 PolarHBondContact O-N 3.03Å; K77-A81 VanDerWaalsContact O-N 3.12Å; S78-A81 PolarHBondContact O-N 2.71Å; V79-A81 PolarHBondContact O-N 2.87Å; A81-A83 PolarHBondContact O-N 2.66Å; A81-T84 PolarHBondContact O-N 3.38Å; A81-N85 WeakPolarHBondContact O-CB 3.48Å; A81-N85 PolarHBondContact O-N 2.85Å
82	L	93.6	Very high	91.8	Very high	83 Å²	83	49.6 Å²	49.6	44%	0.435	28%	0.277	S	S	.	.	H	α-helix	trans	-62.5	-42.9	177.1	-165.7	111.2	0	0	0	111.8	L72 S78 V79 N85 T86	L72-L82 HydrophobicContact CD1-CD1 4.37Å; L72-L82 HydrophobicContact CD2-CB 4.17Å; L72-L82 HydrophobicContact CD2-CD1 4.25Å; S78-L82 WeakPolarHBondContact O-CB 3.43Å; S78-L82 PolarHBondContact O-N 2.97Å; V79-L82 PolarHBondContact O-N 3.49Å; L82-N85 WeakPolarHBondContact O-CB 3.38Å; L82-N85 PolarHBondContact O-N 3.41Å; L82-T86 PolarHBondContact O-N 2.91Å; L82-T86 PolarHBondContact O-OG1 2.91Å; L82-T86 VanDerWaalsContact O-OG1 3.05Å
83	A	93.7	Very high	91.9	Very high	23 Å²	23	49.2 Å²	49.2	19%	0.19	28%	0.278	C	S	.	.	H	α-helix	trans	-65.2	-42.8	177.1	0	0	0	0	0	110.9	V79 A81 N85 T86 L87 I120 L123	V79-A83 WeakPolarHBondContact O-CB 3.33Å; V79-A83 PolarHBondContact O-N 3.38Å; A81-A83 PolarHBondContact O-N 2.66Å; A83-N85 VanDerWaalsContact C-N 3.31Å; A83-N85 PolarHBondContact O-N 2.94Å; A83-T86 PolarHBondContact O-N 2.87Å; A83-L87 WeakPolarHBondContact O-CB 3.38Å; A83-L87 PolarHBondContact O-N 3.32Å; A83-I120 VanDerWaalsContact C-CD1 3.42Å; A83-I120 HydrophobicContact CB-CD1 3.79Å; A83-I120 HydrophobicContact CB-CG1 3.62Å; A83-I120 WeakPolarHBondContact O-CD1 3.44Å; A83-L123 HydrophobicContact CB-CD1 4.27Å
84	T	93.5	Very high	92.2	Very high	18 Å²	18	45.7 Å²	45.7	11%	0.11	26%	0.255	C	S	.	.	H	α-helix	trans	-59.2	-42.1	174.7	-57.3	0	0	0	0	111.7	A11 V12 A80 A81 L87 S88	A11-T84 HydrophobicContact CB-CG2 4.25Å; V12-T84 HydrophobicContact CG2-CG2 3.7Å; A80-T84 WeakPolarHBondContact O-CB 3.35Å; A80-T84 PolarHBondContact O-N 3.05Å; A80-T84 PolarHBondContact O-OG1 3.34Å; A81-T84 PolarHBondContact O-N 3.38Å; T84-L87 PolarHBondContact O-N 2.97Å; T84-S88 VanDerWaalsContact O-CB 3.3Å; T84-S88 WeakPolarHBondContact O-CB 3.31Å; T84-S88 PolarHBondContact O-N 3.49Å
85	N	94.9	Very high	92.5	Very high	11 Å²	11	45.4 Å²	45.4	6%	0.059	26%	0.26	C	S	.	.	H	α-helix	trans	-60.8	-46.5	175.2	174.7	-99.6	0	0	0	112	A11 S14 G15 L68 A81 L82 A83 S88 N89	A11-N85 HydrophobicContact CB-CB 4.23Å; A11-N85 WeakPolarHBondContact O-CA 3.38Å; A11-N85 PolarHBondContact O-ND2 3.41Å; S14-N85 WeakPolarHBondContact CB-ND2 3.38Å; S14-N85 PolarHBondContact OG-ND2 3.45Å; G15-N85 WeakPolarHBondContact CA-ND2 3.48Å; G15-N85 WeakPolarHBondContact CA-O 3.15Å; G15-N85 PolarHBondContact N-ND2 3.27Å; L68-N85 HydrophobicContact CD1-CB 3.84Å; A81-N85 WeakPolarHBondContact O-CB 3.48Å; A81-N85 PolarHBondContact O-N 2.85Å; L82-N85 WeakPolarHBondContact O-CB 3.38Å; L82-N85 PolarHBondContact O-N 3.41Å; A83-N85 VanDerWaalsContact C-N 3.31Å; A83-N85 PolarHBondContact O-N 2.94Å; N85-S88 WeakPolarHBondContact O-CB 3.44Å; N85-S88 PolarHBondContact O-N 3.47Å; N85-N89 WeakPolarHBondContact O-CB 3.36Å; N85-N89 PolarHBondContact O-N 3.41Å
86	T	94.5	Very high	92.9	Very high	52 Å²	52	46.9 Å²	46.9	32%	0.319	27%	0.265	S	S	.	.	H	α-helix	trans	-65.8	-42.5	179.9	-60.2	0	0	0	0	111.2	L82 A83 S88 N89 F90	L82-T86 PolarHBondContact O-N 2.91Å; L82-T86 PolarHBondContact O-OG1 2.91Å; L82-T86 VanDerWaalsContact O-OG1 3.05Å; A83-T86 PolarHBondContact O-N 2.87Å; T86-S88 PolarHBondContact O-N 2.93Å; T86-N89 PolarHBondContact O-N 3.07Å; T86-F90 HydrophobicContact CG2-CD2 4.18Å; T86-F90 HydrophobicContact CG2-CE1 4.24Å; T86-F90 HydrophobicContact CG2-CE2 3.72Å; T86-F90 HydrophobicContact CG2-CZ 3.76Å; T86-F90 WeakPolarHBondContact O-CG 3.42Å; T86-F90 PolarHBondContact O-N 3.43Å
