G4V8R6_SCHMA Loading...

Family S9 non-peptidase homologue (S09 family)

AlphaFold DB , UniProt , Accession G4V8R6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 105 aa.

						>G4V8R6_SCHMA|G4V8R6
MPTGDKQPEKHKKESIIDLNKYIDKRIRVKFSGGREAVGILKGCDNLQNMVIDCTTEFLRDPDDPHRLTEDTRELALVVCRGPSVELVCPADGMESIPNPFVQQE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.7	Very low	59.4	Low	230 Å²	230	160.8 Å²	160.8	100%	1.133	85%	0.849	S	S	*	*				0	132.6	0	-60	-133.9	-170.1	0	0	106.8	T3	M1-T3 PolarHBondContact O-N 3Å
2	P	56.5	Low	59.6	Low	132 Å²	132	162.7 Å²	162.7	86%	0.857	84%	0.844	S	S	*	*			trans	-67	122.2	-168.4	29.4	-31.5	0	0	0	109	G4	P2-G4 PolarHBondContact O-N 3.24Å
3	T	56.3	Low	60.1	Low	129 Å²	129	165.6 Å²	165.6	79%	0.791	85%	0.846	S	S	*	*			trans	-65.3	111.4	172	39.3	0	0	0	0	108.2	M1 D5	M1-T3 PolarHBondContact O-N 3Å; T3-D5 PolarHBondContact O-N 3.34Å
4	G	58.1	Low	60.7	Low	71 Å²	71	166.4 Å²	166.4	73%	0.732	85%	0.845	S	S	*	*			trans	-67.8	111.4	175	0	0	0	0	0	110	P2 K6	P2-G4 PolarHBondContact O-N 3.24Å; G4-K6 PolarHBondContact O-N 3.21Å
5	D	59.7	Low	61.7	Low	155 Å²	155	158.6 Å²	158.6	83%	0.829	81%	0.812	S	S	*	*			trans	-58.9	104.5	168.6	-74.8	-41.9	0	0	0	109	T3 Q7	T3-D5 PolarHBondContact O-N 3.34Å; D5-Q7 PolarHBondContact O-N 2.86Å
6	K	60.6	Low	63	Low	204 Å²	204	159.5 Å²	159.5	89%	0.887	82%	0.816	S	S	*	*			trans	-64.6	101.7	166.1	-74.1	-176.7	175.6	-177.4	0	107.1	G4	G4-K6 PolarHBondContact O-N 3.21Å
7	Q	61.9	Low	64.2	Low	175 Å²	175	154.9 Å²	154.9	82%	0.818	79%	0.793	S	S	*	*			trans	-53.2	129.9	167.4	-78.2	-177.8	-12.3	0	0	108.3	D5 E9	D5-Q7 PolarHBondContact O-N 2.86Å; Q7-E9 PolarHBondContact O-N 3.15Å; Q7-E9 VanDerWaalsContact O-N 3.15Å
8	P	63.4	Low	65.6	Low	118 Å²	118	150.3 Å²	150.3	77%	0.766	77%	0.77	S	S	*	*			trans	-59.6	123.8	177.5	24	-31.1	0	0	0	107.9	K10	P8-K10 PolarHBondContact O-N 3.21Å
9	E	61.6	Low	66.9	Low	179 Å²	179	142.9 Å²	142.9	84%	0.836	73%	0.732	S	S	*	*			trans	-53.1	113.6	173.6	-76.2	-158.5	140.5	0	0	107.8	Q7 H11	Q7-E9 PolarHBondContact O-N 3.15Å; Q7-E9 VanDerWaalsContact O-N 3.15Å; E9-H11 VanDerWaalsContact C-N 3.35Å; E9-H11 PolarHBondContact O-CD2 2.99Å; E9-H11 PolarHBondContact O-N 3Å
10	K	63.3	Low	68.2	Low	200 Å²	200	140.5 Å²	140.5	87%	0.87	72%	0.721	S	S	*	*			trans	-62.1	103.1	172.4	-79.2	179.2	176.8	174.9	0	106.7	P8 K12	P8-K10 PolarHBondContact O-N 3.21Å; K10-K12 PolarHBondContact O-N 2.96Å
11	H	62.9	Low	69.3	Low	176 Å²	176	140.4 Å²	140.4	82%	0.815	72%	0.715	S	S	*	*			trans	-47.4	114.5	169.7	-73.8	-116.6	0	0	0	107.7	E9 K13	E9-H11 VanDerWaalsContact C-N 3.35Å; E9-H11 PolarHBondContact O-CD2 2.99Å; E9-H11 PolarHBondContact O-N 3Å; H11-K13 PolarHBondContact O-N 3.11Å; H11-K13 VanDerWaalsContact O-N 3.11Å
12	K	62.3	Low	71.5	Confident	183 Å²	183	132.8 Å²	132.8	80%	0.796	68%	0.675	S	S	*	*			trans	-57.9	119.9	175.7	-78.5	177.4	177.3	174.4	0	106.7	K10 E14	K10-K12 PolarHBondContact O-N 2.96Å; K12-E14 VanDerWaalsContact C-N 3.32Å; K12-E14 PolarHBondContact O-N 3.19Å
13	K	65.9	Low	73.4	Confident	201 Å²	201	129.5 Å²	129.5	87%	0.874	65%	0.649	S	S	*	*			trans	-68.3	97.2	171.7	-71.5	-175.6	176.7	-176.1	0	106.9	H11	H11-K13 PolarHBondContact O-N 3.11Å; H11-K13 VanDerWaalsContact O-N 3.11Å
14	E	68.4	Low	75.3	Confident	176 Å²	176	128.3 Å²	128.3	82%	0.822	64%	0.638	S	S	*	*			trans	-66.7	137.8	171.9	-66.3	-176.2	172.3	0	0	109	K12	K12-E14 VanDerWaalsContact C-N 3.32Å; K12-E14 PolarHBondContact O-N 3.19Å
15	S	75.4	Confident	77.2	Confident	50 Å²	50	130.3 Å²	130.3	35%	0.35	63%	0.626	S	S	.	*			trans	-67.8	132.1	174.3	174.5	0	0	0	0	108.9	I17 Q48	S15-I17 PolarHBondContact O-N 3.2Å; S15-I17 PolarHBondContact OG-N 3.27Å; S15-I17 PolarHBondContact OG-O 2.94Å; S15-Q48 PolarHBondContact OG-NE2 2.9Å; S15-Q48 VanDerWaalsContact OG-NE2 3.17Å
16	I	83	Confident	78.9	Confident	173 Å²	173	129.4 Å²	129.4	89%	0.887	61%	0.612	S	S	*	*	S	Bend	trans	-65.4	-18.8	172	51.8	158.1	0	0	0	112.6
17	I	83.5	Confident	80.6	Confident	82 Å²	82	119.7 Å²	119.7	42%	0.421	57%	0.569	S	S	.	*	S	Bend	trans	-106.3	120.8	178.7	-61.4	163.9	0	0	0	108.3	S15 L19	S15-I17 PolarHBondContact O-N 3.2Å; S15-I17 PolarHBondContact OG-N 3.27Å; S15-I17 PolarHBondContact OG-O 2.94Å; I17-L19 HydrophobicContact CG2-CD2 3.97Å; I17-L19 HydrophobicContact CG2-CG 4.16Å; I17-L19 PolarHBondContact O-N 3.36Å
18	D	88.6	Confident	82.2	Confident	71 Å²	71	113.6 Å²	113.6	38%	0.38	54%	0.539	S	S	.	.			trans	-88.6	90.5	171.2	-178	16.3	0	0	0	110.2	N20 K21	D18-N20 PolarHBondContact O-N 2.9Å; D18-N20 VanDerWaalsContact OD1-CB 3.27Å; D18-N20 WeakPolarHBondContact OD1-CB 3.22Å; D18-N20 PolarHBondContact OD1-N 3.15Å; D18-N20 PolarHBondContact OD1-ND2 3.17Å; D18-K21 HydrophobicContact CB-CD 4.27Å; D18-K21 HydrophobicContact CB-CG 4.34Å; D18-K21 PolarHBondContact O-N 2.95Å; D18-K21 VanDerWaalsContact OD2-CE 3.22Å; D18-K21 WeakPolarHBondContact OD2-CE 3.37Å; D18-K21 WeakPolarHBondContact OD2-CG 3.48Å
19	L	91.5	Very high	83.8	Confident	10 Å²	10	108 Å²	108	5%	0.052	50%	0.502	C	S	.	.	G	3₁₀ helix	trans	-65.3	-18.6	177.9	-72.3	175.3	0	0	0	112.8	I17 K21 Y22 L41 C44 Q48 M50 V88	I17-L19 HydrophobicContact CG2-CD2 3.97Å; I17-L19 HydrophobicContact CG2-CG 4.16Å; I17-L19 PolarHBondContact O-N 3.36Å; L19-K21 PolarHBondContact O-N 3.38Å; L19-K21 VanDerWaalsContact O-N 3.17Å; L19-Y22 PolarHBondContact O-N 3.28Å; L19-L41 HydrophobicContact CB-CD2 4.32Å; L19-L41 WeakPolarHBondContact O-CD2 3.27Å; L19-C44 HydrophobicContact CB-CB 4.21Å; L19-C44 WeakPolarHBondContact CB-SG 3.44Å; L19-C44 HydrophobicContact CD1-CB 4.03Å; L19-Q48 HydrophobicContact CD1-CB 4.3Å; L19-Q48 HydrophobicContact CD1-CG 4.28Å; L19-M50 HydrophobicContact CD1-CG 4.25Å; L19-M50 HydrophobicContact CD1-SD 4.24Å; L19-V88 HydrophobicContact CD2-CB 4.4Å; L19-V88 HydrophobicContact CD2-CG1 3.95Å
