G4V9I3_SCHMA Loading...

ATP synthase subunit g

AlphaFold DB , UniProt , Accession G4V9I3, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 112 aa.

						>G4V9I3_SCHMA|G4V9I3
MADRLTRVINLASKVSSFVIQETSPRLTKFREYARVELRPPTQADLKPAMEQATKLICSFKSGAWKNVSVKEGLVNAVVTVEVLCWFFMGEMIGRRSFLGYSRVPHTYIVQH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	63	Low	81.9	Confident	203 Å²	203	123.9 Å²	123.9	100%	1	63%	0.625	S	S	*	*				0	-40	0	-78.1	-159.4	-81.3	0	0	112.8	D3 R4 L5	M1-D3 VanDerWaalsContact C-N 3.31Å; M1-D3 PolarHBondContact O-N 3.4Å; M1-R4 PolarHBondContact O-N 3.27Å; M1-L5 PolarHBondContact O-N 3.13Å
2	A	78.1	Confident	82.2	Confident	69 Å²	69	118.4 Å²	118.4	57%	0.57	61%	0.612	S	S	*	*	H	α-helix	trans	-51.1	-43.7	175.8	0	0	0	0	0	114	R4 L5 T6	A2-R4 VanDerWaalsContact C-N 3.31Å; A2-R4 PolarHBondContact O-N 3.4Å; A2-L5 PolarHBondContact O-N 3.11Å; A2-T6 PolarHBondContact O-N 3.48Å; A2-T6 PolarHBondContact O-OG1 2.97Å
3	D	80.8	Confident	82.4	Confident	118 Å²	118	113.2 Å²	113.2	63%	0.631	59%	0.592	S	S	*	*	H	α-helix	trans	-64.7	-29.3	-179.1	-59.9	-41.5	0	0	0	114.9	M1 T6 R7	M1-D3 VanDerWaalsContact C-N 3.31Å; M1-D3 PolarHBondContact O-N 3.4Å; D3-T6 WeakPolarHBondContact CA-OG1 3.46Å; D3-T6 PolarHBondContact O-OG1 3.46Å; D3-R7 VanDerWaalsContact O-CG 3.31Å; D3-R7 WeakPolarHBondContact O-CG 3.46Å; D3-R7 PolarHBondContact O-N 3.41Å
4	R	81.2	Confident	82.6	Confident	205 Å²	205	115.6 Å²	115.6	77%	0.774	60%	0.596	S	S	*	*	H	α-helix	trans	-74.6	-40.3	176.9	-69.9	-165.7	-179.5	-161.9	1.9	110.7	M1 A2 R7 V8	M1-R4 PolarHBondContact O-N 3.27Å; A2-R4 VanDerWaalsContact C-N 3.31Å; A2-R4 PolarHBondContact O-N 3.4Å; R4-R7 PolarHBondContact O-N 3.07Å; R4-V8 WeakPolarHBondContact O-CG2 3.45Å; R4-V8 PolarHBondContact O-N 2.84Å; R4-V8 VanDerWaalsContact O-N 3.08Å
5	L	84.4	Confident	83	Confident	116 Å²	116	113.9 Å²	113.9	61%	0.607	59%	0.592	S	S	*	*	H	α-helix	trans	-63.1	-45.3	176.1	-76.7	168.7	0	0	0	111.5	M1 A2 R7 V8 I9	M1-L5 PolarHBondContact O-N 3.13Å; A2-L5 PolarHBondContact O-N 3.11Å; L5-R7 VanDerWaalsContact C-N 3.32Å; L5-R7 PolarHBondContact O-N 3.02Å; L5-V8 PolarHBondContact O-N 2.88Å; L5-I9 VanDerWaalsContact O-CG1 3.32Å; L5-I9 WeakPolarHBondContact O-CG1 3.32Å; L5-I9 PolarHBondContact O-N 3.1Å
6	T	86	Confident	83.1	Confident	69 Å²	69	110.3 Å²	110.3	42%	0.423	58%	0.58	S	S	.	*	H	α-helix	trans	-62.9	-37.9	177.3	54.8	0	0	0	0	112.1	A2 D3 I9 N10	A2-T6 PolarHBondContact O-N 3.48Å; A2-T6 PolarHBondContact O-OG1 2.97Å; D3-T6 WeakPolarHBondContact CA-OG1 3.46Å; D3-T6 PolarHBondContact O-OG1 3.46Å; T6-I9 PolarHBondContact O-N 3.26Å; T6-N10 VanDerWaalsContact O-CB 3.28Å; T6-N10 WeakPolarHBondContact O-CB 3.5Å; T6-N10 PolarHBondContact O-N 3.39Å; T6-N10 PolarHBondContact O-ND2 3.22Å; T6-N10 VanDerWaalsContact O-ND2 3.14Å
7	R	81.5	Confident	83.1	Confident	180 Å²	180	107.2 Å²	107.2	68%	0.679	57%	0.57	S	S	*	*	H	α-helix	trans	-62	-44.4	173	-75.7	-179.6	-168.1	-170.1	4	112.7	D3 R4 L5 N10 L11	D3-R7 VanDerWaalsContact O-CG 3.31Å; D3-R7 WeakPolarHBondContact O-CG 3.46Å; D3-R7 PolarHBondContact O-N 3.41Å; R4-R7 PolarHBondContact O-N 3.07Å; L5-R7 VanDerWaalsContact C-N 3.32Å; L5-R7 PolarHBondContact O-N 3.02Å; R7-N10 PolarHBondContact O-N 2.97Å; R7-L11 WeakPolarHBondContact O-CB 3.38Å; R7-L11 WeakPolarHBondContact O-CG 3.44Å; R7-L11 PolarHBondContact O-N 3.23Å
8	V	86.1	Confident	83.3	Confident	93 Å²	93	108.2 Å²	108.2	56%	0.564	57%	0.569	S	S	*	*	H	α-helix	trans	-63.9	-44	177.8	172.8	0	0	0	0	110.8	R4 L5 N10 L11 A12	R4-V8 WeakPolarHBondContact O-CG2 3.45Å; R4-V8 PolarHBondContact O-N 2.84Å; R4-V8 VanDerWaalsContact O-N 3.08Å; L5-V8 PolarHBondContact O-N 2.88Å; V8-N10 VanDerWaalsContact C-N 3.33Å; V8-N10 PolarHBondContact O-N 3.34Å; V8-L11 PolarHBondContact O-N 3.06Å; V8-A12 WeakPolarHBondContact O-CB 3.47Å; V8-A12 PolarHBondContact O-N 3.28Å
9	I	87.5	Confident	83.6	Confident	109 Å²	109	106.4 Å²	106.4	56%	0.559	56%	0.562	S	S	*	*	H	α-helix	trans	-61	-43.6	175.7	-67.2	165.5	0	0	0	110.7	L5 T6 L11 A12 S13	L5-I9 VanDerWaalsContact O-CG1 3.32Å; L5-I9 WeakPolarHBondContact O-CG1 3.32Å; L5-I9 PolarHBondContact O-N 3.1Å; T6-I9 PolarHBondContact O-N 3.26Å; I9-L11 VanDerWaalsContact C-N 3.35Å; I9-L11 PolarHBondContact O-N 3.34Å; I9-A12 PolarHBondContact O-N 3.07Å; I9-S13 WeakPolarHBondContact O-CB 3.4Å; I9-S13 PolarHBondContact O-N 3.46Å; I9-S13 PolarHBondContact O-OG 2.93Å