87	L	95.2	Very high	93.4	Very high	39 Å²	39	39.8 Å²	39.8	20%	0.204	23%	0.233	C	C	.	.	H	α-helix	trans	-58.4	-48.8	174.7	-166.2	85.6	0	0	0	111.3	A83 T84 F90 A91 M113 L116 I120	A83-L87 WeakPolarHBondContact O-CB 3.38Å; A83-L87 PolarHBondContact O-N 3.32Å; T84-L87 PolarHBondContact O-N 2.97Å; L87-F90 PolarHBondContact O-N 3.44Å; L87-A91 WeakPolarHBondContact O-CB 3.5Å; L87-A91 PolarHBondContact O-N 3.42Å; L87-M113 HydrophobicContact CD1-CE 2.95Å; L87-M113 HydrophobicContact CG-CE 3.49Å; L87-M113 VanDerWaalsContact CG-CE 3.49Å; L87-L116 HydrophobicContact CD1-CB 3.54Å; L87-I120 HydrophobicContact CB-CD1 3.51Å; L87-I120 HydrophobicContact CD1-CD1 3.7Å; L87-I120 HydrophobicContact CD2-CD1 3.97Å; L87-I120 HydrophobicContact CG-CD1 3.93Å
88	S	95.5	Very high	93.7	Very high	10 Å²	10	44.5 Å²	44.5	7%	0.07	25%	0.249	C	C	.	.	H	α-helix	trans	-58.7	-47.6	176.7	178.2	0	0	0	0	110.8	V12 T84 N85 T86 F90 A91 F92	V12-S88 PolarHBondContact O-OG 3.36Å; T84-S88 VanDerWaalsContact O-CB 3.3Å; T84-S88 WeakPolarHBondContact O-CB 3.31Å; T84-S88 PolarHBondContact O-N 3.49Å; N85-S88 WeakPolarHBondContact O-CB 3.44Å; N85-S88 PolarHBondContact O-N 3.47Å; T86-S88 PolarHBondContact O-N 2.93Å; S88-F90 PolarHBondContact O-N 2.96Å; S88-A91 PolarHBondContact O-N 2.94Å; S88-F92 WeakPolarHBondContact O-CD2 3.31Å; S88-F92 PolarHBondContact O-N 3.35Å; S88-F92 VanDerWaalsContact OG-CD2 3.32Å; S88-F92 WeakPolarHBondContact OG-CD2 3.44Å; S88-F92 VanDerWaalsContact OG-CE2 3.23Å; S88-F92 WeakPolarHBondContact OG-CE2 3.36Å
89	N	96	Very high	93.9	Very high	32 Å²	32	46 Å²	46	17%	0.171	26%	0.259	C	S	.	.	H	α-helix	trans	-57.9	-47.6	177.2	-176	13.6	0	0	0	112.1	G15 A18 A19 N85 T86 S93	G15-N89 WeakPolarHBondContact O-CA 3.28Å; A18-N89 HydrophobicContact CB-CB 4.08Å; A19-N89 WeakPolarHBondContact CA-OD1 3.26Å; A19-N89 PolarHBondContact N-OD1 3.25Å; N85-N89 WeakPolarHBondContact O-CB 3.36Å; N85-N89 PolarHBondContact O-N 3.41Å; T86-N89 PolarHBondContact O-N 3.07Å; N89-S93 WeakPolarHBondContact O-CB 3.36Å; N89-S93 PolarHBondContact O-N 3.49Å; N89-S93 PolarHBondContact O-OG 3.2Å; N89-S93 PolarHBondContact OD1-OG 3.45Å
90	F	94.9	Very high	93.9	Very high	100 Å²	100	45.3 Å²	45.3	44%	0.439	25%	0.251	S	S	.	.	H	α-helix	trans	-64	-44.2	178.1	-69.8	-13.3	0	0	0	112.6	T86 L87 S88 A94 L116	T86-F90 HydrophobicContact CG2-CD2 4.18Å; T86-F90 HydrophobicContact CG2-CE1 4.24Å; T86-F90 HydrophobicContact CG2-CE2 3.72Å; T86-F90 HydrophobicContact CG2-CZ 3.76Å; T86-F90 WeakPolarHBondContact O-CG 3.42Å; T86-F90 PolarHBondContact O-N 3.43Å; L87-F90 PolarHBondContact O-N 3.44Å; S88-F90 PolarHBondContact O-N 2.96Å; F90-A94 WeakPolarHBondContact O-CB 3.2Å; F90-A94 PolarHBondContact O-N 2.9Å; F90-L116 HydrophobicContact CD2-CD1 3.92Å; F90-L116 HydrophobicContact CE2-CD1 4.23Å
91	A	95.5	Very high	93.8	Very high	41 Å²	41	47.6 Å²	47.6	34%	0.339	26%	0.261	S	S	.	.	H	α-helix	trans	-61.6	-48.1	179.1	0	0	0	0	0	111.6	L87 S88 A94 A95 M113	L87-A91 WeakPolarHBondContact O-CB 3.5Å; L87-A91 PolarHBondContact O-N 3.42Å; S88-A91 PolarHBondContact O-N 2.94Å; A91-A94 PolarHBondContact O-N 3.2Å; A91-A95 WeakPolarHBondContact O-CB 3.35Å; A91-A95 PolarHBondContact O-N 3.06Å; A91-M113 HydrophobicContact CB-SD 4.47Å