20	N	91.9	Very high	85.3	Confident	95 Å²	95	102.6 Å²	102.6	51%	0.508	48%	0.476	S	S	.	.	G	3₁₀ helix	trans	-62.1	-26.8	178.8	-59.8	-68.4	0	0	0	112.1	D18 Y22 I23	D18-N20 PolarHBondContact O-N 2.9Å; D18-N20 VanDerWaalsContact OD1-CB 3.27Å; D18-N20 WeakPolarHBondContact OD1-CB 3.22Å; D18-N20 PolarHBondContact OD1-N 3.15Å; D18-N20 PolarHBondContact OD1-ND2 3.17Å; N20-Y22 PolarHBondContact O-N 2.8Å; N20-Y22 VanDerWaalsContact O-N 3.15Å; N20-I23 HydrophobicContact CB-CD1 4.2Å; N20-I23 PolarHBondContact O-N 3.22Å; N20-I23 VanDerWaalsContact O-N 3.17Å
21	K	92.6	Very high	86.9	Confident	138 Å²	138	94.2 Å²	94.2	60%	0.6	44%	0.44	S	S	*	.	G	3₁₀ helix	trans	-63.7	-16.3	174.8	-62.2	179.9	-177.6	175.3	0	113.7	D18 L19 K25	D18-K21 HydrophobicContact CB-CD 4.27Å; D18-K21 HydrophobicContact CB-CG 4.34Å; D18-K21 PolarHBondContact O-N 2.95Å; D18-K21 VanDerWaalsContact OD2-CE 3.22Å; D18-K21 WeakPolarHBondContact OD2-CE 3.37Å; D18-K21 WeakPolarHBondContact OD2-CG 3.48Å; L19-K21 PolarHBondContact O-N 3.38Å; L19-K21 VanDerWaalsContact O-N 3.17Å; K21-K25 WeakPolarHBondContact O-CE 3.35Å; K21-K25 PolarHBondContact O-NZ 3.32Å
22	Y	94.6	Very high	88.3	Confident	71 Å²	71	88.6 Å²	88.6	28%	0.278	42%	0.42	S	S	.	.	G	3₁₀ helix	trans	-108.8	5.2	-179.6	-56.8	-77.5	0	0	0	113.1	L19 N20 D24 K25 I27 L41 P90	L19-Y22 PolarHBondContact O-N 3.28Å; N20-Y22 PolarHBondContact O-N 2.8Å; N20-Y22 VanDerWaalsContact O-N 3.15Å; Y22-D24 PolarHBondContact O-N 3.17Å; Y22-K25 HydrophobicContact CD1-CD 4.48Å; Y22-K25 WeakPolarHBondContact O-CB 3.36Å; Y22-K25 PolarHBondContact O-N 2.9Å; Y22-I27 HydrophobicContact CD1-CG2 4.47Å; Y22-I27 HydrophobicContact CG-CG2 4.33Å; Y22-L41 WeakPolarHBondContact O-CB 3.47Å; Y22-P90 HydrophobicContact CD1-CB 4.23Å; Y22-P90 HydrophobicContact CE1-CB 3.88Å; Y22-P90 HydrophobicContact CE1-CG 4.01Å
23	I	95.8	Very high	89.5	Confident	63 Å²	63	83.8 Å²	83.8	32%	0.323	42%	0.422	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57.4	137.2	171.8	-71.1	176.2	0	0	0	109.6	N20 K25	N20-I23 HydrophobicContact CB-CD1 4.2Å; N20-I23 PolarHBondContact O-N 3.22Å; N20-I23 VanDerWaalsContact O-N 3.17Å; I23-K25 PolarHBondContact O-N 3.17Å; I23-K25 VanDerWaalsContact O-N 3.13Å
24	D	96.8	Very high	90.7	Very high	103 Å²	103	74.7 Å²	74.7	55%	0.551	39%	0.386	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.3	15.7	-174	-67.6	-50	0	0	0	115	Y22 L41 K42	Y22-D24 PolarHBondContact O-N 3.17Å; D24-L41 PolarHBondContact N-O 3Å; D24-K42 IonicContact OD1-NZ 2.8Å; D24-K42 PolarHBondContact OD1-NZ 2.98Å
25	K	96.8	Very high	91.8	Very high	113 Å²	113	72.4 Å²	72.4	49%	0.491	37%	0.37	S	S	.	.	S	Bend	trans	-105.2	151.7	171.1	-59.1	-175	-174.4	159.8	0	111.1	K21 Y22 I23 I27 I40 L41	K21-K25 WeakPolarHBondContact O-CE 3.35Å; K21-K25 PolarHBondContact O-NZ 3.32Å; Y22-K25 HydrophobicContact CD1-CD 4.48Å; Y22-K25 WeakPolarHBondContact O-CB 3.36Å; Y22-K25 PolarHBondContact O-N 2.9Å; I23-K25 PolarHBondContact O-N 3.17Å; I23-K25 VanDerWaalsContact O-N 3.13Å; K25-I27 PolarHBondContact O-N 3.04Å; K25-I40 WeakPolarHBondContact O-CA 3.45Å; K25-L41 PolarHBondContact O-N 3.42Å
26	R	96.5	Very high	92.7	Very high	137 Å²	137	70.2 Å²	70.2	52%	0.517	35%	0.354	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.3	120.8	172.7	-164.7	172	-175.7	137.4	8.2	109.2	V38 G39 A91	R26-V38 HydrophobicContact CG-CG1 3.73Å; R26-G39 CarbonylContact C-O 3.59Å; R26-G39 VanDerWaalsContact CA-O 3.29Å; R26-G39 WeakPolarHBondContact CA-O 3.49Å; R26-A91 HydrophobicContact CB-CB 4.01Å; R26-A91 HydrophobicContact CG-CB 3.78Å; R26-A91 WeakPolarHBondContact O-CB 3.47Å; R26-A91 PolarHBondContact O-N 3.31Å
27	I	96.6	Very high	93.3	Very high	0 Å²	0	62.2 Å²	62.2	0%	0	31%	0.314	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.4	152.1	176.9	60.8	166.2	0	0	0	110	Y22 K25 V29 V38 G39 L41 M50 I52 V88 C89	Y22-I27 HydrophobicContact CD1-CG2 4.47Å; Y22-I27 HydrophobicContact CG-CG2 4.33Å; K25-I27 PolarHBondContact O-N 3.04Å; I27-V29 HydrophobicContact CD1-CG2 3.71Å; I27-V29 HydrophobicContact CG1-CG2 4.15Å; I27-V38 VanDerWaalsContact O-CA 3.3Å; I27-V38 WeakPolarHBondContact O-CA 3.47Å; I27-G39 PolarHBondContact N-O 3.15Å; I27-G39 PolarHBondContact O-N 3.46Å; I27-G39 VanDerWaalsContact O-N 3.08Å; I27-L41 HydrophobicContact CD1-CB 3.86Å; I27-L41 HydrophobicContact CD1-CD1 4.07Å; I27-L41 HydrophobicContact CD1-CD2 4.39Å; I27-L41 HydrophobicContact CD1-CG 4.33Å; I27-L41 HydrophobicContact CG1-CB 4.17Å; I27-L41 HydrophobicContact CG2-CB 4.48Å; I27-M50 HydrophobicContact CD1-SD 4.05Å; I27-I52 HydrophobicContact CD1-CD1 4.03Å; I27-I52 HydrophobicContact CG1-CD1 4.44Å; I27-V88 HydrophobicContact CB-CG1 4.38Å; I27-V88 HydrophobicContact CD1-CG1 4.09Å; I27-C89 CarbonylContact C-O 3.57Å; I27-C89 WeakPolarHBondContact CA-O 3.22Å
28	R	95.6	Very high	93.9	Very high	47 Å²	47	58.5 Å²	58.5	18%	0.177	30%	0.295	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.1	131.2	168.2	179.5	-180	-76.2	-91.8	1.8	108.2	E36 A37 V38 V88 C89 M94	R28-E36 WeakPolarHBondContact CD-OE1 3.37Å; R28-E36 HydrophobicContact CG-CG 4.31Å; R28-E36 IonicContact CZ-OE1 3.53Å; R28-E36 IonicContact NE-OE1 3.69Å; R28-E36 IonicContact NH1-OE1 2.65Å; R28-E36 PolarHBondContact NH1-OE1 3.48Å; R28-A37 CarbonylContact C-O 3.52Å; R28-A37 WeakPolarHBondContact CA-O 3.36Å; R28-V38 HydrophobicContact CB-CG2 3.76Å; R28-V38 HydrophobicContact CG-CG2 3.71Å; R28-V88 WeakPolarHBondContact O-CA 3.46Å; R28-C89 PolarHBondContact N-O 3.42Å; R28-C89 PolarHBondContact O-N 3.5Å; R28-M94 WeakPolarHBondContact CD-SD 3.47Å; R28-M94 PolarHBondContact NE-SD 2.65Å; R28-M94 VanDerWaalsContact NE-SD 3.36Å
29	V	95.8	Very high	94.3	Very high	0 Å²	0	55.1 Å²	55.1	0%	0	28%	0.277	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124	127.4	-176.5	-174.1	0	0	0	0	109	I27 F31 E36 A37 M50 I52 V85 L87 V88	I27-V29 HydrophobicContact CD1-CG2 3.71Å; I27-V29 HydrophobicContact CG1-CG2 4.15Å; V29-F31 HydrophobicContact CB-CE2 4.19Å; V29-F31 HydrophobicContact CB-CZ 4.16Å; V29-F31 HydrophobicContact CG1-CD1 4.49Å; V29-F31 HydrophobicContact CG1-CD2 4.45Å; V29-F31 HydrophobicContact CG1-CE1 3.9Å; V29-F31 HydrophobicContact CG1-CE2 3.85Å; V29-F31 HydrophobicContact CG1-CZ 3.52Å; V29-E36 WeakPolarHBondContact O-CA 3.48Å; V29-A37 PolarHBondContact N-O 3.49Å; V29-A37 PolarHBondContact O-N 3.17Å; V29-M50 HydrophobicContact CG1-CE 3.82Å; V29-M50 HydrophobicContact CG2-CE 4.09Å; V29-M50 HydrophobicContact CG2-SD 4.36Å; V29-I52 HydrophobicContact CG2-CD1 3.78Å; V29-V85 HydrophobicContact CG1-CG1 3.96Å; V29-V85 HydrophobicContact CG1-CG2 4.19Å; V29-L87 WeakPolarHBondContact CA-O 3.47Å; V29-V88 HydrophobicContact CG1-CG2 4.4Å; V29-V88 HydrophobicContact CG2-CG2 4.4Å