10	N	87.4	Confident	83.8	Confident	92 Å²	92	106.5 Å²	106.5	49%	0.492	56%	0.562	S	S	.	*	H	α-helix	trans	-67.4	-32	177.2	-73.6	-28.1	0	0	0	113.2	T6 R7 V8 S13 K14	T6-N10 VanDerWaalsContact O-CB 3.28Å; T6-N10 WeakPolarHBondContact O-CB 3.5Å; T6-N10 PolarHBondContact O-N 3.39Å; T6-N10 PolarHBondContact O-ND2 3.22Å; T6-N10 VanDerWaalsContact O-ND2 3.14Å; R7-N10 PolarHBondContact O-N 2.97Å; V8-N10 VanDerWaalsContact C-N 3.33Å; V8-N10 PolarHBondContact O-N 3.34Å; N10-S13 WeakPolarHBondContact CA-OG 3.38Å; N10-S13 PolarHBondContact O-OG 3.27Å; N10-K14 WeakPolarHBondContact O-CB 3.37Å; N10-K14 WeakPolarHBondContact O-CG 3.49Å; N10-K14 PolarHBondContact O-N 3.23Å; N10-K14 VanDerWaalsContact O-N 3.08Å
11	L	85.3	Confident	83.9	Confident	109 Å²	109	107.9 Å²	107.9	57%	0.571	57%	0.565	S	S	*	*	H	α-helix	trans	-71.9	-44.7	172.7	-75	171.9	0	0	0	110.9	R7 V8 I9 S13 K14 V15	R7-L11 WeakPolarHBondContact O-CB 3.38Å; R7-L11 WeakPolarHBondContact O-CG 3.44Å; R7-L11 PolarHBondContact O-N 3.23Å; V8-L11 PolarHBondContact O-N 3.06Å; I9-L11 VanDerWaalsContact C-N 3.35Å; I9-L11 PolarHBondContact O-N 3.34Å; L11-S13 VanDerWaalsContact C-N 3.32Å; L11-S13 PolarHBondContact O-N 3.14Å; L11-K14 PolarHBondContact O-N 3.42Å; L11-V15 VanDerWaalsContact O-CG2 3.32Å; L11-V15 WeakPolarHBondContact O-CG2 3.48Å; L11-V15 PolarHBondContact O-N 3.38Å
12	A	85.3	Confident	85.1	Confident	58 Å²	58	102.1 Å²	102.1	48%	0.479	54%	0.536	S	S	.	.	H	α-helix	trans	-59.7	-43.5	176.1	0	0	0	0	0	111.2	V8 I9 V15 S16	V8-A12 WeakPolarHBondContact O-CB 3.47Å; V8-A12 PolarHBondContact O-N 3.28Å; I9-A12 PolarHBondContact O-N 3.07Å; A12-V15 PolarHBondContact O-N 3.46Å; A12-S16 WeakPolarHBondContact O-CB 3.38Å; A12-S16 PolarHBondContact O-N 2.93Å; A12-S16 PolarHBondContact O-OG 2.89Å
13	S	85	Confident	85.6	Confident	50 Å²	50	101.4 Å²	101.4	35%	0.35	52%	0.524	S	S	.	.	H	α-helix	trans	-68	-34.4	177.1	67.8	0	0	0	0	112.9	I9 N10 L11 S16 S17	I9-S13 WeakPolarHBondContact O-CB 3.4Å; I9-S13 PolarHBondContact O-N 3.46Å; I9-S13 PolarHBondContact O-OG 2.93Å; N10-S13 WeakPolarHBondContact CA-OG 3.38Å; N10-S13 PolarHBondContact O-OG 3.27Å; L11-S13 VanDerWaalsContact C-N 3.32Å; L11-S13 PolarHBondContact O-N 3.14Å; S13-S16 VanDerWaalsContact CA-OG 3.32Å; S13-S16 WeakPolarHBondContact CA-OG 3.28Å; S13-S16 PolarHBondContact O-OG 3.44Å; S13-S17 VanDerWaalsContact O-CB 3.25Å; S13-S17 WeakPolarHBondContact O-CB 3.49Å; S13-S17 PolarHBondContact O-N 3.44Å; S13-S17 PolarHBondContact O-OG 3.46Å
14	K	84.2	Confident	86	Confident	148 Å²	148	98.7 Å²	98.7	64%	0.643	52%	0.515	S	S	*	.	H	α-helix	trans	-66.9	-45.6	172.1	-80.3	178.1	-179.4	-171.2	0	111.9	N10 L11 S17 F18	N10-K14 WeakPolarHBondContact O-CB 3.37Å; N10-K14 WeakPolarHBondContact O-CG 3.49Å; N10-K14 PolarHBondContact O-N 3.23Å; N10-K14 VanDerWaalsContact O-N 3.08Å; L11-K14 PolarHBondContact O-N 3.42Å; K14-S17 PolarHBondContact O-N 2.93Å; K14-F18 WeakPolarHBondContact O-CB 3.44Å; K14-F18 PolarHBondContact O-N 2.98Å
15	V	89.2	Confident	86.4	Confident	89 Å²	89	92.2 Å²	92.2	54%	0.539	50%	0.499	S	S	.	.	H	α-helix	trans	-64.8	-44.2	177.7	173.5	0	0	0	0	110.4	L11 A12 S17 F18 V19	L11-V15 VanDerWaalsContact O-CG2 3.32Å; L11-V15 WeakPolarHBondContact O-CG2 3.48Å; L11-V15 PolarHBondContact O-N 3.38Å; A12-V15 PolarHBondContact O-N 3.46Å; V15-S17 VanDerWaalsContact C-N 3.33Å; V15-S17 PolarHBondContact O-N 2.88Å; V15-F18 PolarHBondContact O-N 3.27Å; V15-V19 HydrophobicContact CG1-CG2 4.29Å; V15-V19 WeakPolarHBondContact O-CB 3.41Å; V15-V19 VanDerWaalsContact O-CG2 3.28Å; V15-V19 WeakPolarHBondContact O-CG2 3.33Å; V15-V19 PolarHBondContact O-N 3.2Å
16	S	85.2	Confident	86.7	Confident	57 Å²	57	94.5 Å²	94.5	40%	0.399	50%	0.5	S	S	.	.	H	α-helix	trans	-62.1	-42.4	176.2	64.4	0	0	0	0	111.6	A12 S13 V19 I20	A12-S16 WeakPolarHBondContact O-CB 3.38Å; A12-S16 PolarHBondContact O-N 2.93Å; A12-S16 PolarHBondContact O-OG 2.89Å; S13-S16 VanDerWaalsContact CA-OG 3.32Å; S13-S16 WeakPolarHBondContact CA-OG 3.28Å; S13-S16 PolarHBondContact O-OG 3.44Å; S16-V19 PolarHBondContact O-N 3.07Å; S16-I20 WeakPolarHBondContact O-CB 3.37Å; S16-I20 WeakPolarHBondContact O-CD1 3.41Å; S16-I20 WeakPolarHBondContact O-CG1 3.45Å; S16-I20 PolarHBondContact O-N 2.83Å