92	F	95.9	Very high	93.6	Very high	72 Å²	72	54.3 Å²	54.3	32%	0.316	29%	0.292	S	S	.	.	H	α-helix	trans	-71.1	-39.7	179.2	-72.6	-60.2	0	0	0	112.7	V12 F16 A19 S88 A94 A95 F96	V12-F92 HydrophobicContact CG1-CE2 4.41Å; F16-F92 HydrophobicContact CB-CD2 3.76Å; F16-F92 HydrophobicContact CB-CE2 3.78Å; F16-F92 HydrophobicContact CB-CG 4.45Å; F16-F92 HydrophobicContact CB-CZ 4.46Å; F16-F92 HydrophobicContact CD2-CB 4.42Å; F16-F92 AromaticContact CD2-CD1 3.76Å; F16-F92 HydrophobicContact CD2-CD1 3.76Å; F16-F92 AromaticContact CD2-CD2 3.88Å; F16-F92 HydrophobicContact CD2-CD2 3.88Å; F16-F92 AromaticContact CD2-CE1 3.89Å; F16-F92 HydrophobicContact CD2-CE1 3.89Å; F16-F92 HydrophobicContact CD2-CE2 4.02Å; F16-F92 AromaticContact CD2-CG 3.77Å; F16-F92 HydrophobicContact CD2-CG 3.77Å; F16-F92 HydrophobicContact CD2-CZ 4.02Å; F16-F92 HydrophobicContact CE2-CD1 4.31Å; F16-F92 HydrophobicContact CE2-CE1 4.45Å; F16-F92 HydrophobicContact CG-CD2 4.34Å; F16-F92 HydrophobicContact CG-CE2 4.38Å; A19-F92 HydrophobicContact CB-CB 3.49Å; A19-F92 VanDerWaalsContact CB-CB 3.49Å; S88-F92 WeakPolarHBondContact O-CD2 3.31Å; S88-F92 PolarHBondContact O-N 3.35Å; S88-F92 VanDerWaalsContact OG-CD2 3.32Å; S88-F92 WeakPolarHBondContact OG-CD2 3.44Å; S88-F92 VanDerWaalsContact OG-CE2 3.23Å; S88-F92 WeakPolarHBondContact OG-CE2 3.36Å; F92-A94 VanDerWaalsContact C-N 3.29Å; F92-A94 PolarHBondContact O-N 3.01Å; F92-A95 WeakPolarHBondContact O-CB 3.43Å; F92-A95 PolarHBondContact O-N 3.38Å; F92-F96 HydrophobicContact CB-CE2 4.35Å; F92-F96 VanDerWaalsContact O-CD2 3.27Å; F92-F96 WeakPolarHBondContact O-CD2 3.45Å; F92-F96 VanDerWaalsContact O-CG 3.31Å; F92-F96 WeakPolarHBondContact O-CG 3.49Å; F92-F96 PolarHBondContact O-N 2.88Å
93	S	94.3	Very high	93.4	Very high	38 Å²	38	54.8 Å²	54.8	27%	0.266	29%	0.292	S	S	.	.	H	α-helix	trans	-61.1	-41.4	175.6	-68.6	0	0	0	0	111.1	A19 N89 F96 G97	A19-S93 WeakPolarHBondContact CA-OG 3.33Å; A19-S93 WeakPolarHBondContact CB-OG 3.4Å; N89-S93 WeakPolarHBondContact O-CB 3.36Å; N89-S93 PolarHBondContact O-N 3.49Å; N89-S93 PolarHBondContact O-OG 3.2Å; N89-S93 PolarHBondContact OD1-OG 3.45Å; S93-F96 PolarHBondContact O-N 2.92Å; S93-G97 PolarHBondContact O-N 3.34Å
94	A	94.6	Very high	93.2	Very high	17 Å²	17	62.6 Å²	62.6	14%	0.14	33%	0.325	C	S	.	.	H	α-helix	trans	-67.3	-40.2	175.8	0	0	0	0	0	111.9	F90 A91 F92 F96 G97 R98 L105 W109	F90-A94 WeakPolarHBondContact O-CB 3.2Å; F90-A94 PolarHBondContact O-N 2.9Å; A91-A94 PolarHBondContact O-N 3.2Å; F92-A94 VanDerWaalsContact C-N 3.29Å; F92-A94 PolarHBondContact O-N 3.01Å; A94-F96 VanDerWaalsContact C-N 3.34Å; A94-F96 PolarHBondContact O-N 3.05Å; A94-G97 PolarHBondContact O-N 3.49Å; A94-R98 WeakPolarHBondContact O-CB 3.49Å; A94-R98 PolarHBondContact O-N 3.2Å; A94-L105 HydrophobicContact CB-CD2 3.87Å; A94-W109 HydrophobicContact CB-CH2 4.04Å; A94-W109 HydrophobicContact CB-CZ2 3.24Å
95	A	94.6	Very high	93	Very high	45 Å²	45	64.1 Å²	64.1	37%	0.372	33%	0.332	S	S	.	.	H	α-helix	trans	-60	-43.7	173.5	0	0	0	0	0	111.7	A91 F92 R98 C99	A91-A95 WeakPolarHBondContact O-CB 3.35Å; A91-A95 PolarHBondContact O-N 3.06Å; F92-A95 WeakPolarHBondContact O-CB 3.43Å; F92-A95 PolarHBondContact O-N 3.38Å; A95-R98 PolarHBondContact O-N 3.38Å; A95-C99 VanDerWaalsContact O-CB 3.3Å; A95-C99 WeakPolarHBondContact O-CB 3.35Å; A95-C99 PolarHBondContact O-N 3.46Å; A95-C99 PolarHBondContact O-SG 3.05Å
96	F	93.5	Very high	92.8	Very high	43 Å²	43	67.7 Å²	67.7	19%	0.189	35%	0.354	C	S	.	.	H	α-helix	trans	-66.8	-42.2	174.9	-63.4	-35.6	0	0	0	112.5	F16 A19 L23 F92 S93 A94 R98 C99 I100	F16-F96 HydrophobicContact CD2-CZ 4.45Å; F16-F96 AromaticContact CE2-CZ 3.77Å; F16-F96 HydrophobicContact CE2-CZ 3.77Å; F16-F96 HydrophobicContact CZ-CZ 4.36Å; A19-F96 HydrophobicContact CB-CD2 3.98Å; A19-F96 HydrophobicContact CB-CE2 3.79Å; L23-F96 HydrophobicContact CB-CD2 4.25Å; L23-F96 HydrophobicContact CD1-CB 4.41Å; L23-F96 HydrophobicContact CD2-CB 4.23Å; L23-F96 HydrophobicContact CD2-CD1 4.26Å; L23-F96 HydrophobicContact CD2-CD2 4.04Å; L23-F96 HydrophobicContact CD2-CE2 4.46Å; L23-F96 HydrophobicContact CD2-CG 3.94Å; F92-F96 HydrophobicContact CB-CE2 