30	K	94.6	Very high	94.6	Very high	65 Å²	65	57.1 Å²	57.1	28%	0.283	29%	0.287	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.7	135.3	170	-59.6	-171.3	176.9	-164.7	0	109.7	E36 E86 L87	K30-E36 VanDerWaalsContact CE-CD 3.44Å; K30-E36 VanDerWaalsContact CE-OE1 3.27Å; K30-E36 WeakPolarHBondContact CE-OE1 3.39Å; K30-E36 WeakPolarHBondContact CE-OE2 3.14Å; K30-E36 HydrophobicContact CG-CG 4.18Å; K30-E36 IonicContact NZ-OE2 3.61Å; K30-E86 PolarHBondContact O-N 2.91Å; K30-L87 HydrophobicContact CB-CB 4.05Å; K30-L87 HydrophobicContact CD-CD2 4.01Å; K30-L87 HydrophobicContact CG-CB 4.37Å; K30-L87 HydrophobicContact CG-CD2 4.27Å; K30-L87 PolarHBondContact N-O 3.24Å; K30-L87 PolarHBondContact O-N 2.81Å
31	F	95.1	Very high	94.9	Very high	24 Å²	24	52.6 Å²	52.6	11%	0.105	26%	0.263	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.3	154.8	179.2	-59.1	-85.4	0	0	0	111.3	V29 G33 G34 R35 A37 C80 S84 V85	V29-F31 HydrophobicContact CB-CE2 4.19Å; V29-F31 HydrophobicContact CB-CZ 4.16Å; V29-F31 HydrophobicContact CG1-CD1 4.49Å; V29-F31 HydrophobicContact CG1-CD2 4.45Å; V29-F31 HydrophobicContact CG1-CE1 3.9Å; V29-F31 HydrophobicContact CG1-CE2 3.85Å; V29-F31 HydrophobicContact CG1-CZ 3.52Å; F31-G33 PolarHBondContact O-N 3.43Å; F31-G34 WeakPolarHBondContact O-CA 3.42Å; F31-G34 PolarHBondContact O-N 3.01Å; F31-R35 HydrophobicContact CB-CB 4.22Å; F31-R35 HydrophobicContact CD2-CB 4.11Å; F31-R35 WeakPolarHBondContact CD2-O 3.39Å; F31-R35 PolarHBondContact N-O 2.82Å; F31-A37 HydrophobicContact CE2-CB 4.1Å; F31-C80 HydrophobicContact CE1-CB 3.85Å; F31-C80 HydrophobicContact CZ-CB 3.8Å; F31-S84 CarbonylContact C-O 3.6Å; F31-S84 WeakPolarHBondContact CA-O 3.34Å; F31-S84 WeakPolarHBondContact CB-O 3.49Å; F31-V85 HydrophobicContact CD1-CG2 4.1Å; F31-V85 HydrophobicContact CE1-CG2 3.79Å
32	S	93.4	Very high	95.1	Very high	59 Å²	59	50.2 Å²	50.2	41%	0.413	25%	0.253	S	S	.	.	T	Hydrogen-bonded Turn	trans	-51.8	133.4	165.9	62.2	0	0	0	0	110.8	G34 S84 E86	S32-G34 VanDerWaalsContact C-N 3.32Å; S32-S84 PolarHBondContact N-O 2.85Å; S32-S84 PolarHBondContact OG-O 2.86Å; S32-E86 VanDerWaalsContact CA-OE1 3.23Å; S32-E86 WeakPolarHBondContact CA-OE1 3.41Å
33	G	88.3	Confident	95.2	Very high	81 Å²	81	47.8 Å²	47.8	84%	0.835	25%	0.249	S	C	*	.	T	Hydrogen-bonded Turn	trans	86.2	3.2	-171.8	0	0	0	0	0	113.9	F31	F31-G33 PolarHBondContact O-N 3.43Å
34	G	89.7	Confident	95.2	Very high	11 Å²	11	46.6 Å²	46.6	11%	0.113	25%	0.246	C	C	.	.	S	Bend	trans	95.8	-11.8	167.4	0	0	0	0	0	115.7	F31 S32 E36 R60	F31-G34 WeakPolarHBondContact O-CA 3.42Å; F31-G34 PolarHBondContact O-N 3.01Å; S32-G34 VanDerWaalsContact C-N 3.32Å; G34-E36 PolarHBondContact O-N 3.13Å; G34-R60 VanDerWaalsContact C-CZ 3.42Å; G34-R60 VanDerWaalsContact C-NH2 3.34Å; G34-R60 PolarHBondContact O-NE 2.92Å; G34-R60 PolarHBondContact O-NH2 2.65Å
35	R	92.1	Very high	95	Very high	128 Å²	128	45.1 Å²	45.1	48%	0.483	24%	0.238	S	C	.	.			trans	-55.5	139.6	-179.3	-61.7	177.5	65	-163.5	-2.1	110.8	F31 E57	F31-R35 HydrophobicContact CB-CB 4.22Å; F31-R35 HydrophobicContact CD2-CB 4.11Å; F31-R35 WeakPolarHBondContact CD2-O 3.39Å; F31-R35 PolarHBondContact N-O 2.82Å; R35-E57 IonicContact CZ-OE1 2.9Å; R35-E57 VanDerWaalsContact CZ-OE1 3.25Å; R35-E57 IonicContact NE-OE1 3.25Å; R35-E57 PolarHBondContact NE-OE1 2.79Å; R35-E57 VanDerWaalsContact NH2-CD 3.34Å; R35-E57 IonicContact NH2-OE1 3.34Å; R35-E57 PolarHBondContact NH2-OE1 3.07Å; R35-E57 IonicContact NH2-OE2 3.07Å; R35-E57 PolarHBondContact NH2-OE2 2.8Å
36	E	94.1	Very high	94.5	Very high	3 Å²	3	46.6 Å²	46.6	1%	0.014	25%	0.251	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.9	125.8	-175.5	-178.1	158.4	-177.9	0	0	109.6	R28 V29 K30 G34 E57 F58 L68	R28-E36 WeakPolarHBondContact CD-OE1 3.37Å; R28-E36 HydrophobicContact CG-CG 4.31Å; R28-E36 IonicContact CZ-OE1 3.53Å; R28-E36 IonicContact NE-OE1 3.69Å; R28-E36 IonicContact NH1-OE1 2.65Å; R28-E36 PolarHBondContact NH1-OE1 3.48Å; V29-E36 WeakPolarHBondContact O-CA 3.48Å; K30-E36 VanDerWaalsContact CE-CD 3.44Å; K30-E36 VanDerWaalsContact CE-OE1 3.27Å; K30-E36 WeakPolarHBondContact CE-OE1 3.39Å; K30-E36 WeakPolarHBondContact CE-OE2 3.14Å; K30-E36 HydrophobicContact CG-CG 4.18Å; K30-E36 IonicContact NZ-OE2 3.61Å; G34-E36 PolarHBondContact O-N 3.13Å; E36-E57 CarbonylContact O-C 3.56Å; E36-E57 WeakPolarHBondContact O-CA 3.16Å; E36-F58 HydrophobicContact CB-CB 4.39Å; E36-F58 HydrophobicContact CG-CD2 4.28Å; E36-F58 PolarHBondContact O-N 2.78Å; E36-L68 HydrophobicContact CB-CD2 4.26Å; E36-L68 WeakPolarHBondContact OE2-CD1 3.36Å
37	A	95.3	Very high	94.2	Very high	6 Å²	6	46 Å²	46	5%	0.05	26%	0.258	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.5	147.4	-177	0	0	0	0	0	110.9	R28 V29 F31 T55 T56	R28-A37 CarbonylContact C-O 3.52Å; R28-A37 WeakPolarHBondContact CA-O 3.36Å; V29-A37 PolarHBondContact N-O 3.49Å; V29-A37 PolarHBondContact O-N 3.17Å; F31-A37 HydrophobicContact CE2-CB 4.1Å; A37-T55 HydrophobicContact CB-CG2 3.92Å; A37-T56 CarbonylContact C-O 3.44Å; A37-T56 WeakPolarHBondContact CA-O 3.23Å
38	V	96.2	Very high	93.9	Very high	4 Å²	4	48.8 Å²	48.8	2%	0.024	27%	0.27	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.5	134.4	175.9	176.3	0	0	0	0	109	R26 I27 R28 T55 T56 F58	R26-V38 HydrophobicContact CG-CG1 3.73Å; I27-V38 VanDerWaalsContact O-CA 3.3Å; I27-V38 WeakPolarHBondContact O-CA 3.47Å; R28-V38 HydrophobicContact CB-CG2 3.76Å; R28-V38 HydrophobicContact CG-CG2 3.71Å; V38-T55 CarbonylContact O-C 3.59Å; V38-T55 WeakPolarHBondContact O-CA 3.42Å; V38-T56 PolarHBondContact N-O 2.83Å; V38-T56 PolarHBondContact O-N 2.96Å; V38-F58 HydrophobicContact CB-CE2 4.13Å; V38-F58 HydrophobicContact CG2-CD2 4.34Å; V38-F58 HydrophobicContact CG2-CE2 3.55Å; V38-F58 HydrophobicContact CG2-CZ 4.42Å