17	S	82.7	Confident	86.9	Confident	58 Å²	58	96.2 Å²	96.2	41%	0.406	51%	0.506	S	S	.	.	H	α-helix	trans	-63.4	-42.9	176.9	-59.7	0	0	0	0	111.5	S13 K14 V15 I20 Q21	S13-S17 VanDerWaalsContact O-CB 3.25Å; S13-S17 WeakPolarHBondContact O-CB 3.49Å; S13-S17 PolarHBondContact O-N 3.44Å; S13-S17 PolarHBondContact O-OG 3.46Å; K14-S17 PolarHBondContact O-N 2.93Å; V15-S17 VanDerWaalsContact C-N 3.33Å; V15-S17 PolarHBondContact O-N 2.88Å; S17-I20 PolarHBondContact O-N 2.95Å; S17-Q21 WeakPolarHBondContact O-CB 3.42Å; S17-Q21 VanDerWaalsContact O-CG 3.22Å; S17-Q21 WeakPolarHBondContact O-CG 3.38Å; S17-Q21 PolarHBondContact O-N 3.4Å
18	F	86.7	Confident	87.4	Confident	125 Å²	125	91.7 Å²	91.7	55%	0.548	50%	0.498	S	S	.	.	H	α-helix	trans	-63.5	-45.7	176.4	-179.2	-101.2	0	0	0	112	K14 V15 I20 Q21 E22	K14-F18 WeakPolarHBondContact O-CB 3.44Å; K14-F18 PolarHBondContact O-N 2.98Å; V15-F18 PolarHBondContact O-N 3.27Å; F18-I20 VanDerWaalsContact C-N 3.35Å; F18-I20 PolarHBondContact O-N 3.35Å; F18-Q21 PolarHBondContact O-N 2.95Å; F18-E22 HydrophobicContact CD1-CG 4.44Å; F18-E22 HydrophobicContact CE1-CG 3.98Å; F18-E22 HydrophobicContact CE2-CG 4.13Å; F18-E22 HydrophobicContact CZ-CG 3.8Å; F18-E22 WeakPolarHBondContact O-CB 3.37Å; F18-E22 PolarHBondContact O-N 3.41Å
19	V	89	Confident	87.7	Confident	73 Å²	73	93.6 Å²	93.6	44%	0.442	50%	0.499	S	S	.	.	H	α-helix	trans	-61.6	-43.6	176.4	171.6	0	0	0	0	110.7	V15 S16 E22 T23	V15-V19 HydrophobicContact CG1-CG2 4.29Å; V15-V19 WeakPolarHBondContact O-CB 3.41Å; V15-V19 VanDerWaalsContact O-CG2 3.28Å; V15-V19 WeakPolarHBondContact O-CG2 3.33Å; V15-V19 PolarHBondContact O-N 3.2Å; S16-V19 PolarHBondContact O-N 3.07Å; V19-E22 PolarHBondContact O-N 3.12Å; V19-T23 HydrophobicContact CG1-CG2 4.09Å; V19-T23 VanDerWaalsContact O-CB 3.27Å; V19-T23 WeakPolarHBondContact O-CB 3.5Å; V19-T23 WeakPolarHBondContact O-CG2 3.41Å; V19-T23 PolarHBondContact O-N 3.35Å; V19-T23 PolarHBondContact O-OG1 2.73Å
20	I	87.5	Confident	87.9	Confident	108 Å²	108	94.8 Å²	94.8	55%	0.554	50%	0.5	S	S	*	.	H	α-helix	trans	-64.3	-42.4	176.9	-68.3	164	0	0	0	110.6	S16 S17 F18 E22 T23 S24	S16-I20 WeakPolarHBondContact O-CB 3.37Å; S16-I20 WeakPolarHBondContact O-CD1 3.41Å; S16-I20 WeakPolarHBondContact O-CG1 3.45Å; S16-I20 PolarHBondContact O-N 2.83Å; S17-I20 PolarHBondContact O-N 2.95Å; F18-I20 VanDerWaalsContact C-N 3.35Å; F18-I20 PolarHBondContact O-N 3.35Å; I20-E22 PolarHBondContact O-N 2.95Å; I20-T23 PolarHBondContact O-N 2.95Å; I20-T23 PolarHBondContact O-OG1 3.23Å; I20-S24 WeakPolarHBondContact O-CB 3.36Å; I20-S24 PolarHBondContact O-N 2.97Å
21	Q	85.5	Confident	88.2	Confident	137 Å²	137	99.7 Å²	99.7	64%	0.64	51%	0.512	S	S	*	.	H	α-helix	trans	-63.5	-39.3	178	-77.2	177.1	-21.9	0	0	112.5	S17 F18 P25	S17-Q21 WeakPolarHBondContact O-CB 3.42Å; S17-Q21 VanDerWaalsContact O-CG 3.22Å; S17-Q21 WeakPolarHBondContact O-CG 3.38Å; S17-Q21 PolarHBondContact O-N 3.4Å; F18-Q21 PolarHBondContact O-N 2.95Å; Q21-P25 WeakPolarHBondContact O-CD 3.32Å
22	E	88.2	Confident	88.6	Confident	81 Å²	81	100.5 Å²	100.5	38%	0.379	51%	0.513	S	S	.	.	H	α-helix	trans	-75.8	-36.4	177.3	-79	-62.7	131.2	0	0	113.5	F18 V19 I20 R26	F18-E22 HydrophobicContact CD1-CG 4.44Å; F18-E22 HydrophobicContact CE1-CG 3.98Å; F18-E22 HydrophobicContact CE2-CG 4.13Å; F18-E22 HydrophobicContact CZ-CG 3.8Å; F18-E22 WeakPolarHBondContact O-CB 3.37Å; F18-E22 PolarHBondContact O-N 3.41Å; V19-E22 PolarHBondContact O-N 3.12Å; I20-E22 PolarHBondContact O-N 2.95Å; E22-R26 PolarHBondContact O-NE 2.96Å; E22-R26 IonicContact OE2-CZ 3.02Å; E22-R26 IonicContact OE2-NH2 2.77Å; E22-R26 PolarHBondContact OE2-NH2 3.05Å
23	T	89.9	Confident	88.9	Confident	54 Å²	54	104.2 Å²	104.2	33%	0.331	52%	0.515	S	S	.	.	H	α-helix	trans	-83.2	-34	-177	55.1	0	0	0	0	112.8	V19 I20 R26 L27	V19-T23 HydrophobicContact CG1-CG2 4.09Å; V19-T23 VanDerWaalsContact O-CB 3.27Å; V19-T23 WeakPolarHBondContact O-CB 3.5Å; V19-T23 WeakPolarHBondContact O-CG2 3.41Å; V19-T23 PolarHBondContact O-N 3.35Å; V19-T23 PolarHBondContact O-OG1 2.73Å; I20-T23 PolarHBondContact O-N 2.95Å; I20-T23 PolarHBondContact O-OG1 3.23Å; T23-R26 PolarHBondContact O-N 3.37Å; T23-R26 VanDerWaalsContact O-N 3.09Å; T23-L27 WeakPolarHBondContact O-CB 3.13Å; T23-L27 WeakPolarHBondContact O-CG 3.46Å; T23-L27 PolarHBondContact O-N 3.05Å
24	S	87.6	Confident	89.2	Confident	61 Å²	61	102.9 Å²	102.9	43%	0.427	51%	0.508	S	S	.	.	H	α-helix	trans	-51.2	-51	180	-179.3	0	0	0	0	114.3	I20 R26 L27 T28	I20-S24 WeakPolarHBondContact O-CB 3.36Å; I20-S24 PolarHBondContact O-N 2.97Å; S24-R26 VanDerWaalsContact C-N 3.31Å; S24-R26 PolarHBondContact O-N 3.24Å; S24-L27 PolarHBondContact O-N 3.38Å; S24-T28 WeakPolarHBondContact O-CB 3.34Å; S24-T28 PolarHBondContact O-N 2.93Å; S24-T28 PolarHBondContact O-OG1 3.38Å