4.35Å; F92-F96 VanDerWaalsContact O-CD2 3.27Å; F92-F96 WeakPolarHBondContact O-CD2 3.45Å; F92-F96 VanDerWaalsContact O-CG 3.31Å; F92-F96 WeakPolarHBondContact O-CG 3.49Å; F92-F96 PolarHBondContact O-N 2.88Å; S93-F96 PolarHBondContact O-N 2.92Å; A94-F96 VanDerWaalsContact C-N 3.34Å; A94-F96 PolarHBondContact O-N 3.05Å; F96-R98 VanDerWaalsContact C-N 3.33Å; F96-R98 PolarHBondContact O-N 2.99Å; F96-C99 PolarHBondContact O-N 3.47Å; F96-I100 HydrophobicContact CB-CD1 4.37Å; F96-I100 VanDerWaalsContact O-CB 3.29Å; F96-I100 WeakPolarHBondContact O-CB 3.46Å; F96-I100 PolarHBondContact O-N 3.2Å
97	G	92.7	Very high	92.6	Very high	4 Å²	4	68 Å²	68	4%	0.041	37%	0.368	C	S	.	.	H	α-helix	trans	-50.5	-52.6	172.1	0	0	0	0	0	111.9	S93 A94 F101 Q102 E103	S93-G97 PolarHBondContact O-N 3.34Å; A94-G97 PolarHBondContact O-N 3.49Å; G97-F101 CarbonylContact O-C 3.21Å; G97-F101 WeakPolarHBondContact O-CA 3.44Å; G97-F101 WeakPolarHBondContact O-CB 3.44Å; G97-F101 PolarHBondContact O-N 3.07Å; G97-Q102 PolarHBondContact O-N 3.47Å; G97-Q102 VanDerWaalsContact O-N 3.16Å; G97-E103 PolarHBondContact O-N 2.89Å
98	R	92.2	Very high	92.5	Very high	147 Å²	147	72.5 Å²	72.5	56%	0.555	39%	0.392	S	S	*	.	H	α-helix	trans	-66.5	-45	-179.7	-149.3	-73.3	-155.9	167.9	6.9	113.2	A94 A95 F96 Q102 L105	A94-R98 WeakPolarHBondContact O-CB 3.49Å; A94-R98 PolarHBondContact O-N 3.2Å; A95-R98 PolarHBondContact O-N 3.38Å; F96-R98 VanDerWaalsContact C-N 3.33Å; F96-R98 PolarHBondContact O-N 2.99Å; R98-Q102 VanDerWaalsContact O-CA 3.31Å; R98-Q102 WeakPolarHBondContact O-CA 3.38Å; R98-Q102 PolarHBondContact O-N 3.24Å; R98-L105 HydrophobicContact CB-CD1 3.72Å; R98-L105 HydrophobicContact CG-CD1 3.17Å
99	C	92.7	Very high	92.4	Very high	92 Å²	92	76 Å²	76	62%	0.622	40%	0.404	S	S	*	.	H	α-helix	trans	-76.9	-40.5	-174.2	-72.2	0	0	0	0	112.7	A95 F96 Q102	A95-C99 VanDerWaalsContact O-CB 3.3Å; A95-C99 WeakPolarHBondContact O-CB 3.35Å; A95-C99 PolarHBondContact O-N 3.46Å; A95-C99 PolarHBondContact O-SG 3.05Å; F96-C99 PolarHBondContact O-N 3.47Å; C99-Q102 PolarHBondContact O-NE2 3.1Å
100	I	90.5	Very high	92.3	Very high	83 Å²	83	79.7 Å²	79.7	43%	0.426	42%	0.419	S	S	.	.	H	α-helix	trans	-95.8	-44.6	-171.4	-61	173.6	0	0	0	111	L23 L27 F96	L23-I100 HydrophobicContact CD1-CD1 3.55Å; L23-I100 HydrophobicContact CD1-CG2 4.49Å; L23-I100 HydrophobicContact CD2-CD1 3.44Å; L23-I100 VanDerWaalsContact CD2-CD1 3.44Å; L23-I100 HydrophobicContact CG-CD1 4.11Å; L27-I100 HydrophobicContact CD2-CG2 4.4Å; F96-I100 HydrophobicContact CB-CD1 4.37Å; F96-I100 VanDerWaalsContact O-CB 3.29Å; F96-I100 WeakPolarHBondContact O-CB 3.46Å; F96-I100 PolarHBondContact O-N 3.2Å
101	F	89.6	Confident	92.3	Very high	50 Å²	50	80.6 Å²	80.6	22%	0.219	43%	0.428	C	S	.	.	S	Bend	trans	-99.7	-1.6	-175.9	-56	-81.2	0	0	0	113.2	L23 K26 L27 G97 E103	L23-F101 HydrophobicContact CD1-CE2 3.56Å; L23-F101 HydrophobicContact CD1-CZ 3.95Å; K26-F101 HydrophobicContact CB-CZ 4.16Å; K26-F101 HydrophobicContact CD-CD2 4.42Å; K26-F101 HydrophobicContact CD-CE1 4.02Å; K26-F101 HydrophobicContact CD-CE2 3.8Å; K26-F101 HydrophobicContact CD-CZ 3.58Å; K26-F101 HydrophobicContact CG-CE1 4.13Å; K26-F101 HydrophobicContact CG-CE2 4.43Å; K26-F101 HydrophobicContact CG-CZ 3.75Å; L27-F101 HydrophobicContact CD2-CE1 4.12Å; L27-F101 HydrophobicContact CD2-CZ 3.85Å; L27-F101 HydrophobicContact CG-CZ 4.26Å; G97-F101 CarbonylContact O-C 3.21Å; G97-F101 WeakPolarHBondContact O-CA 3.44Å; G97-F101 WeakPolarHBondContact O-CB 3.44Å; G97-F101 PolarHBondContact O-N 3.07Å; F101-E103 HydrophobicContact CB-CG 3.97Å; F101-E103 PolarHBondContact O-N 3.26Å