39	G	97.4	Very high	93.9	Very high	0 Å²	0	47.8 Å²	47.8	0%	0	27%	0.269	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-175.2	-172.2	175.4	0	0	0	0	0	111.7	R26 I27 I52 D53	R26-G39 CarbonylContact C-O 3.59Å; R26-G39 VanDerWaalsContact CA-O 3.29Å; R26-G39 WeakPolarHBondContact CA-O 3.49Å; I27-G39 PolarHBondContact N-O 3.15Å; I27-G39 PolarHBondContact O-N 3.46Å; I27-G39 VanDerWaalsContact O-N 3.08Å; G39-I52 VanDerWaalsContact C-CG2 3.44Å; G39-I52 VanDerWaalsContact CA-CG2 3.43Å; G39-D53 WeakPolarHBondContact CA-O 3.29Å
40	I	97.7	Very high	93.9	Very high	51 Å²	51	47.9 Å²	47.9	26%	0.262	27%	0.269	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.5	122.2	-177.3	-57.6	175.3	0	0	0	109.5	K25 K42 I52 D53	K25-I40 WeakPolarHBondContact O-CA 3.45Å; I40-K42 HydrophobicContact CG2-CD 4.37Å; I40-K42 PolarHBondContact O-N 2.87Å; I40-I52 CarbonylContact O-C 3.53Å; I40-I52 WeakPolarHBondContact O-CA 3.49Å; I40-D53 PolarHBondContact N-O 2.94Å; I40-D53 PolarHBondContact O-N 3.29Å
41	L	97.8	Very high	94.1	Very high	0 Å²	0	47.3 Å²	47.3	0%	0	27%	0.271	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.5	116.2	176.8	-179.2	64.5	0	0	0	110.3	L19 Y22 D24 K25 I27 G43 M50	L19-L41 HydrophobicContact CB-CD2 4.32Å; L19-L41 WeakPolarHBondContact O-CD2 3.27Å; Y22-L41 WeakPolarHBondContact O-CB 3.47Å; D24-L41 PolarHBondContact N-O 3Å; K25-L41 PolarHBondContact O-N 3.42Å; I27-L41 HydrophobicContact CD1-CB 3.86Å; I27-L41 HydrophobicContact CD1-CD1 4.07Å; I27-L41 HydrophobicContact CD1-CD2 4.39Å; I27-L41 HydrophobicContact CD1-CG 4.33Å; I27-L41 HydrophobicContact CG1-CB 4.17Å; I27-L41 HydrophobicContact CG2-CB 4.48Å; L41-G43 WeakPolarHBondContact CD1-O 3.39Å; L41-M50 HydrophobicContact CD1-CB 3.81Å; L41-M50 HydrophobicContact CD1-CG 3.91Å; L41-M50 HydrophobicContact CD1-SD 4.38Å
42	K	97.9	Very high	94.2	Very high	89 Å²	89	46.1 Å²	46.1	39%	0.387	27%	0.266	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.3	-23.6	177.8	-66.4	-59.7	-179.7	-178	0	113.9	D24 I40 V51 D53	D24-K42 IonicContact OD1-NZ 2.8Å; D24-K42 PolarHBondContact OD1-NZ 2.98Å; I40-K42 HydrophobicContact CG2-CD 4.37Å; I40-K42 PolarHBondContact O-N 2.87Å; K42-V51 HydrophobicContact CB-CB 4.37Å; K42-V51 HydrophobicContact CB-CG1 4.17Å; K42-V51 PolarHBondContact N-O 2.8Å; K42-D53 HydrophobicContact CD-CB 4.32Å; K42-D53 HydrophobicContact CG-CB 3.63Å
43	G	96.8	Very high	94.4	Very high	19 Å²	19	45.8 Å²	45.8	20%	0.196	26%	0.259	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-178.6	161	176.2	0	0	0	0	0	111.7	L41 M50 V51	L41-G43 WeakPolarHBondContact CD1-O 3.39Å; G43-M50 WeakPolarHBondContact O-CA 3.13Å; G43-V51 PolarHBondContact O-N 3.04Å
44	C	94.4	Very high	94.8	Very high	38 Å²	38	45.1 Å²	45.1	26%	0.257	24%	0.241	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-146.3	160.2	176.3	57.8	0	0	0	0	111.4	L19 N49 M50	L19-C44 HydrophobicContact CB-CB 4.21Å; L19-C44 WeakPolarHBondContact CB-SG 3.44Å; L19-C44 HydrophobicContact CD1-CB 4.03Å; C44-N49 CarbonylContact C-O 3.58Å; C44-N49 WeakPolarHBondContact CA-O 3.39Å; C44-M50 HydrophobicContact CB-CG 4.25Å
45	D	92.3	Very high	95.2	Very high	72 Å²	72	44.6 Å²	44.6	39%	0.385	24%	0.236	S	C	.	.			trans	-114.5	178.5	171.9	72.5	13.8	0	0	0	112.5	L47 Q48 N49	D45-L47 PolarHBondContact O-N 3.09Å; D45-L47 WeakPolarHBondContact OD1-CA 3.27Å; D45-L47 WeakPolarHBondContact OD1-CB 3.45Å; D45-L47 PolarHBondContact OD1-N 2.77Å; D45-Q48 PolarHBondContact O-N 3.26Å; D45-Q48 PolarHBondContact OD1-N 3.29Å; D45-Q48 VanDerWaalsContact OD1-N 3.11Å; D45-N49 PolarHBondContact N-O 2.83Å; D45-N49 VanDerWaalsContact N-O 3.09Å; D45-N49 WeakPolarHBondContact OD1-CB 3.29Å; D45-N49 PolarHBondContact OD1-N 3.22Å; D45-N49 PolarHBondContact OD1-ND2 2.88Å; D45-N49 WeakPolarHBondContact OD2-CB 3.21Å; D45-N49 PolarHBondContact OD2-ND2 3.11Å
46	N	88	Confident	95.4	Very high	144 Å²	144	39.2 Å²	39.2	77%	0.77	22%	0.217	S	C	*	.	T	Hydrogen-bonded Turn	trans	-66.8	-16.3	-179.8	-67.8	-19.7	0	0	0	113.9	Q48	N46-Q48 VanDerWaalsContact C-N 3.26Å
47	L	89	Confident	95.5	Very high	125 Å²	125	39.5 Å²	39.5	65%	0.654	22%	0.218	S	C	*	.	T	Hydrogen-bonded Turn	trans	-92.7	9.4	174.7	-62.2	179.1	0	0	0	111.5	D45 N49 G82	D45-L47 PolarHBondContact O-N 3.09Å; D45-L47 WeakPolarHBondContact OD1-CA 3.27Å; D45-L47 WeakPolarHBondContact OD1-CB 3.45Å; D45-L47 PolarHBondContact OD1-N 2.77Å; L47-N49 PolarHBondContact O-N 3.36Å; L47-G82 WeakPolarHBondContact O-CA 3.47Å
48	Q	90.8	Very high	95.4	Very high	58 Å²	58	41.5 Å²	41.5	27%	0.271	23%	0.226	S	C	.	.			trans	60.2	24.8	-177.4	-56.4	172.4	-19.1	0	0	113	S15 L19 D45 N46 G82	S15-Q48 PolarHBondContact OG-NE2 2.9Å; S15-Q48 VanDerWaalsContact OG-NE2 3.17Å; L19-Q48 HydrophobicContact CD1-CB 4.3Å; L19-Q48 HydrophobicContact CD1-CG 4.28Å; D45-Q48 PolarHBondContact O-N 3.26Å; D45-Q48 PolarHBondContact OD1-N 3.29Å; D45-Q48 VanDerWaalsContact OD1-N 3.11Å; N46-Q48 VanDerWaalsContact C-N 3.26Å; Q48-G82 WeakPolarHBondContact O-CA 3.38Å
49	N	94.9	Very high	95.2	Very high	26 Å²	26	44 Å²	44	14%	0.139	24%	0.239	C	C	.	.			trans	-67.8	136.9	162.9	-57.1	-58.4	0	0	0	107.7	C44 D45 L47 C80 G82	C44-N49 CarbonylContact C-O 3.58Å; C44-N49 WeakPolarHBondContact CA-O 3.39Å; D45-N49 PolarHBondContact N-O 2.83Å; D45-N49 VanDerWaalsContact N-O 3.09Å; D45-N49 WeakPolarHBondContact OD1-CB 3.29Å; D45-N49 PolarHBondContact OD1-N 3.22Å; D45-N49 PolarHBondContact OD1-ND2 2.88Å; D45-N49 WeakPolarHBondContact OD2-CB 3.21Å; D45-N49 PolarHBondContact OD2-ND2 3.11Å; L47-N49 PolarHBondContact O-N 3.36Å; N49-C80 VanDerWaalsContact CA-O 3.29Å; N49-C80 WeakPolarHBondContact CA-O 3.34Å; N49-G82 PolarHBondContact OD1-N 3.07Å