25	P	90.3	Very high	89.5	Confident	70 Å²	70	105.5 Å²	105.5	46%	0.455	51%	0.514	S	S	.	.	H	α-helix	trans	-66.7	-33.1	178.9	25.8	-34.3	0	0	0	112.5	Q21 T28 K29	Q21-P25 WeakPolarHBondContact O-CD 3.32Å; P25-T28 PolarHBondContact O-N 3.36Å; P25-K29 PolarHBondContact O-N 3.5Å; P25-K29 VanDerWaalsContact O-N 3.09Å
26	R	90.7	Very high	89.5	Confident	163 Å²	163	105.8 Å²	105.8	62%	0.615	52%	0.515	S	S	*	.	H	α-helix	trans	-70.8	-42.6	178.6	-58.4	178.7	-162.9	-175.3	5.3	111.3	E22 T23 S24 T28 K29 F30	E22-R26 PolarHBondContact O-NE 2.96Å; E22-R26 IonicContact OE2-CZ 3.02Å; E22-R26 IonicContact OE2-NH2 2.77Å; E22-R26 PolarHBondContact OE2-NH2 3.05Å; T23-R26 PolarHBondContact O-N 3.37Å; T23-R26 VanDerWaalsContact O-N 3.09Å; S24-R26 VanDerWaalsContact C-N 3.31Å; S24-R26 PolarHBondContact O-N 3.24Å; R26-T28 VanDerWaalsContact C-N 3.32Å; R26-K29 PolarHBondContact O-N 3.07Å; R26-F30 WeakPolarHBondContact O-CB 3.47Å; R26-F30 PolarHBondContact O-N 3.48Å
27	L	91.1	Very high	89.7	Confident	106 Å²	106	110.2 Å²	110.2	56%	0.555	53%	0.53	S	S	*	.	H	α-helix	trans	-65.9	-35.5	174.6	-71.4	175.9	0	0	0	111.9	T23 S24 F30 R31	T23-L27 WeakPolarHBondContact O-CB 3.13Å; T23-L27 WeakPolarHBondContact O-CG 3.46Å; T23-L27 PolarHBondContact O-N 3.05Å; S24-L27 PolarHBondContact O-N 3.38Å; L27-F30 PolarHBondContact O-N 3.23Å; L27-R31 VanDerWaalsContact O-CB 3.23Å; L27-R31 WeakPolarHBondContact O-CB 3.4Å; L27-R31 PolarHBondContact O-N 2.91Å
28	T	91.8	Very high	90	Very high	85 Å²	85	112 Å²	112	52%	0.521	53%	0.534	S	S	.	.	H	α-helix	trans	-64.2	-47.8	176	-58.5	0	0	0	0	110.8	S24 P25 R26 R31 E32	S24-T28 WeakPolarHBondContact O-CB 3.34Å; S24-T28 PolarHBondContact O-N 2.93Å; S24-T28 PolarHBondContact O-OG1 3.38Å; P25-T28 PolarHBondContact O-N 3.36Å; R26-T28 VanDerWaalsContact C-N 3.32Å; T28-R31 PolarHBondContact O-N 3.43Å; T28-E32 PolarHBondContact O-N 3.21Å
29	K	92.5	Very high	90.1	Very high	133 Å²	133	111.6 Å²	111.6	58%	0.578	53%	0.529	S	S	*	.	H	α-helix	trans	-62	-45.4	173.9	-73	-173.1	178.1	-178.3	0	112.3	P25 R26 R31 E32 Y33	P25-K29 PolarHBondContact O-N 3.5Å; P25-K29 VanDerWaalsContact O-N 3.09Å; R26-K29 PolarHBondContact O-N 3.07Å; K29-R31 VanDerWaalsContact C-N 3.28Å; K29-R31 PolarHBondContact O-N 3.04Å; K29-E32 WeakPolarHBondContact O-CB 3.19Å; K29-E32 PolarHBondContact O-N 3.25Å; K29-Y33 HydrophobicContact CB-CE2 4.44Å; K29-Y33 WeakPolarHBondContact O-CD2 3.4Å; K29-Y33 PolarHBondContact O-N 3.31Å; K29-Y33 VanDerWaalsContact O-N 3.08Å
30	F	91.7	Very high	89.9	Confident	133 Å²	133	113.2 Å²	113.2	58%	0.583	54%	0.541	S	S	*	.	H	α-helix	trans	-57.2	-44	175.5	173.6	-101	0	0	0	111.4	R26 L27 E32 Y33 A34	R26-F30 WeakPolarHBondContact O-CB 3.47Å; R26-F30 PolarHBondContact O-N 3.48Å; L27-F30 PolarHBondContact O-N 3.23Å; F30-E32 VanDerWaalsContact C-N 3.33Å; F30-E32 PolarHBondContact O-N 2.9Å; F30-Y33 PolarHBondContact O-N 3.22Å; F30-A34 HydrophobicContact CE1-CB 4.29Å; F30-A34 HydrophobicContact CZ-CB 4.3Å; F30-A34 WeakPolarHBondContact O-CB 3.45Å; F30-A34 PolarHBondContact O-N 3.28Å
31	R	92.5	Very high	89.7	Confident	195 Å²	195	112.5 Å²	112.5	74%	0.736	54%	0.543	S	S	*	.	H	α-helix	trans	-63.7	-38.4	178	-175.2	-179.5	-176.8	-176.4	1.8	112.3	L27 T28 K29 R35	L27-R31 VanDerWaalsContact O-CB 3.23Å; L27-R31 WeakPolarHBondContact O-CB 3.4Å; L27-R31 PolarHBondContact O-N 2.91Å; T28-R31 PolarHBondContact O-N 3.43Å; K29-R31 VanDerWaalsContact C-N 3.28Å; K29-R31 PolarHBondContact O-N 3.04Å; R31-R35 VanDerWaalsContact O-CB 3.24Å; R31-R35 WeakPolarHBondContact O-CB 3.49Å; R31-R35 PolarHBondContact O-N 3.29Å
32	E	93.4	Very high	89.8	Confident	127 Å²	127	109.9 Å²	109.9	59%	0.593	54%	0.537	S	S	*	.	H	α-helix	trans	-62.4	-51.7	176.7	-171.8	176.6	175.8	0	0	111.2	T28 K29 F30 R35 V36	T28-E32 PolarHBondContact O-N 3.21Å; K29-E32 WeakPolarHBondContact O-CB 3.19Å; K29-E32 PolarHBondContact O-N 3.25Å; F30-E32 VanDerWaalsContact C-N 3.33Å; F30-E32 PolarHBondContact O-N 2.9Å; E32-R35 PolarHBondContact O-N 3.43Å; E32-V36 PolarHBondContact O-N 3.4Å
33	Y	92.9	Very high	89.6	Confident	135 Å²	135	114 Å²	114	53%	0.529	56%	0.556	S	S	.	*	H	α-helix	trans	-65.8	-45.4	177.3	-65.5	-58.1	0	0	0	112.5	K29 F30 R35 V36 E37	K29-Y33 HydrophobicContact CB-CE2 4.44Å; K29-Y33 WeakPolarHBondContact O-CD2 3.4Å; K29-Y33 PolarHBondContact O-N 3.31Å; K29-Y33 VanDerWaalsContact O-N 3.08Å; F30-Y33 PolarHBondContact O-N 3.22Å; Y33-R35 PolarHBondContact O-N 2.8Å; Y33-V36 VanDerWaalsContact O-CG2 3.28Å; Y33-V36 WeakPolarHBondContact O-CG2 3.32Å; Y33-V36 PolarHBondContact O-N 3.34Å; Y33-E37 WeakPolarHBondContact O-CB 3.23Å; Y33-E37 PolarHBondContact O-N 3.23Å