102	Q	88.8	Confident	92.3	Very high	141 Å²	141	80.3 Å²	80.3	66%	0.659	43%	0.428	S	S	*	.			trans	54.8	31.8	-176.8	-59.7	-68.4	-45.8	0	0	112.6	G97 R98 C99	G97-Q102 PolarHBondContact O-N 3.47Å; G97-Q102 VanDerWaalsContact O-N 3.16Å; R98-Q102 VanDerWaalsContact O-CA 3.31Å; R98-Q102 WeakPolarHBondContact O-CA 3.38Å; R98-Q102 PolarHBondContact O-N 3.24Å; C99-Q102 PolarHBondContact O-NE2 3.1Å
103	E	89.1	Confident	92.2	Very high	92 Å²	92	78 Å²	78	43%	0.43	42%	0.419	S	S	.	.	P	Polyproline II helix	trans	-68.4	133	176.6	-71.5	173.5	178.8	0	0	110.6	K26 G97 F101	K26-E103 IonicContact NZ-OE1 2.66Å; K26-E103 PolarHBondContact NZ-OE1 3.18Å; G97-E103 PolarHBondContact O-N 2.89Å; F101-E103 HydrophobicContact CB-CG 3.97Å; F101-E103 PolarHBondContact O-N 3.26Å
104	E	89.1	Confident	92.3	Very high	188 Å²	188	81.4 Å²	81.4	88%	0.879	43%	0.433	S	S	*	.	P	Polyproline II helix	trans	-78	127.2	176.9	-66.4	-167.3	162.9	0	0	111.2
105	L	88.9	Confident	92.3	Very high	50 Å²	50	84.8 Å²	84.8	26%	0.262	46%	0.455	S	S	.	.	P	Polyproline II helix	trans	-86.5	116.3	170	-61.9	103.9	0	0	0	109.8	A94 R98 W109 F110	A94-L105 HydrophobicContact CB-CD2 3.87Å; R98-L105 HydrophobicContact CB-CD1 3.72Å; R98-L105 HydrophobicContact CG-CD1 3.17Å; L105-W109 HydrophobicContact CB-CE3 4.35Å; L105-W109 HydrophobicContact CD2-CD2 3.37Å; L105-W109 HydrophobicContact CD2-CE3 3.31Å; L105-W109 HydrophobicContact CD2-CG 4.03Å; L105-W109 HydrophobicContact CD2-CH2 3.77Å; L105-W109 HydrophobicContact CD2-CZ2 3.81Å; L105-W109 HydrophobicContact CD2-CZ3 3.52Å; L105-W109 HydrophobicContact CG-CD2 4.46Å; L105-W109 HydrophobicContact CG-CE3 4.44Å; L105-F110 HydrophobicContact CB-CE2 3.85Å; L105-F110 HydrophobicContact CB-CZ 4.21Å
106	T	91.7	Very high	92.3	Very high	86 Å²	86	86.6 Å²	86.6	53%	0.528	46%	0.458	S	S	.	.	P	Polyproline II helix	trans	-70.1	155.7	176	62	0	0	0	0	111.5	N108 W109 F110	T106-N108 PolarHBondContact O-N 2.98Å; T106-N108 VanDerWaalsContact O-N 3.16Å; T106-W109 VanDerWaalsContact O-CB 3.29Å; T106-W109 WeakPolarHBondContact O-CB 3.37Å; T106-W109 PolarHBondContact O-N 3.41Å; T106-W109 PolarHBondContact OG1-N 3.39Å; T106-F110 WeakPolarHBondContact O-CD2 3.41Å
107	G	90.4	Very high	92.3	Very high	59 Å²	59	86.2 Å²	86.2	61%	0.608	46%	0.461	S	S	*	.	H	α-helix	trans	-54.9	-32.4	172.1	0	0	0	0	0	113	W109 F110 L111	G107-W109 VanDerWaalsContact C-N 3.31Å; G107-W109 PolarHBondContact O-N 3.02Å; G107-F110 PolarHBondContact O-N 3.45Å; G107-L111 PolarHBondContact O-N 3.31Å; G107-L111 VanDerWaalsContact O-N 3.12Å
108	N	93.1	Very high	92.4	Very high	133 Å²	133	90.4 Å²	90.4	71%	0.711	48%	0.481	S	S	*	.	H	α-helix	trans	-64.8	-33.7	175.7	-68.3	-8.1	0	0	0	112.6	T106 L111 G112	T106-N108 PolarHBondContact O-N 2.98Å; T106-N108 VanDerWaalsContact O-N 3.16Å; N108-L111 PolarHBondContact O-N 3.36Å; N108-G112 PolarHBondContact O-N 3.02Å
109	W	93.2	Very high	92.5	Very high	82 Å²	82	85 Å²	85	31%	0.311	47%	0.472	S	S	.	.	H	α-helix	trans	-61.8	-45.8	174.7	-179.3	92.1	0	0	0	110.9	A94 L105 T106 G107 L111 G112 M113	A94-W109 HydrophobicContact CB-CH2 4.04Å; A94-W109 HydrophobicContact CB-CZ2 3.24Å; L105-W109 HydrophobicContact CB-CE3 4.35Å; L105-W109 HydrophobicContact CD2-CD2 3.37Å; L105-W109 HydrophobicContact CD2-CE3 3.31Å; L105-W109 HydrophobicContact CD2-CG 4.03Å; L105-W109 HydrophobicContact CD2-CH2 3.77Å; L105-W109 HydrophobicContact CD2-CZ2 3.81Å; L105-W109 HydrophobicContact CD2-CZ3 3.52Å; L105-W109 HydrophobicContact CG-CD2 4.46Å; L105-W109 HydrophobicContact CG-CE3 4.44Å; T106-W109 VanDerWaalsContact O-CB 3.29Å; T106-W109 WeakPolarHBondContact O-CB 3.37Å; T106-W109 PolarHBondContact O-N 3.41Å; T106-W109 PolarHBondContact OG1-N 3.39Å; G107-W109 VanDerWaalsContact C-N 3.31Å; G107-W109 PolarHBondContact O-N 3.02Å; W109-L111 VanDerWaalsContact C-N 3.34Å; W109-L111 PolarHBondContact O-N 3.2Å; W109-G112 PolarHBondContact O-N 2.89Å; W109-M113 HydrophobicContact CE3-CB 4.42Å; W109-M113 HydrophobicContact CH2-CB 4.33Å; W109-M113 HydrophobicContact CH2-CG 3.92Å; W109-M113 HydrophobicContact CH2-SD 3.98Å; W109-M113 HydrophobicContact CZ2-CG 4.26Å; W109-M113 HydrophobicContact CZ2-SD 3.8Å; W109-M113 HydrophobicContact CZ3-CB 4.26Å; W109-M113 HydrophobicContact CZ3-CG 4.24Å; W109-M113 WeakPolarHBondContact O-CB 3.47Å; W109-M113 PolarHBondContact O-N 2.89Å