50	M	96.6	Very high	94.7	Very high	2 Å²	2	47.6 Å²	47.6	1%	0.01	25%	0.253	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.6	141.8	-174.3	-64.5	170.5	-72.3	0	0	110.1	L19 I27 V29 L41 G43 C44 I52 V79 C80 V85 V88	L19-M50 HydrophobicContact CD1-CG 4.25Å; L19-M50 HydrophobicContact CD1-SD 4.24Å; I27-M50 HydrophobicContact CD1-SD 4.05Å; V29-M50 HydrophobicContact CG1-CE 3.82Å; V29-M50 HydrophobicContact CG2-CE 4.09Å; V29-M50 HydrophobicContact CG2-SD 4.36Å; L41-M50 HydrophobicContact CD1-CB 3.81Å; L41-M50 HydrophobicContact CD1-CG 3.91Å; L41-M50 HydrophobicContact CD1-SD 4.38Å; G43-M50 WeakPolarHBondContact O-CA 3.13Å; C44-M50 HydrophobicContact CB-CG 4.25Å; M50-I52 HydrophobicContact CB-CD1 4.42Å; M50-I52 HydrophobicContact CB-CG1 4.11Å; M50-V79 CarbonylContact O-C 3.59Å; M50-V79 WeakPolarHBondContact O-CA 3.43Å; M50-C80 HydrophobicContact CB-CB 4.17Å; M50-C80 HydrophobicContact CE-CB 4.08Å; M50-C80 PolarHBondContact N-O 3.41Å; M50-C80 VanDerWaalsContact N-O 3.07Å; M50-C80 PolarHBondContact O-N 3.04Å; M50-V85 HydrophobicContact CE-CB 4.47Å; M50-V85 HydrophobicContact CE-CG1 4.17Å; M50-V85 HydrophobicContact CE-CG2 3.5Å; M50-V85 VanDerWaalsContact CE-CG2 3.5Å; M50-V88 HydrophobicContact CE-CG2 4.23Å; M50-V88 HydrophobicContact SD-CG2 4.14Å
51	V	98	Very high	94	Very high	53 Å²	53	46.9 Å²	46.9	32%	0.321	25%	0.25	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-100.3	119.3	165.5	-176.7	0	0	0	0	106.9	K42 G43 L77 V78	K42-V51 HydrophobicContact CB-CB 4.37Å; K42-V51 HydrophobicContact CB-CG1 4.17Å; K42-V51 PolarHBondContact N-O 2.8Å; G43-V51 PolarHBondContact O-N 3.04Å; V51-L77 HydrophobicContact CG1-CD1 3.67Å; V51-L77 HydrophobicContact CG1-CG 4.49Å; V51-V78 WeakPolarHBondContact CA-O 3.3Å
52	I	97.9	Very high	93.3	Very high	0 Å²	0	52.6 Å²	52.6	0%	0	29%	0.286	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.6	127.5	-178	-52.2	-176.2	0	0	0	108.6	I27 V29 G39 I40 M50 T55 L77 V78 C80	I27-I52 HydrophobicContact CD1-CD1 4.03Å; I27-I52 HydrophobicContact CG1-CD1 4.44Å; V29-I52 HydrophobicContact CG2-CD1 3.78Å; G39-I52 VanDerWaalsContact C-CG2 3.44Å; G39-I52 VanDerWaalsContact CA-CG2 3.43Å; I40-I52 CarbonylContact O-C 3.53Å; I40-I52 WeakPolarHBondContact O-CA 3.49Å; M50-I52 HydrophobicContact CB-CD1 4.42Å; M50-I52 HydrophobicContact CB-CG1 4.11Å; I52-T55 WeakPolarHBondContact CG2-OG1 3.39Å; I52-T55 PolarHBondContact O-OG1 3.25Å; I52-T55 VanDerWaalsContact O-OG1 3.11Å; I52-L77 WeakPolarHBondContact O-CA 3.35Å; I52-V78 HydrophobicContact CB-CG2 3.93Å; I52-V78 PolarHBondContact N-O 3.04Å; I52-V78 PolarHBondContact O-N 2.8Å; I52-C80 VanDerWaalsContact CD1-SG 3.52Å
53	D	98	Very high	92.7	Very high	51 Å²	51	55.6 Å²	55.6	27%	0.273	31%	0.307	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.3	156.7	178.6	-166.2	14.4	0	0	0	111.1	G39 I40 K42 T55 L77	G39-D53 WeakPolarHBondContact CA-O 3.29Å; I40-D53 PolarHBondContact N-O 2.94Å; I40-D53 PolarHBondContact O-N 3.29Å; K42-D53 HydrophobicContact CD-CB 4.32Å; K42-D53 HydrophobicContact CG-CB 3.63Å; D53-T55 VanDerWaalsContact C-N 3.27Å; D53-T55 PolarHBondContact O-N 3.08Å; D53-L77 HydrophobicContact CB-CD1 3.98Å
54	C	97	Very high	91.9	Very high	67 Å²	67	58 Å²	58	45%	0.453	32%	0.315	S	S	.	.	E	Extended strand (participates in β ladder)	trans	48.3	49.1	-173.2	-56.6	0	0	0	0	112.4	A76	C54-A76 PolarHBondContact N-O 2.82Å
55	T	97.7	Very high	91	Very high	1 Å²	1	60 Å²	60	1%	0.006	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.4	121	-172.7	-55.2	0	0	0	0	111.8	A37 V38 I52 D53 L75 A76 V78	A37-T55 HydrophobicContact CB-CG2 3.92Å; V38-T55 CarbonylContact O-C 3.59Å; V38-T55 WeakPolarHBondContact O-CA 3.42Å; I52-T55 WeakPolarHBondContact CG2-OG1 3.39Å; I52-T55 PolarHBondContact O-OG1 3.25Å; I52-T55 VanDerWaalsContact O-OG1 3.11Å; D53-T55 VanDerWaalsContact C-N 3.27Å; D53-T55 PolarHBondContact O-N 3.08Å; T55-L75 PolarHBondContact O-N 3.32Å; T55-A76 WeakPolarHBondContact CB-O 3.43Å; T55-A76 PolarHBondContact N-O 2.97Å; T55-A76 PolarHBondContact OG1-O 2.88Å; T55-A76 VanDerWaalsContact OG1-O 3.07Å; T55-V78 HydrophobicContact CG2-CG1 4.27Å; T55-V78 HydrophobicContact CG2-CG2 3.91Å; T55-V78 WeakPolarHBondContact OG1-CG2 3.46Å
56	T	96.6	Very high	90.1	Very high	15 Å²	15	64.4 Å²	64.4	9%	0.092	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.6	121.3	168.8	-49.2	0	0	0	0	109	A37 V38 T72 R73 E74	A37-T56 CarbonylContact C-O 3.44Å; A37-T56 WeakPolarHBondContact CA-O 3.23Å; V38-T56 PolarHBondContact N-O 2.83Å; V38-T56 PolarHBondContact O-N 2.96Å; T56-T72 HydrophobicContact CG2-CG2 3.79Å; T56-R73 WeakPolarHBondContact CA-O 3.36Å; T56-E74 WeakPolarHBondContact CB-OE1 3.35Å; T56-E74 WeakPolarHBondContact CG2-OE1 3.33Å; T56-E74 PolarHBondContact OG1-OE1 2.64Å
57	E	95.9	Very high	89.6	Confident	8 Å²	8	65.2 Å²	65.2	4%	0.037	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.9	133	171.7	178.1	174.1	-164.8	0	0	110.7	R35 E36 T72 R73 L75	R35-E57 IonicContact CZ-OE1 2.9Å; R35-E57 VanDerWaalsContact CZ-OE1 3.25Å; R35-E57 IonicContact NE-OE1 3.25Å; R35-E57 PolarHBondContact NE-OE1 2.79Å; R35-E57 VanDerWaalsContact NH2-CD 3.34Å; R35-E57 IonicContact NH2-OE1 3.34Å; R35-E57 PolarHBondContact NH2-OE1 3.07Å; R35-E57 IonicContact NH2-OE2 3.07Å; R35-E57 PolarHBondContact NH2-OE2 2.8Å; E36-E57 CarbonylContact O-C 3.56Å; E36-E57 WeakPolarHBondContact O-CA 3.16Å; E57-T72 CarbonylContact O-C 3.56Å; E57-T72 WeakPolarHBondContact O-CA 3.45Å; E57-R73 HydrophobicContact CB-CG 3.91Å; E57-R73 VanDerWaalsContact CD-NH2 3.31Å; E57-R73 PolarHBondContact N-O 2.62Å; E57-R73 PolarHBondContact O-N 2.86Å; E57-R73 IonicContact OE1-NH2 2.65Å; E57-R73 PolarHBondContact OE1-NH2 3.41Å; E57-R73 IonicContact OE2-CZ 3.07Å; E57-R73 IonicContact OE2-NE 2.71Å; E57-R73 PolarHBondContact OE2-NE 3.47Å; E57-R73 IonicContact OE2-NH2 2.74Å; E57-R73 PolarHBondContact OE2-NH2 2.67Å; E57-L75 HydrophobicContact CB-CD1 4.1Å