34	A	91.1	Very high	89.5	Confident	23 Å²	23	115 Å²	115	19%	0.19	57%	0.569	C	S	.	*	H	α-helix	trans	-59.7	-33.8	177.6	0	0	0	0	0	112	F30 V36 L38	F30-A34 HydrophobicContact CE1-CB 4.29Å; F30-A34 HydrophobicContact CZ-CB 4.3Å; F30-A34 WeakPolarHBondContact O-CB 3.45Å; F30-A34 PolarHBondContact O-N 3.28Å; A34-V36 VanDerWaalsContact C-N 3.31Å; A34-V36 PolarHBondContact O-N 3.06Å; A34-L38 HydrophobicContact CB-CD1 4.03Å; A34-L38 CarbonylContact O-C 3.57Å; A34-L38 WeakPolarHBondContact O-CA 3.31Å; A34-L38 VanDerWaalsContact O-CB 3.27Å; A34-L38 WeakPolarHBondContact O-CB 3.37Å; A34-L38 PolarHBondContact O-N 3.11Å
35	R	89.2	Confident	89.5	Confident	203 Å²	203	114.7 Å²	114.7	77%	0.766	56%	0.563	S	S	*	*	H	α-helix	trans	-67.6	-31.5	177.9	-174.5	176.7	-176.1	-178	1.1	112.8	R31 E32 Y33	R31-R35 VanDerWaalsContact O-CB 3.24Å; R31-R35 WeakPolarHBondContact O-CB 3.49Å; R31-R35 PolarHBondContact O-N 3.29Å; E32-R35 PolarHBondContact O-N 3.43Å; Y33-R35 PolarHBondContact O-N 2.8Å
36	V	89.7	Confident	89.4	Confident	94 Å²	94	115.6 Å²	115.6	57%	0.57	56%	0.564	S	S	*	*	H	α-helix	trans	-93.4	-37.3	-178.3	-59.3	0	0	0	0	112.3	E32 Y33 A34	E32-V36 PolarHBondContact O-N 3.4Å; Y33-V36 VanDerWaalsContact O-CG2 3.28Å; Y33-V36 WeakPolarHBondContact O-CG2 3.32Å; Y33-V36 PolarHBondContact O-N 3.34Å; A34-V36 VanDerWaalsContact C-N 3.31Å; A34-V36 PolarHBondContact O-N 3.06Å
37	E	90.1	Very high	89.4	Confident	150 Å²	150	115.2 Å²	115.2	70%	0.701	57%	0.567	S	S	*	*	H	α-helix	trans	-91.2	-36.7	-175.8	-59.3	-174.7	170.9	0	0	113.3	Y33	Y33-E37 WeakPolarHBondContact O-CB 3.23Å; Y33-E37 PolarHBondContact O-N 3.23Å
38	L	88.4	Confident	89.4	Confident	95 Å²	95	112.8 Å²	112.8	50%	0.497	56%	0.557	S	S	.	*	S	Bend	trans	-100.6	20	-178.2	-54.1	175.3	0	0	0	112.4	A34 W86	A34-L38 HydrophobicContact CB-CD1 4.03Å; A34-L38 CarbonylContact O-C 3.57Å; A34-L38 WeakPolarHBondContact O-CA 3.31Å; A34-L38 VanDerWaalsContact O-CB 3.27Å; A34-L38 WeakPolarHBondContact O-CB 3.37Å; A34-L38 PolarHBondContact O-N 3.11Å; L38-W86 HydrophobicContact CD2-CH2 4.35Å; L38-W86 HydrophobicContact CD2-CZ2 3.9Å
39	R	88.1	Confident	89.4	Confident	117 Å²	117	111.1 Å²	111.1	44%	0.442	55%	0.552	S	S	.	*	P	Polyproline II helix	trans	-64.5	140.9	173.5	69.4	179.5	-176.4	83.8	-3.2	109.4	D45	R39-D45 IonicContact CZ-OD2 3.38Å; R39-D45 IonicContact NH1-OD2 3.74Å; R39-D45 PolarHBondContact NH1-OD2 3.04Å; R39-D45 IonicContact NH2-OD1 3.92Å; R39-D45 PolarHBondContact NH2-OD1 2.88Å; R39-D45 IonicContact NH2-OD2 2.8Å; R39-D45 PolarHBondContact NH2-OD2 3.47Å
40	P	85.3	Confident	89.3	Confident	108 Å²	108	111.2 Å²	111.2	70%	0.701	56%	0.556	S	S	*	*	P	Polyproline II helix	trans	-58.6	138	168.8	25.2	-32.4	0	0	0	109.3	T42	P40-T42 PolarHBondContact O-N 3.39Å
41	P	84.4	Confident	89.3	Confident	92 Å²	92	110.5 Å²	110.5	60%	0.597	55%	0.554	S	S	*	*	P	Polyproline II helix	trans	-62.5	137.4	178.8	25.7	-33.5	0	0	0	109.7	D45	P41-D45 HydrophobicContact CB-CB 4.25Å
42	T	86.8	Confident	89.3	Confident	83 Å²	83	107.6 Å²	107.6	51%	0.509	55%	0.549	S	S	.	.	P	Polyproline II helix	trans	-78.8	155.1	171.2	-58.9	0	0	0	0	108.4	P40 A44 D45	P40-T42 PolarHBondContact O-N 3.39Å; T42-A44 HydrophobicContact CG2-CB 4.34Å; T42-A44 PolarHBondContact O-N 3.37Å; T42-D45 PolarHBondContact N-OD2 3.24Å; T42-D45 WeakPolarHBondContact O-CA 3.36Å; T42-D45 WeakPolarHBondContact O-CB 3.25Å; T42-D45 PolarHBondContact O-N 3.29Å
43	Q	84.4	Confident	89.2	Confident	168 Å²	168	104 Å²	104	79%	0.785	54%	0.541	S	S	*	.	H	α-helix	trans	-55.5	-28.1	178	-65.3	-178.9	8.7	0	0	113.1	D45 L46	Q43-D45 VanDerWaalsContact C-N 3.27Å; Q43-D45 PolarHBondContact O-N 3.47Å; Q43-L46 WeakPolarHBondContact O-CB 3.11Å; Q43-L46 PolarHBondContact O-N 2.88Å
44	A	87.2	Confident	89.2	Confident	73 Å²	73	101.5 Å²	101.5	60%	0.603	54%	0.54	S	S	*	.	H	α-helix	trans	-63.2	-30.4	172.5	0	0	0	0	0	113.4	T42 L46 P48	T42-A44 HydrophobicContact CG2-CB 4.34Å; T42-A44 PolarHBondContact O-N 3.37Å; A44-L46 VanDerWaalsContact C-N 3.34Å; A44-P48 WeakPolarHBondContact O-CD 3.28Å