110	F	93.3	Very high	92.5	Very high	110 Å²	110	81.5 Å²	81.5	48%	0.482	45%	0.447	S	S	.	.	H	α-helix	trans	-62.6	-41.7	177.8	-70.3	-80.2	0	0	0	111.9	L105 T106 G107 G112 M113 L114	L105-F110 HydrophobicContact CB-CE2 3.85Å; L105-F110 HydrophobicContact CB-CZ 4.21Å; T106-F110 WeakPolarHBondContact O-CD2 3.41Å; G107-F110 PolarHBondContact O-N 3.45Å; F110-G112 PolarHBondContact O-N 2.94Å; F110-M113 PolarHBondContact O-N 3.26Å; F110-L114 WeakPolarHBondContact O-CG 3.41Å; F110-L114 PolarHBondContact O-N 3.45Å
111	L	95.3	Very high	92.5	Very high	120 Å²	120	82.4 Å²	82.4	63%	0.628	45%	0.451	S	S	*	.	H	α-helix	trans	-61.9	-44	176.1	-173.9	65	0	0	0	111.7	G107 N108 W109 L114 C115	G107-L111 PolarHBondContact O-N 3.31Å; G107-L111 VanDerWaalsContact O-N 3.12Å; N108-L111 PolarHBondContact O-N 3.36Å; W109-L111 VanDerWaalsContact C-N 3.34Å; W109-L111 PolarHBondContact O-N 3.2Å; L111-L114 PolarHBondContact O-N 3.36Å; L111-C115 WeakPolarHBondContact O-CB 3.45Å; L111-C115 PolarHBondContact O-N 2.8Å
112	G	95.6	Very high	92.6	Very high	34 Å²	34	87 Å²	87	35%	0.351	47%	0.471	S	S	.	.	H	α-helix	trans	-61.2	-43.8	174.5	0	0	0	0	0	112.3	N108 W109 F110 L114 C115 L116	N108-G112 PolarHBondContact O-N 3.02Å; W109-G112 PolarHBondContact O-N 2.89Å; F110-G112 PolarHBondContact O-N 2.94Å; G112-L114 VanDerWaalsContact C-N 3.35Å; G112-L114 PolarHBondContact O-N 2.7Å; G112-C115 PolarHBondContact O-N 2.98Å; G112-L116 WeakPolarHBondContact O-CG 3.18Å; G112-L116 PolarHBondContact O-N 3.39Å
113	M	94.1	Very high	92.7	Very high	25 Å²	25	82.8 Å²	82.8	12%	0.123	45%	0.453	C	S	.	.	H	α-helix	trans	-62.6	-40.9	178.8	-165.5	72.5	-100	0	0	112.1	L87 A91 W109 F110 L116 S117	L87-M113 HydrophobicContact CD1-CE 2.95Å; L87-M113 HydrophobicContact CG-CE 3.49Å; L87-M113 VanDerWaalsContact CG-CE 3.49Å; A91-M113 HydrophobicContact CB-SD 4.47Å; W109-M113 HydrophobicContact CE3-CB 4.42Å; W109-M113 HydrophobicContact CH2-CB 4.33Å; W109-M113 HydrophobicContact CH2-CG 3.92Å; W109-M113 HydrophobicContact CH2-SD 3.98Å; W109-M113 HydrophobicContact CZ2-CG 4.26Å; W109-M113 HydrophobicContact CZ2-SD 3.8Å; W109-M113 HydrophobicContact CZ3-CB 4.26Å; W109-M113 HydrophobicContact CZ3-CG 4.24Å; W109-M113 WeakPolarHBondContact O-CB 3.47Å; W109-M113 PolarHBondContact O-N 2.89Å; F110-M113 PolarHBondContact O-N 3.26Å; M113-L116 HydrophobicContact CE-CB 4.33Å; M113-L116 HydrophobicContact CE-CD1 4.33Å; M113-S117 WeakPolarHBondContact O-CB 3.35Å; M113-S117 PolarHBondContact O-N 2.91Å; M113-S117 PolarHBondContact O-OG 2.87Å
114	L	94.9	Very high	92.5	Very high	108 Å²	108	80.9 Å²	80.9	57%	0.565	45%	0.447	S	S	*	.	H	α-helix	trans	-64	-46.5	174.4	-75.1	171.6	0	0	0	111.5	F110 L111 G112 L116 S117 I118	F110-L114 WeakPolarHBondContact O-CG 3.41Å; F110-L114 PolarHBondContact O-N 3.45Å; L111-L114 PolarHBondContact O-N 3.36Å; G112-L114 VanDerWaalsContact C-N 3.35Å; G112-L114 PolarHBondContact O-N 2.7Å; L114-L116 PolarHBondContact O-N 2.94Å; L114-S117 PolarHBondContact O-N 3.19Å; L114-I118 VanDerWaalsContact O-CG1 3.31Å; L114-I118 WeakPolarHBondContact O-CG1 3.3Å; L114-I118 PolarHBondContact O-N 3.5Å