58	F	93.1	Very high	88.7	Confident	48 Å²	48	62.5 Å²	62.5	21%	0.211	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86	122.1	172.1	-66.5	-96.8	0	0	0	109	E36 V38 L68 T72	E36-F58 HydrophobicContact CB-CB 4.39Å; E36-F58 HydrophobicContact CG-CD2 4.28Å; E36-F58 PolarHBondContact O-N 2.78Å; V38-F58 HydrophobicContact CB-CE2 4.13Å; V38-F58 HydrophobicContact CG2-CD2 4.34Å; V38-F58 HydrophobicContact CG2-CE2 3.55Å; V38-F58 HydrophobicContact CG2-CZ 4.42Å; F58-L68 HydrophobicContact CB-CD2 3.73Å; F58-T72 HydrophobicContact CD1-CG2 3.87Å; F58-T72 HydrophobicContact CE1-CG2 3.91Å; F58-T72 HydrophobicContact CG-CG2 4.39Å; F58-T72 HydrophobicContact CZ-CG2 4.45Å
59	L	91	Very high	88.2	Confident	57 Å²	57	61.1 Å²	61.1	30%	0.298	32%	0.319	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.4	151.2	178.6	-58.6	179.6	0	0	0	109.8	T69 D71 R73	L59-T69 PolarHBondContact O-N 2.85Å; L59-T69 PolarHBondContact O-OG1 3.04Å; L59-T69 VanDerWaalsContact O-OG1 3.07Å; L59-D71 HydrophobicContact CB-CB 4.18Å; L59-D71 WeakPolarHBondContact CB-O 3.11Å; L59-D71 HydrophobicContact CD1-CB 4Å; L59-D71 HydrophobicContact CG-CB 4.43Å; L59-D71 PolarHBondContact N-O 2.91Å; L59-R73 HydrophobicContact CD2-CG 4.11Å
60	R	86.6	Confident	87.6	Confident	75 Å²	75	69 Å²	69	28%	0.283	36%	0.355	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.6	152.1	174.7	-71.9	-170.5	171.8	-131.3	-2.7	109.4	G34 P65	G34-R60 VanDerWaalsContact C-CZ 3.42Å; G34-R60 VanDerWaalsContact C-NH2 3.34Å; G34-R60 PolarHBondContact O-NE 2.92Å; G34-R60 PolarHBondContact O-NH2 2.65Å; R60-P65 WeakPolarHBondContact CD-O 3.44Å; R60-P65 PolarHBondContact NH1-O 2.82Å
61	D	84.1	Confident	87.3	Confident	37 Å²	37	73.7 Å²	73.7	20%	0.198	38%	0.381	C	S	.	.	P	Polyproline II helix	trans	-62.8	125.2	173.7	-166.9	-40.1	0	0	0	108.3	D63 D64 R67 T69	D61-D63 PolarHBondContact O-N 2.82Å; D61-D63 WeakPolarHBondContact OD1-CB 3.48Å; D61-D63 PolarHBondContact OD1-N 2.93Å; D61-D64 HydrophobicContact CB-CB 4.43Å; D61-D64 CarbonylContact O-C 3.3Å; D61-D64 VanDerWaalsContact O-C 3.3Å; D61-D64 PolarHBondContact O-N 2.85Å; D61-D64 PolarHBondContact OD1-N 2.83Å; D61-R67 HydrophobicContact CB-CB 4.12Å; D61-R67 PolarHBondContact N-O 3.22Å; D61-T69 HydrophobicContact CB-CG2 3.85Å
62	P	83	Confident	87.1	Confident	119 Å²	119	74.7 Å²	74.7	77%	0.773	39%	0.387	S	S	*	.	S	Bend	trans	-63.4	-24.6	177.9	24.5	-32.4	0	0	0	112.8
63	D	84.5	Confident	87	Confident	153 Å²	153	80 Å²	80	82%	0.818	41%	0.407	S	S	*	.	S	Bend	trans	-90.2	-29.1	-179.8	-63.1	-38.9	0	0	0	112.3	D61	D61-D63 PolarHBondContact O-N 2.82Å; D61-D63 WeakPolarHBondContact OD1-CB 3.48Å; D61-D63 PolarHBondContact OD1-N 2.93Å
64	D	81.1	Confident	87	Confident	69 Å²	69	83.6 Å²	83.6	37%	0.369	42%	0.422	S	S	.	.			trans	-129.3	97.2	175.3	-175.2	-1.5	0	0	0	111.8	D61 H66 R67	D61-D64 HydrophobicContact CB-CB 4.43Å; D61-D64 CarbonylContact O-C 3.3Å; D61-D64 VanDerWaalsContact O-C 3.3Å; D61-D64 PolarHBondContact O-N 2.85Å; D61-D64 PolarHBondContact OD1-N 2.83Å; D64-H66 PolarHBondContact O-N 3.07Å; D64-H66 WeakPolarHBondContact OD1-CB 3.4Å; D64-H66 IonicContact OD1-CD2 3.7Å; D64-H66 IonicContact OD1-CG 3.93Å; D64-H66 PolarHBondContact OD1-N 3.11Å; D64-R67 HydrophobicContact CB-CB 4.11Å; D64-R67 PolarHBondContact O-N 3.34Å
65	P	75.4	Confident	87	Confident	80 Å²	80	83.5 Å²	83.5	52%	0.519	42%	0.416	S	S	.	.	T	Hydrogen-bonded Turn	trans	-58.6	-13.7	177.3	-24.7	34	0	0	0	114.1	R60	R60-P65 WeakPolarHBondContact CD-O 3.44Å; R60-P65 PolarHBondContact NH1-O 2.82Å
66	H	73.9	Confident	86.9	Confident	165 Å²	165	86.2 Å²	86.2	76%	0.764	44%	0.439	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.3	-11.5	177.8	-61.9	-74.3	0	0	0	113.6	D64	D64-H66 PolarHBondContact O-N 3.07Å; D64-H66 WeakPolarHBondContact OD1-CB 3.4Å; D64-H66 IonicContact OD1-CD2 3.7Å; D64-H66 IonicContact OD1-CG 3.93Å; D64-H66 PolarHBondContact OD1-N 3.11Å
67	R	76	Confident	87	Confident	160 Å²	160	90.7 Å²	90.7	60%	0.604	46%	0.462	S	S	*	.	P	Polyproline II helix	trans	-97.1	119.6	-179.6	-168.7	174.4	179.6	170.8	-2.2	110.8	D61 D64	D61-R67 HydrophobicContact CB-CB 4.12Å; D61-R67 PolarHBondContact N-O 3.22Å; D64-R67 HydrophobicContact CB-CB 4.11Å; D64-R67 PolarHBondContact O-N 3.34Å
68	L	71.6	Confident	87.1	Confident	69 Å²	69	91.7 Å²	91.7	36%	0.361	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.8	128.4	163.9	-75.4	153.9	0	0	0	107.8	E36 F58	E36-L68 HydrophobicContact CB-CD2 4.26Å; E36-L68 WeakPolarHBondContact OE2-CD1 3.36Å; F58-L68 HydrophobicContact CB-CD2 3.73Å
69	T	79.3	Confident	87.3	Confident	29 Å²	29	94.5 Å²	94.5	18%	0.178	49%	0.49	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.8	164.5	166.4	62.4	0	0	0	0	108.9	L59 D61 D71	L59-T69 PolarHBondContact O-N 2.85Å; L59-T69 PolarHBondContact O-OG1 3.04Å; L59-T69 VanDerWaalsContact O-OG1 3.07Å; D61-T69 HydrophobicContact CB-CG2 3.85Å; T69-D71 PolarHBondContact O-N 2.93Å; T69-D71 WeakPolarHBondContact OG1-CB 3.39Å; T69-D71 PolarHBondContact OG1-N 2.86Å
70	E	82.1	Confident	87.5	Confident	190 Å²	190	92.2 Å²	92.2	89%	0.888	48%	0.478	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.3	-6.4	169.3	-63.9	-172.7	170.5	0	0	111.7	T72	E70-T72 PolarHBondContact O-N 2.97Å
71	D	89.9	Confident	88	Confident	102 Å²	102	96.6 Å²	96.6	55%	0.545	50%	0.495	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.1	128.8	-178.9	-58.7	-43.1	0	0	0	110.8	L59 T69	L59-D71 HydrophobicContact CB-CB 4.18Å; L59-D71 WeakPolarHBondContact CB-O 3.11Å; L59-D71 HydrophobicContact CD1-CB 4Å; L59-D71 HydrophobicContact CG-CB 4.43Å; L59-D71 PolarHBondContact N-O 2.91Å; T69-D71 PolarHBondContact O-N 2.93Å; T69-D71 WeakPolarHBondContact OG1-CB 3.39Å; T69-D71 PolarHBondContact OG1-N 2.86Å
72	T	94.8	Very high	88.5	Confident	74 Å²	74	95 Å²	95	45%	0.454	49%	0.488	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.2	151	177.4	58.6	0	0	0	0	111.1	T56 E57 F58 E70	T56-T72 HydrophobicContact CG2-CG2 3.79Å; E57-T72 CarbonylContact O-C 3.56Å; E57-T72 WeakPolarHBondContact O-CA 3.45Å; F58-T72 HydrophobicContact CD1-CG2 3.87Å; F58-T72 HydrophobicContact CE1-CG2 3.91Å; F58-T72 HydrophobicContact CG-CG2 4.39Å; F58-T72 HydrophobicContact CZ-CG2 4.45Å; E70-T72 PolarHBondContact O-N 2.97Å