45	D	87.8	Confident	89.3	Confident	55 Å²	55	106.9 Å²	106.9	29%	0.294	56%	0.559	S	S	.	*	H	α-helix	trans	-78.9	-18	178.7	-57.2	-48.3	0	0	0	112.1	R39 P41 T42 Q43 P48 A49	R39-D45 IonicContact CZ-OD2 3.38Å; R39-D45 IonicContact NH1-OD2 3.74Å; R39-D45 PolarHBondContact NH1-OD2 3.04Å; R39-D45 IonicContact NH2-OD1 3.92Å; R39-D45 PolarHBondContact NH2-OD1 2.88Å; R39-D45 IonicContact NH2-OD2 2.8Å; R39-D45 PolarHBondContact NH2-OD2 3.47Å; P41-D45 HydrophobicContact CB-CB 4.25Å; T42-D45 PolarHBondContact N-OD2 3.24Å; T42-D45 WeakPolarHBondContact O-CA 3.36Å; T42-D45 WeakPolarHBondContact O-CB 3.25Å; T42-D45 PolarHBondContact O-N 3.29Å; Q43-D45 VanDerWaalsContact C-N 3.27Å; Q43-D45 PolarHBondContact O-N 3.47Å; D45-P48 WeakPolarHBondContact O-CD 3.27Å; D45-P48 VanDerWaalsContact O-CG 3.32Å; D45-P48 WeakPolarHBondContact O-CG 3.31Å; D45-A49 WeakPolarHBondContact O-CB 3.36Å; D45-A49 PolarHBondContact O-N 3.14Å
46	L	89	Confident	89.3	Confident	89 Å²	89	103.3 Å²	103.3	47%	0.466	56%	0.555	S	S	.	*	H	α-helix	trans	-71.2	-40.3	-178.1	-64.7	177.9	0	0	0	112.6	Q43 A44 A49 M50	Q43-L46 WeakPolarHBondContact O-CB 3.11Å; Q43-L46 PolarHBondContact O-N 2.88Å; A44-L46 VanDerWaalsContact C-N 3.34Å; L46-A49 PolarHBondContact O-N 3.02Å; L46-M50 WeakPolarHBondContact O-CG 3.25Å; L46-M50 PolarHBondContact O-N 3.38Å
47	K	89.3	Confident	89.4	Confident	156 Å²	156	103.7 Å²	103.7	68%	0.678	55%	0.552	S	S	*	*	H	α-helix	trans	-56.9	-55.3	177.6	-70.8	-173.4	176.7	-176	0	112.5	A49 M50 E51	K47-A49 VanDerWaalsContact C-N 3.29Å; K47-A49 PolarHBondContact O-N 2.77Å; K47-M50 PolarHBondContact O-N 2.99Å; K47-E51 WeakPolarHBondContact O-CG 3.48Å; K47-E51 PolarHBondContact O-N 3.12Å
48	P	91.7	Very high	89.5	Confident	55 Å²	55	100.2 Å²	100.2	36%	0.357	54%	0.544	S	S	.	.	H	α-helix	trans	-64.1	-33.4	178.4	24.3	-33	0	0	0	112.4	A44 D45 E51 Q52	A44-P48 WeakPolarHBondContact O-CD 3.28Å; D45-P48 WeakPolarHBondContact O-CD 3.27Å; D45-P48 VanDerWaalsContact O-CG 3.32Å; D45-P48 WeakPolarHBondContact O-CG 3.31Å; P48-E51 PolarHBondContact O-N 3.01Å; P48-Q52 VanDerWaalsContact O-CG 3.28Å; P48-Q52 WeakPolarHBondContact O-CG 3.46Å; P48-Q52 PolarHBondContact O-N 3.39Å
49	A	91.1	Very high	89.5	Confident	50 Å²	50	98.3 Å²	98.3	41%	0.413	54%	0.538	S	S	.	.	H	α-helix	trans	-63.4	-42.6	174.9	0	0	0	0	0	112.4	D45 L46 K47 Q52 A53	D45-A49 WeakPolarHBondContact O-CB 3.36Å; D45-A49 PolarHBondContact O-N 3.14Å; L46-A49 PolarHBondContact O-N 3.02Å; K47-A49 VanDerWaalsContact C-N 3.29Å; K47-A49 PolarHBondContact O-N 2.77Å; A49-Q52 PolarHBondContact O-N 2.96Å; A49-A53 PolarHBondContact O-N 2.87Å
50	M	91	Very high	89.6	Confident	134 Å²	134	99.5 Å²	99.5	66%	0.66	55%	0.547	S	S	*	.	H	α-helix	trans	-65.4	-39.7	175.7	-71	179.4	70.6	0	0	112.3	L46 K47 A53 T54	L46-M50 WeakPolarHBondContact O-CG 3.25Å; L46-M50 PolarHBondContact O-N 3.38Å; K47-M50 PolarHBondContact O-N 2.99Å; M50-A53 PolarHBondContact O-N 3.11Å; M50-T54 WeakPolarHBondContact O-CB 3.24Å; M50-T54 PolarHBondContact O-N 3.48Å; M50-T54 PolarHBondContact O-OG1 2.9Å
51	E	93	Very high	89.8	Confident	118 Å²	118	102.7 Å²	102.7	55%	0.551	55%	0.55	S	S	*	.	H	α-helix	trans	-62.8	-42.2	174.6	-72	175.8	-167.9	0	0	111.7	K47 P48 T54 K55	K47-E51 WeakPolarHBondContact O-CG 3.48Å; K47-E51 PolarHBondContact O-N 3.12Å; P48-E51 PolarHBondContact O-N 3.01Å; E51-T54 PolarHBondContact O-N 3.39Å; E51-K55 WeakPolarHBondContact O-CG 3.14Å; E51-K55 PolarHBondContact O-N 3.23Å
52	Q	91.7	Very high	90.1	Very high	135 Å²	135	102.7 Å²	102.7	63%	0.631	55%	0.552	S	S	*	*	H	α-helix	trans	-63.5	-44.4	175.2	-73.2	176	14.9	0	0	112	P48 A49 T54 K55 L56	P48-Q52 VanDerWaalsContact O-CG 3.28Å; P48-Q52 WeakPolarHBondContact O-CG 3.46Å; P48-Q52 PolarHBondContact O-N 3.39Å; A49-Q52 PolarHBondContact O-N 2.96Å; Q52-T54 VanDerWaalsContact C-N 3.3Å; Q52-T54 PolarHBondContact O-N 2.8Å; Q52-K55 PolarHBondContact O-N 3.49Å; Q52-L56 PolarHBondContact O-N 2.85Å
53	A	91.6	Very high	90.1	Very high	51 Å²	51	99.7 Å²	99.7	42%	0.421	54%	0.537	S	S	.	.	H	α-helix	trans	-59.9	-42	175.4	0	0	0	0	0	111.7	A49 M50 L56 I57	A49-A53 PolarHBondContact O-N 2.87Å; M50-A53 PolarHBondContact O-N 3.11Å; A53-L56 PolarHBondContact O-N 3.25Å; A53-I57 WeakPolarHBondContact O-CG1 3.43Å; A53-I57 PolarHBondContact O-N 3.47Å; A53-I57 VanDerWaalsContact O-N 3.07Å
54	T	92.8	Very high	90.1	Very high	83 Å²	83	93.5 Å²	93.5	51%	0.509	52%	0.515	S	S	.	.	H	α-helix	trans	-63.9	-43	176.7	-54.7	0	0	0	0	111.5	M50 E51 Q52 L56 I57 C58	M50-T54 WeakPolarHBondContact O-CB 3.24Å; M50-T54 PolarHBondContact O-N 3.48Å; M50-T54 PolarHBondContact O-OG1 2.9Å; E51-T54 PolarHBondContact O-N 3.39Å; Q52-T54 VanDerWaalsContact C-N 3.3Å; Q52-T54 PolarHBondContact O-N 2.8Å; T54-L56 VanDerWaalsContact C-N 3.33Å; T54-L56 PolarHBondContact O-N 2.9Å; T54-I57 PolarHBondContact O-N 3.38Å; T54-C58 PolarHBondContact O-N 3.45Å; T54-C58 PolarHBondContact O-SG 3Å; T54-C58 VanDerWaalsContact O-SG 3.39Å