115	C	95.4	Very high	92.3	Very high	89 Å²	89	76.3 Å²	76.3	60%	0.601	44%	0.435	S	S	*	.	H	α-helix	trans	-59.2	-46.5	178.3	-171.2	0	0	0	0	111.8	L111 G112 S117 I118 G119	L111-C115 WeakPolarHBondContact O-CB 3.45Å; L111-C115 PolarHBondContact O-N 2.8Å; G112-C115 PolarHBondContact O-N 2.98Å; C115-S117 VanDerWaalsContact C-N 3.35Å; C115-S117 PolarHBondContact O-N 3.43Å; C115-I118 PolarHBondContact O-N 3.17Å; C115-G119 PolarHBondContact O-N 3.46Å
116	L	94.2	Very high	91.9	Very high	82 Å²	82	79.6 Å²	79.6	43%	0.429	45%	0.449	S	S	.	.	H	α-helix	trans	-59.8	-44.7	175.1	-73.1	173	0	0	0	111.9	L87 F90 G112 M113 L114 I118 G119 I120	L87-L116 HydrophobicContact CD1-CB 3.54Å; F90-L116 HydrophobicContact CD2-CD1 3.92Å; F90-L116 HydrophobicContact CE2-CD1 4.23Å; G112-L116 WeakPolarHBondContact O-CG 3.18Å; G112-L116 PolarHBondContact O-N 3.39Å; M113-L116 HydrophobicContact CE-CB 4.33Å; M113-L116 HydrophobicContact CE-CD1 4.33Å; L114-L116 PolarHBondContact O-N 2.94Å; L116-I118 PolarHBondContact O-N 2.89Å; L116-G119 PolarHBondContact O-N 3.03Å; L116-I120 VanDerWaalsContact O-CG1 3.31Å; L116-I120 WeakPolarHBondContact O-CG1 3.36Å; L116-I120 PolarHBondContact O-N 3.41Å
117	S	94	Very high	90.6	Very high	36 Å²	36	87.9 Å²	87.9	25%	0.252	48%	0.478	S	S	.	.	H	α-helix	trans	-61.7	-44.3	-179.7	-57.9	0	0	0	0	111.5	M113 L114 C115 I120 I121	M113-S117 WeakPolarHBondContact O-CB 3.35Å; M113-S117 PolarHBondContact O-N 2.91Å; M113-S117 PolarHBondContact O-OG 2.87Å; L114-S117 PolarHBondContact O-N 3.19Å; C115-S117 VanDerWaalsContact C-N 3.35Å; C115-S117 PolarHBondContact O-N 3.43Å; S117-I120 PolarHBondContact O-N 3.45Å; S117-I121 WeakPolarHBondContact O-CD1 3.49Å; S117-I121 VanDerWaalsContact O-CG1 3.3Å; S117-I121 WeakPolarHBondContact O-CG1 3.3Å; S117-I121 PolarHBondContact O-N 3.42Å
118	I	94.9	Very high	90.6	Very high	91 Å²	91	89.4 Å²	89.4	47%	0.467	47%	0.472	S	S	.	.	H	α-helix	trans	-62.4	-46.5	176.8	-67.2	164.9	0	0	0	110.9	L114 C115 L116 I120 I121 F122	L114-I118 VanDerWaalsContact O-CG1 3.31Å; L114-I118 WeakPolarHBondContact O-CG1 3.3Å; L114-I118 PolarHBondContact O-N 3.5Å; C115-I118 PolarHBondContact O-N 3.17Å; L116-I118 PolarHBondContact O-N 2.89Å; I118-I120 VanDerWaalsContact C-N 3.28Å; I118-I120 PolarHBondContact O-N 3.45Å; I118-I121 WeakPolarHBondContact O-CB 3.25Å; I118-I121 PolarHBondContact O-N 3.21Å; I118-F122 HydrophobicContact CG2-CD2 3.92Å; I118-F122 HydrophobicContact CG2-CE2 3.53Å; I118-F122 HydrophobicContact CG2-CZ 4.45Å; I118-F122 WeakPolarHBondContact O-CD2 3.35Å; I118-F122 PolarHBondContact O-N 2.85Å; I118-F122 VanDerWaalsContact O-N 3.09Å
119	G	94.1	Very high	90.4	Very high	34 Å²	34	87.1 Å²	87.1	35%	0.351	46%	0.459	S	S	.	.	H	α-helix	trans	-58.7	-39.8	177.9	0	0	0	0	0	112.8	C115 L116 F122 L123	C115-G119 PolarHBondContact O-N 3.46Å; L116-G119 PolarHBondContact O-N 3.03Å; G119-F122 PolarHBondContact O-N 2.94Å; G119-L123 PolarHBondContact O-N 3.37Å; G119-L123 VanDerWaalsContact O-N 3.09Å
120	I	92	Very high	90.3	Very high	19 Å²	19	87.3 Å²	87.3	10%	0.097	47%	0.467	C	S	.	.	H	α-helix	trans	-69.4	-39.5	177.4	-67.3	174.9	0	0	0	111.8	A83 L87 L116 S117 I118 F122 L123 V124	A83-I120 VanDerWaalsContact C-CD1 3.42Å; A83-I120 HydrophobicContact CB-CD1 3.79Å; A83-I120 HydrophobicContact CB-CG1 3.62Å; A83-I120 WeakPolarHBondContact O-CD1 3.44Å; L87-I120 HydrophobicContact CB-CD1 3.51Å; L87-I120 HydrophobicContact CD1-CD1 3.7Å; L87-I120 HydrophobicContact CD2-CD1 3.97Å; L87-I120 HydrophobicContact CG-CD1 3.93Å; L116-I120 VanDerWaalsContact O-CG1 3.31Å; L116-I120 WeakPolarHBondContact O-CG1 3.36Å; L116-I120 PolarHBondContact O-N 3.41Å; S117-I120 PolarHBondContact O-N 3.45Å; I118-I120 VanDerWaalsContact C-N 3.28Å; I118-I120 PolarHBondContact O-N 3.45Å; I120-F122 PolarHBondContact O-N 3.41Å; I120-L123 PolarHBondContact O-N 3.24Å; I120-L123 VanDerWaalsContact O-N 3.15Å; I120-V124 HydrophobicContact CG2-CG2 4.09Å; I120-V124 VanDerWaalsContact O-CG2 3.3Å; I120-V124 WeakPolarHBondContact O-CG2 3.26Å; I120-V124 PolarHBondContact O-N 3.32Å