73	R	95.5	Very high	89	Confident	112 Å²	112	94.5 Å²	94.5	42%	0.423	48%	0.484	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.2	140.8	167.4	67.4	175.3	179.6	-165	-2.7	111.9	T56 E57 L59 L75	T56-R73 WeakPolarHBondContact CA-O 3.36Å; E57-R73 HydrophobicContact CB-CG 3.91Å; E57-R73 VanDerWaalsContact CD-NH2 3.31Å; E57-R73 PolarHBondContact N-O 2.62Å; E57-R73 PolarHBondContact O-N 2.86Å; E57-R73 IonicContact OE1-NH2 2.65Å; E57-R73 PolarHBondContact OE1-NH2 3.41Å; E57-R73 IonicContact OE2-CZ 3.07Å; E57-R73 IonicContact OE2-NE 2.71Å; E57-R73 PolarHBondContact OE2-NE 3.47Å; E57-R73 IonicContact OE2-NH2 2.74Å; E57-R73 PolarHBondContact OE2-NH2 2.67Å; L59-R73 HydrophobicContact CD2-CG 4.11Å; R73-L75 HydrophobicContact CG-CD2 4.34Å
74	E	97.1	Very high	89.6	Confident	125 Å²	125	89.5 Å²	89.5	58%	0.584	46%	0.461	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.9	129.3	175.3	-68.1	-61.5	135.1	0	0	110.4	T56	T56-E74 WeakPolarHBondContact CB-OE1 3.35Å; T56-E74 WeakPolarHBondContact CG2-OE1 3.33Å; T56-E74 PolarHBondContact OG1-OE1 2.64Å
75	L	97.3	Very high	90.2	Very high	65 Å²	65	87.4 Å²	87.4	34%	0.34	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.3	-5.6	178.4	-60.3	179	0	0	0	112.9	T55 E57 R73 L77 V78	T55-L75 PolarHBondContact O-N 3.32Å; E57-L75 HydrophobicContact CB-CD1 4.1Å; R73-L75 HydrophobicContact CG-CD2 4.34Å; L75-L77 PolarHBondContact O-N 2.7Å; L75-V78 HydrophobicContact CB-CG1 3.51Å; L75-V78 HydrophobicContact CD1-CG1 4.09Å; L75-V78 HydrophobicContact CG-CG1 4.47Å
76	A	96.7	Very high	91.1	Very high	58 Å²	58	90.1 Å²	90.1	48%	0.479	46%	0.457	S	S	.	.	E	Extended strand (participates in β ladder)	trans	56.2	-116.1	-174.8	0	0	0	0	0	112.2	C54 T55	C54-A76 PolarHBondContact N-O 2.82Å; T55-A76 WeakPolarHBondContact CB-O 3.43Å; T55-A76 PolarHBondContact N-O 2.97Å; T55-A76 PolarHBondContact OG1-O 2.88Å; T55-A76 VanDerWaalsContact OG1-O 3.07Å
77	L	98	Very high	92	Very high	109 Å²	109	86.2 Å²	86.2	57%	0.571	44%	0.441	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-90.3	121.1	-178.5	-174.6	68.9	0	0	0	110.8	V51 I52 D53 L75	V51-L77 HydrophobicContact CG1-CD1 3.67Å; V51-L77 HydrophobicContact CG1-CG 4.49Å; I52-L77 WeakPolarHBondContact O-CA 3.35Å; D53-L77 HydrophobicContact CB-CD1 3.98Å; L75-L77 PolarHBondContact O-N 2.7Å
78	V	97.7	Very high	92.9	Very high	29 Å²	29	80.6 Å²	80.6	18%	0.176	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	156.5	-179.8	-52.6	0	0	0	0	112.1	V51 I52 T55 L75	V51-V78 WeakPolarHBondContact CA-O 3.3Å; I52-V78 HydrophobicContact CB-CG2 3.93Å; I52-V78 PolarHBondContact N-O 3.04Å; I52-V78 PolarHBondContact O-N 2.8Å; T55-V78 HydrophobicContact CG2-CG1 4.27Å; T55-V78 HydrophobicContact CG2-CG2 3.91Å; T55-V78 WeakPolarHBondContact OG1-CG2 3.46Å; L75-V78 HydrophobicContact CB-CG1 3.51Å; L75-V78 HydrophobicContact CD1-CG1 4.09Å; L75-V78 HydrophobicContact CG-CG1 4.47Å
79	V	97.4	Very high	93.9	Very high	108 Å²	108	78.7 Å²	78.7	66%	0.655	42%	0.416	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-110.8	117.1	166.6	-178.3	0	0	0	0	108.8	M50	M50-V79 CarbonylContact O-C 3.59Å; M50-V79 WeakPolarHBondContact O-CA 3.43Å
80	C	96.5	Very high	94.6	Very high	9 Å²	9	79.5 Å²	79.5	6%	0.061	42%	0.422	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.2	134.2	177.3	-58	0	0	0	0	110.1	F31 N49 M50 I52	F31-C80 HydrophobicContact CE1-CB 3.85Å; F31-C80 HydrophobicContact CZ-CB 3.8Å; N49-C80 VanDerWaalsContact CA-O 3.29Å; N49-C80 WeakPolarHBondContact CA-O 3.34Å; M50-C80 HydrophobicContact CB-CB 4.17Å; M50-C80 HydrophobicContact CE-CB 4.08Å; M50-C80 PolarHBondContact N-O 3.41Å; M50-C80 VanDerWaalsContact N-O 3.07Å; M50-C80 PolarHBondContact O-N 3.04Å; I52-C80 VanDerWaalsContact CD1-SG 3.52Å
81	R	96.3	Very high	94.9	Very high	166 Å²	166	71.8 Å²	71.8	63%	0.626	39%	0.391	S	S	*	.			trans	-84.9	113.5	178.9	-65.5	-72.1	-67.1	-178.4	-0.8	109.7	P83 S84	R81-P83 VanDerWaalsContact C-CD 3.44Å; R81-P83 VanDerWaalsContact C-N 3.35Å; R81-S84 PolarHBondContact O-N 3.05Å
82	G	94.2	Very high	94.8	Very high	5 Å²	5	74 Å²	74	5%	0.052	40%	0.403	C	S	.	.	G	3₁₀ helix	trans	-52.3	-40.6	-178.9	0	0	0	0	0	115.3	L47 Q48 N49 S84 V85	L47-G82 WeakPolarHBondContact O-CA 3.47Å; Q48-G82 WeakPolarHBondContact O-CA 3.38Å; N49-G82 PolarHBondContact OD1-N 3.07Å; G82-S84 PolarHBondContact O-N 2.87Å; G82-V85 WeakPolarHBondContact O-CB 3.42Å; G82-V85 PolarHBondContact O-N 2.89Å
83	P	94.8	Very high	94.5	Very high	107 Å²	107	74.2 Å²	74.2	70%	0.695	42%	0.419	S	S	*	.	G	3₁₀ helix	trans	-60.7	-17.5	177.5	-27.6	36.3	0	0	0	115.8	R81	R81-P83 VanDerWaalsContact C-CD 3.44Å; R81-P83 VanDerWaalsContact C-N 3.35Å
84	S	95.5	Very high	94.1	Very high	48 Å²	48	73.6 Å²	73.6	34%	0.336	42%	0.422	S	S	.	.	G	3₁₀ helix	trans	-99.2	-1.1	177.6	-61.5	0	0	0	0	112.8	F31 S32 R81 G82	F31-S84 CarbonylContact C-O 3.6Å; F31-S84 WeakPolarHBondContact CA-O 3.34Å; F31-S84 WeakPolarHBondContact CB-O 3.49Å; S32-S84 PolarHBondContact N-O 2.85Å; S32-S84 PolarHBondContact OG-O 2.86Å; R81-S84 PolarHBondContact O-N 3.05Å; G82-S84 PolarHBondContact O-N 2.87Å
85	V	94.9	Very high	93.7	Very high	26 Å²	26	75.1 Å²	75.1	16%	0.158	43%	0.429	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.5	126	-177.3	177.3	0	0	0	0	109.5	V29 F31 M50 G82 V88	V29-V85 HydrophobicContact CG1-CG1 3.96Å; V29-V85 HydrophobicContact CG1-CG2 4.19Å; F31-V85 HydrophobicContact CD1-CG2 4.1Å; F31-V85 HydrophobicContact CE1-CG2 3.79Å; M50-V85 HydrophobicContact CE-CB 4.47Å; M50-V85 HydrophobicContact CE-CG1 4.17Å; M50-V85 HydrophobicContact CE-CG2 3.5Å; M50-V85 VanDerWaalsContact CE-CG2 3.5Å; G82-V85 WeakPolarHBondContact O-CB 3.42Å; G82-V85 PolarHBondContact O-N 2.89Å; V85-V88 HydrophobicContact CG1-CG2 3.6Å
86	E	94.1	Very high	93.2	Very high	137 Å²	137	78.1 Å²	78.1	64%	0.64	46%	0.456	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.7	-38.8	176.1	-69.6	-176.2	167.9	0	0	112.1	K30 S32	K30-E86 PolarHBondContact O-N 2.91Å; S32-E86 VanDerWaalsContact CA-OE1 3.23Å; S32-E86 WeakPolarHBondContact CA-OE1 3.41Å