55	K	92.2	Very high	90	Very high	136 Å²	136	96.9 Å²	96.9	59%	0.591	51%	0.512	S	S	*	.	H	α-helix	trans	-60.3	-41.8	174.3	-74.9	173.9	-178	173.1	0	111.8	E51 Q52 I57 C58 S59	E51-K55 WeakPolarHBondContact O-CG 3.14Å; E51-K55 PolarHBondContact O-N 3.23Å; Q52-K55 PolarHBondContact O-N 3.49Å; K55-I57 VanDerWaalsContact C-N 3.34Å; K55-I57 PolarHBondContact O-N 3.01Å; K55-C58 PolarHBondContact O-N 3.07Å; K55-S59 WeakPolarHBondContact O-CB 3.23Å; K55-S59 PolarHBondContact O-N 3.35Å; K55-S59 PolarHBondContact O-OG 3.46Å; K55-S59 VanDerWaalsContact O-OG 3.14Å
56	L	90.6	Very high	89.8	Confident	128 Å²	128	101.5 Å²	101.5	67%	0.67	53%	0.53	S	S	*	.	H	α-helix	trans	-61.4	-42.6	177.3	-174.2	62.4	0	0	0	111.7	Q52 A53 T54 S59 F60	Q52-L56 PolarHBondContact O-N 2.85Å; A53-L56 PolarHBondContact O-N 3.25Å; T54-L56 VanDerWaalsContact C-N 3.33Å; T54-L56 PolarHBondContact O-N 2.9Å; L56-S59 PolarHBondContact O-N 2.81Å; L56-F60 WeakPolarHBondContact O-CB 3.37Å; L56-F60 PolarHBondContact O-N 2.87Å
57	I	91.4	Very high	89.9	Confident	102 Å²	102	104.3 Å²	104.3	52%	0.523	55%	0.545	S	S	.	.	H	α-helix	trans	-63.1	-43	175.3	-65.3	165	0	0	0	110.9	A53 T54 K55 F60 K61	A53-I57 WeakPolarHBondContact O-CG1 3.43Å; A53-I57 PolarHBondContact O-N 3.47Å; A53-I57 VanDerWaalsContact O-N 3.07Å; T54-I57 PolarHBondContact O-N 3.38Å; K55-I57 VanDerWaalsContact C-N 3.34Å; K55-I57 PolarHBondContact O-N 3.01Å; I57-F60 PolarHBondContact O-N 3.35Å; I57-K61 WeakPolarHBondContact O-CG 3.4Å; I57-K61 PolarHBondContact O-N 2.85Å
58	C	91.3	Very high	89.8	Confident	76 Å²	76	99.6 Å²	99.6	51%	0.514	53%	0.529	S	S	.	.	H	α-helix	trans	-63.5	-43	175.6	-70.6	0	0	0	0	112.3	T54 K55 F60 K61 S62	T54-C58 PolarHBondContact O-N 3.45Å; T54-C58 PolarHBondContact O-SG 3Å; T54-C58 VanDerWaalsContact O-SG 3.39Å; K55-C58 PolarHBondContact O-N 3.07Å; C58-F60 VanDerWaalsContact C-N 3.3Å; C58-F60 PolarHBondContact O-N 3.47Å; C58-K61 PolarHBondContact O-N 3.17Å; C58-S62 PolarHBondContact O-N 3.46Å; C58-S62 PolarHBondContact O-OG 3.22Å
59	S	88.6	Confident	89.8	Confident	55 Å²	55	100 Å²	100	39%	0.385	53%	0.533	S	S	.	.	H	α-helix	trans	-64.1	-34.5	175.4	-67	0	0	0	0	112.6	K55 L56 S62 G63 A64	K55-S59 WeakPolarHBondContact O-CB 3.23Å; K55-S59 PolarHBondContact O-N 3.35Å; K55-S59 PolarHBondContact O-OG 3.46Å; K55-S59 VanDerWaalsContact O-OG 3.14Å; L56-S59 PolarHBondContact O-N 2.81Å; S59-S62 WeakPolarHBondContact CA-OG 3.49Å; S59-S62 PolarHBondContact O-OG 3.08Å; S59-S62 VanDerWaalsContact O-OG 3.07Å; S59-G63 PolarHBondContact O-N 3.19Å; S59-A64 WeakPolarHBondContact O-CB 3.21Å; S59-A64 PolarHBondContact O-N 3.03Å
60	F	89.9	Confident	89.9	Confident	143 Å²	143	104 Å²	104	63%	0.627	55%	0.552	S	S	*	*	H	α-helix	trans	-66.5	-45.3	172.8	-172.6	-101.2	0	0	0	111.1	L56 I57 C58 S62 G63 W65	L56-F60 WeakPolarHBondContact O-CB 3.37Å; L56-F60 PolarHBondContact O-N 2.87Å; I57-F60 PolarHBondContact O-N 3.35Å; C58-F60 VanDerWaalsContact C-N 3.3Å; C58-F60 PolarHBondContact O-N 3.47Å; F60-S62 PolarHBondContact O-N 3.44Å; F60-G63 PolarHBondContact O-N 3.38Å; F60-W65 HydrophobicContact CD2-CG 4.37Å
61	K	90.5	Very high	90.1	Very high	175 Å²	175	105.8 Å²	105.8	76%	0.761	56%	0.557	S	S	*	*	H	α-helix	trans	-63.7	-36.5	176.3	-76.8	-176	168.9	-172.8	0	113.6	I57 C58 G63	I57-K61 WeakPolarHBondContact O-CG 3.4Å; I57-K61 PolarHBondContact O-N 2.85Å; C58-K61 PolarHBondContact O-N 3.17Å; K61-G63 PolarHBondContact O-N 3.37Å
62	S	91.1	Very high	90	Very high	91 Å²	91	105 Å²	105	64%	0.636	55%	0.553	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.4	-10.6	179	67.8	0	0	0	0	113.7	C58 S59 F60	C58-S62 PolarHBondContact O-N 3.46Å; C58-S62 PolarHBondContact O-OG 3.22Å; S59-S62 WeakPolarHBondContact CA-OG 3.49Å; S59-S62 PolarHBondContact O-OG 3.08Å; S59-S62 VanDerWaalsContact O-OG 3.07Å; F60-S62 PolarHBondContact O-N 3.44Å
63	G	86.3	Confident	90.1	Very high	20 Å²	20	100.1 Å²	100.1	21%	0.206	54%	0.539	C	S	.	.	T	Hydrogen-bonded Turn	trans	82.9	11.1	-177.1	0	0	0	0	0	114.3	S59 F60 K61 W65 K66	S59-G63 PolarHBondContact O-N 3.19Å; F60-G63 PolarHBondContact O-N 3.38Å; K61-G63 PolarHBondContact O-N 3.37Å; G63-W65 PolarHBondContact O-N 3.45Å; G63-W65 VanDerWaalsContact O-N 3.13Å; G63-K66 WeakPolarHBondContact O-CB 3.06Å; G63-K66 PolarHBondContact O-N 2.76Å; G63-K66 VanDerWaalsContact O-N 3.11Å