121	I	91.1	Very high	90.1	Very high	101 Å²	101	86 Å²	86	52%	0.518	47%	0.466	S	S	.	.	H	α-helix	trans	-56.8	-44.5	174.4	-70.1	160.5	0	0	0	109.9	S117 I118 L123 V124 C125	S117-I121 WeakPolarHBondContact O-CD1 3.49Å; S117-I121 VanDerWaalsContact O-CG1 3.3Å; S117-I121 WeakPolarHBondContact O-CG1 3.3Å; S117-I121 PolarHBondContact O-N 3.42Å; I118-I121 WeakPolarHBondContact O-CB 3.25Å; I118-I121 PolarHBondContact O-N 3.21Å; I121-L123 PolarHBondContact O-N 3.33Å; I121-V124 PolarHBondContact O-N 3.19Å; I121-C125 VanDerWaalsContact O-CB 3.31Å; I121-C125 WeakPolarHBondContact O-CB 3.48Å; I121-C125 PolarHBondContact O-N 2.96Å; I121-C125 PolarHBondContact O-SG 2.98Å; I121-C125 VanDerWaalsContact O-SG 3.37Å
122	F	92.3	Very high	89.8	Confident	146 Å²	146	83.9 Å²	83.9	64%	0.64	46%	0.456	S	S	*	.	H	α-helix	trans	-60.6	-45.6	175.5	-74.3	-54	0	0	0	112.7	I118 G119 I120 V124 C125 E126	I118-F122 HydrophobicContact CG2-CD2 3.92Å; I118-F122 HydrophobicContact CG2-CE2 3.53Å; I118-F122 HydrophobicContact CG2-CZ 4.45Å; I118-F122 WeakPolarHBondContact O-CD2 3.35Å; I118-F122 PolarHBondContact O-N 2.85Å; I118-F122 VanDerWaalsContact O-N 3.09Å; G119-F122 PolarHBondContact O-N 2.94Å; I120-F122 PolarHBondContact O-N 3.41Å; F122-V124 VanDerWaalsContact C-N 3.33Å; F122-V124 PolarHBondContact O-N 3.21Å; F122-C125 PolarHBondContact O-N 2.81Å; F122-E126 PolarHBondContact O-N 3.07Å
123	L	89.2	Confident	89.4	Confident	54 Å²	54	87.2 Å²	87.2	28%	0.283	46%	0.463	S	S	.	.	H	α-helix	trans	-61.6	-39.6	176.7	-73.4	168.4	0	0	0	112.8	K77 V79 A80 A83 G119 I120 I121	K77-L123 PolarHBondContact NZ-O 3.15Å; V79-L123 HydrophobicContact CG1-CD1 4.19Å; V79-L123 HydrophobicContact CG1-CD2 4.22Å; A80-L123 HydrophobicContact CB-CB 4.21Å; A83-L123 HydrophobicContact CB-CD1 4.27Å; G119-L123 PolarHBondContact O-N 3.37Å; G119-L123 VanDerWaalsContact O-N 3.09Å; I120-L123 PolarHBondContact O-N 3.24Å; I120-L123 VanDerWaalsContact O-N 3.15Å; I121-L123 PolarHBondContact O-N 3.33Å
124	V	84.8	Confident	89	Confident	51 Å²	51	91.6 Å²	91.6	31%	0.309	49%	0.488	S	S	.	.	H	α-helix	trans	-68.1	-40.9	178.1	172.8	0	0	0	0	110.5	Y8 K77 A80 I120 I121 F122	Y8-V124 HydrophobicContact CE1-CG2 3.86Å; Y8-V124 HydrophobicContact CE2-CG1 4.36Å; K77-V124 PolarHBondContact NZ-O 3.04Å; A80-V124 HydrophobicContact CB-CG2 3.96Å; I120-V124 HydrophobicContact CG2-CG2 4.09Å; I120-V124 VanDerWaalsContact O-CG2 3.3Å; I120-V124 WeakPolarHBondContact O-CG2 3.26Å; I120-V124 PolarHBondContact O-N 3.32Å; I121-V124 PolarHBondContact O-N 3.19Å; F122-V124 VanDerWaalsContact C-N 3.33Å; F122-V124 PolarHBondContact O-N 3.21Å
125	C	85.2	Confident	88.6	Confident	92 Å²	92	90.4 Å²	90.4	62%	0.622	48%	0.482	S	S	*	.	H	α-helix	trans	-81	-15.1	-177.4	-71.6	0	0	0	0	115.2	I121 F122	I121-C125 VanDerWaalsContact O-CB 3.31Å; I121-C125 WeakPolarHBondContact O-CB 3.48Å; I121-C125 PolarHBondContact O-N 2.96Å; I121-C125 PolarHBondContact O-SG 2.98Å; I121-C125 VanDerWaalsContact O-SG 3.37Å; F122-C125 PolarHBondContact O-N 2.81Å
126	E	81.6	Confident	88	Confident	120 Å²	120	90.5 Å²	90.5	56%	0.561	47%	0.472	S	S	*	.			trans	-52.7	140.2	173.5	-171	173.7	-158.9	0	0	110.5	K77 F122	K77-E126 WeakPolarHBondContact CE-O 3.3Å; K77-E126 PolarHBondContact NZ-O 3.23Å; F122-E126 PolarHBondContact O-N 3.07Å
127	K	63	Low	87.5	Confident	260 Å²	260	91.3 Å²	91.3	100%	1.13	48%	0.475	S	S	*	.			trans	-88.4	0	-175.7	-75.8	-174.7	178.8	179.1	0	111.9

Retrieved 127 of 127 residues in 230.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).