87	L	93.4	Very high	92.8	Very high	82 Å²	82	80.2 Å²	80.2	43%	0.429	46%	0.458	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.3	138.4	-177.2	-175	79.4	0	0	0	110.2	V29 K30	V29-L87 WeakPolarHBondContact CA-O 3.47Å; K30-L87 HydrophobicContact CB-CB 4.05Å; K30-L87 HydrophobicContact CD-CD2 4.01Å; K30-L87 HydrophobicContact CG-CB 4.37Å; K30-L87 HydrophobicContact CG-CD2 4.27Å; K30-L87 PolarHBondContact N-O 3.24Å; K30-L87 PolarHBondContact O-N 2.81Å
88	V	94.1	Very high	92.5	Very high	43 Å²	43	79.6 Å²	79.6	26%	0.261	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.9	124.7	164.6	-176.8	0	0	0	0	108	L19 I27 R28 V29 M50 V85	L19-V88 HydrophobicContact CD2-CB 4.4Å; L19-V88 HydrophobicContact CD2-CG1 3.95Å; I27-V88 HydrophobicContact CB-CG1 4.38Å; I27-V88 HydrophobicContact CD1-CG1 4.09Å; R28-V88 WeakPolarHBondContact O-CA 3.46Å; V29-V88 HydrophobicContact CG1-CG2 4.4Å; V29-V88 HydrophobicContact CG2-CG2 4.4Å; M50-V88 HydrophobicContact CE-CG2 4.23Å; M50-V88 HydrophobicContact SD-CG2 4.14Å; V85-V88 HydrophobicContact CG1-CG2 3.6Å
89	C	93.3	Very high	92.1	Very high	28 Å²	28	82.8 Å²	82.8	19%	0.189	48%	0.477	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.3	148.7	173.3	53.3	0	0	0	0	111.2	I27 R28 A91	I27-C89 CarbonylContact C-O 3.57Å; I27-C89 WeakPolarHBondContact CA-O 3.22Å; R28-C89 PolarHBondContact N-O 3.42Å; R28-C89 PolarHBondContact O-N 3.5Å; C89-A91 PolarHBondContact O-N 2.74Å
90	P	94.1	Very high	91.8	Very high	47 Å²	47	82.2 Å²	82.2	31%	0.305	48%	0.475	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-60.1	138.6	166.3	26.7	-32.4	0	0	0	109.2	Y22	Y22-P90 HydrophobicContact CD1-CB 4.23Å; Y22-P90 HydrophobicContact CE1-CB 3.88Å; Y22-P90 HydrophobicContact CE1-CG 4.01Å
91	A	88	Confident	91.6	Very high	27 Å²	27	90.8 Å²	90.8	22%	0.223	51%	0.512	C	S	.	.	S	Bend	trans	-72.5	-25.8	173.7	0	0	0	0	0	111.6	R26 C89 M94	R26-A91 HydrophobicContact CB-CB 4.01Å; R26-A91 HydrophobicContact CG-CB 3.78Å; R26-A91 WeakPolarHBondContact O-CB 3.47Å; R26-A91 PolarHBondContact O-N 3.31Å; C89-A91 PolarHBondContact O-N 2.74Å; A91-M94 PolarHBondContact O-N 2.9Å
92	D	87.8	Confident	91.2	Very high	149 Å²	149	87.4 Å²	87.4	80%	0.797	51%	0.509	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.1	134.6	174.3	-168.7	18.4	0	0	0	110.9	M94	D92-M94 VanDerWaalsContact C-N 3.28Å; D92-M94 PolarHBondContact O-N 3.34Å
93	G	87.1	Confident	90.5	Very high	78 Å²	78	95.6 Å²	95.6	80%	0.804	55%	0.546	S	S	*	.	T	Hydrogen-bonded Turn	trans	77.6	2.3	-174	0	0	0	0	0	115.6
94	M	87.4	Confident	89.5	Confident	99 Å²	99	98.7 Å²	98.7	49%	0.488	55%	0.551	S	S	.	*			trans	-91.5	120	173.2	-177	178.9	-177	0	0	110.5	R28 A91 D92	R28-M94 WeakPolarHBondContact CD-SD 3.47Å; R28-M94 PolarHBondContact NE-SD 2.65Å; R28-M94 VanDerWaalsContact NE-SD 3.36Å; A91-M94 PolarHBondContact O-N 2.9Å; D92-M94 VanDerWaalsContact C-N 3.28Å; D92-M94 PolarHBondContact O-N 3.34Å
95	E	88.4	Confident	88	Confident	157 Å²	157	109.2 Å²	109.2	73%	0.734	60%	0.595	S	S	*	*			trans	-133.4	150.1	173.4	62	178.4	-178	0	0	111.5	I97	E95-I97 HydrophobicContact CG-CG2 3.87Å
96	S	87	Confident	87.6	Confident	128 Å²	128	113.4 Å²	113.4	90%	0.895	62%	0.617	S	S	*	*			trans	-80.6	121.1	169.8	-171.1	0	0	0	0	108.2
97	I	89.8	Confident	87.3	Confident	103 Å²	103	112.2 Å²	112.2	53%	0.528	62%	0.616	S	S	.	*			trans	-109.8	151	179.1	61.8	172.4	0	0	0	110.5	E95	E95-I97 HydrophobicContact CG-CG2 3.87Å
98	P	89.8	Confident	86.9	Confident	95 Å²	95	113.8 Å²	113.8	62%	0.617	63%	0.626	S	S	*	*			trans	-61.8	164.9	165.3	29.4	-35.3	0	0	0	110.3	P100	P98-P100 WeakPolarHBondContact O-CD 3.45Å; P98-P100 VanDerWaalsContact O-N 3.11Å
99	N	91.2	Very high	86.5	Confident	97 Å²	97	118 Å²	118	52%	0.519	65%	0.648	S	S	.	*			trans	-57.5	117.3	176.9	-177.4	-21.8	0	0	0	110.4	F101 V102	N99-F101 PolarHBondContact O-N 2.71Å; N99-F101 VanDerWaalsContact O-N 3.15Å; N99-F101 WeakPolarHBondContact OD1-CD2 3.44Å; N99-F101 PolarHBondContact OD1-N 3.07Å; N99-V102 HydrophobicContact CB-CB 4.49Å; N99-V102 HydrophobicContact CB-CG2 3.83Å; N99-V102 PolarHBondContact O-N 3.42Å
100	P	91.2	Very high	86.1	Confident	96 Å²	96	123.6 Å²	123.6	62%	0.623	68%	0.677	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.2	-5.2	-172.3	31.1	-36.7	0	0	0	113.8	P98	P98-P100 WeakPolarHBondContact O-CD 3.45Å; P98-P100 VanDerWaalsContact O-N 3.11Å
101	F	91.1	Very high	85.5	Confident	188 Å²	188	128.7 Å²	128.7	83%	0.825	70%	0.701	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.4	-10.8	179.5	-55.8	-74	0	0	0	113.3	N99 Q103	N99-F101 PolarHBondContact O-N 2.71Å; N99-F101 VanDerWaalsContact O-N 3.15Å; N99-F101 WeakPolarHBondContact OD1-CD2 3.44Å; N99-F101 PolarHBondContact OD1-N 3.07Å; F101-Q103 PolarHBondContact O-N 3.38Å
102	V	88.8	Confident	85.4	Confident	96 Å²	96	136 Å²	136	58%	0.582	74%	0.736	S	S	*	*	S	Bend	trans	-79.8	117	173.5	179.6	0	0	0	0	106.9	N99 Q104	N99-V102 HydrophobicContact CB-CB 4.49Å; N99-V102 HydrophobicContact CB-CG2 3.83Å; N99-V102 PolarHBondContact O-N 3.42Å; V102-Q104 PolarHBondContact O-N 3.44Å; V102-Q104 VanDerWaalsContact O-N 3.17Å
103	Q	78.9	Confident	85.2	Confident	176 Å²	176	135 Å²	135	82%	0.822	73%	0.731	S	S	*	*	P	Polyproline II helix	trans	-58.8	120.9	169.5	-72.3	177.7	-18.6	0	0	107.4	F101 E105	F101-Q103 PolarHBondContact O-N 3.38Å; Q103-E105 PolarHBondContact O-N 2.86Å
104	Q	73.9	Confident	85	Confident	172 Å²	172	139.8 Å²	139.8	80%	0.804	73%	0.725	S	S	*	*	P	Polyproline II helix	trans	-63.8	118	168.6	-68.7	177	-5.5	0	0	106.5	V102	V102-Q104 PolarHBondContact O-N 3.44Å; V102-Q104 VanDerWaalsContact O-N 3.17Å
105	E	62.7	Low	84.8	Confident	270 Å²	270	143.5 Å²	143.5	100%	1.262	75%	0.746	S	S	*	*			trans	-62.6	0	172.3	-74.5	-178.1	160.5	0	0	111.8	Q103	Q103-E105 PolarHBondContact O-N 2.86Å

Retrieved 105 of 105 residues in 408.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).