64	A	84	Confident	90.2	Very high	38 Å²	38	103.2 Å²	103.2	31%	0.314	55%	0.547	S	S	.	.	G	3₁₀ helix	trans	-61.2	-22.9	-179.2	0	0	0	0	0	113.3	S59 K66 N67	S59-A64 WeakPolarHBondContact O-CB 3.21Å; S59-A64 PolarHBondContact O-N 3.03Å; A64-K66 PolarHBondContact O-N 3.09Å; A64-K66 VanDerWaalsContact O-N 3.1Å; A64-N67 PolarHBondContact O-N 3.09Å
65	W	84.2	Confident	90.4	Very high	144 Å²	144	103.2 Å²	103.2	55%	0.545	55%	0.547	S	S	.	.	G	3₁₀ helix	trans	-57.2	-22.4	174.6	64.4	-89.6	0	0	0	113.7	F60 G63 N67	F60-W65 HydrophobicContact CD2-CG 4.37Å; G63-W65 PolarHBondContact O-N 3.45Å; G63-W65 VanDerWaalsContact O-N 3.13Å; W65-N67 VanDerWaalsContact C-N 3.31Å
66	K	85.4	Confident	90.4	Very high	153 Å²	153	100.7 Å²	100.7	67%	0.665	54%	0.54	S	S	*	.	G	3₁₀ helix	trans	-73.8	-20.8	176.7	-63.5	-176.7	179.8	-178.4	0	113.7	G63 A64	G63-K66 WeakPolarHBondContact O-CB 3.06Å; G63-K66 PolarHBondContact O-N 2.76Å; G63-K66 VanDerWaalsContact O-N 3.11Å; A64-K66 PolarHBondContact O-N 3.09Å; A64-K66 VanDerWaalsContact O-N 3.1Å
67	N	89.3	Confident	90.6	Very high	148 Å²	148	96.9 Å²	96.9	79%	0.791	53%	0.527	S	S	*	.	G	3₁₀ helix	trans	-96	3.9	-179.7	-63.1	-45.8	0	0	0	112.6	A64 W65	A64-N67 PolarHBondContact O-N 3.09Å; W65-N67 VanDerWaalsContact C-N 3.31Å
68	V	88.5	Confident	90.9	Very high	57 Å²	57	96.4 Å²	96.4	35%	0.345	53%	0.528	S	S	.	.			trans	-76.5	129.8	-178.9	177.4	0	0	0	0	109.6	E72	V68-E72 HydrophobicContact CG1-CB 3.85Å; V68-E72 HydrophobicContact CG1-CG 3.88Å
69	S	92.1	Very high	91.1	Very high	63 Å²	63	96.1 Å²	96.1	44%	0.441	52%	0.524	S	S	.	.			trans	-66.7	150.9	176.3	72.7	0	0	0	0	111.3	K71 E72 G73	S69-K71 PolarHBondContact O-N 2.77Å; S69-E72 PolarHBondContact O-N 3.48Å; S69-E72 VanDerWaalsContact OG-CB 3.32Å; S69-E72 WeakPolarHBondContact OG-CB 3.27Å; S69-E72 PolarHBondContact OG-N 3.01Å; S69-G73 PolarHBondContact O-N 2.83Å
70	V	92.9	Very high	91.3	Very high	133 Å²	133	97.4 Å²	97.4	81%	0.806	53%	0.53	S	S	*	.	H	α-helix	trans	-56.5	-38.4	178.8	178.3	0	0	0	0	111.7	G73 L74	V70-G73 PolarHBondContact O-N 3.28Å; V70-L74 WeakPolarHBondContact O-CB 3.02Å; V70-L74 PolarHBondContact O-N 2.88Å
71	K	93.9	Very high	91.6	Very high	173 Å²	173	94.7 Å²	94.7	75%	0.752	53%	0.525	S	S	*	.	H	α-helix	trans	-61.3	-46.3	177.2	-176.8	-177.7	176.1	-175.7	0	111.6	S69 L74 V75	S69-K71 PolarHBondContact O-N 2.77Å; K71-L74 PolarHBondContact O-N 3.43Å; K71-V75 WeakPolarHBondContact O-CG2 3.28Å; K71-V75 PolarHBondContact O-N 3.13Å; K71-V75 VanDerWaalsContact O-N 3.12Å
72	E	92.6	Very high	91.8	Very high	102 Å²	102	91.2 Å²	91.2	48%	0.477	51%	0.511	S	S	.	.	H	α-helix	trans	-68.8	-42.4	179.5	-176	179	177.5	0	0	111.7	V68 S69 L74 V75 N76	V68-E72 HydrophobicContact CG1-CB 3.85Å; V68-E72 HydrophobicContact CG1-CG 3.88Å; S69-E72 PolarHBondContact O-N 3.48Å; S69-E72 VanDerWaalsContact OG-CB 3.32Å; S69-E72 WeakPolarHBondContact OG-CB 3.27Å; S69-E72 PolarHBondContact OG-N 3.01Å; E72-L74 VanDerWaalsContact C-N 3.3Å; E72-L74 PolarHBondContact O-N 3.09Å; E72-V75 PolarHBondContact O-N 3.4Å; E72-N76 PolarHBondContact O-N 3.26Å; E72-N76 PolarHBondContact O-ND2 3.47Å
73	G	92.2	Very high	91.9	Very high	32 Å²	32	91.3 Å²	91.3	33%	0.33	51%	0.508	S	S	.	.	H	α-helix	trans	-58.3	-41.6	174	0	0	0	0	0	112.4	S69 V70 N76 A77	S69-G73 PolarHBondContact O-N 2.83Å; V70-G73 PolarHBondContact O-N 3.28Å; G73-N76 PolarHBondContact O-N 3.45Å; G73-A77 WeakPolarHBondContact O-CB 3.48Å; G73-A77 PolarHBondContact O-N 3Å
74	L	95	Very high	92.3	Very high	115 Å²	115	94.9 Å²	94.9	60%	0.602	52%	0.522	S	S	*	.	H	α-helix	trans	-65.8	-43.2	177.4	-176.1	63.2	0	0	0	112.2	V70 K71 E72 A77 V78	V70-L74 WeakPolarHBondContact O-CB 3.02Å; V70-L74 PolarHBondContact O-N 2.88Å; K71-L74 PolarHBondContact O-N 3.43Å; E72-L74 VanDerWaalsContact C-N 3.3Å; E72-L74 PolarHBondContact O-N 3.09Å; L74-A77 WeakPolarHBondContact O-CB 3.17Å; L74-A77 PolarHBondContact O-N 2.93Å; L74-V78 WeakPolarHBondContact O-CG2 3.47Å; L74-V78 PolarHBondContact O-N 3.09Å
75	V	96.1	Very high	92.8	Very high	83 Å²	83	96.3 Å²	96.3	50%	0.503	53%	0.528	S	S	.	.	H	α-helix	trans	-61.1	-46.1	176.2	172.2	0	0	0	0	110.6	K71 E72 A77 V78 V79	K71-V75 WeakPolarHBondContact O-CG2 3.28Å; K71-V75 PolarHBondContact O-N 3.13Å; K71-V75 VanDerWaalsContact O-N 3.12Å; E72-V75 PolarHBondContact O-N 3.4Å; V75-A77 VanDerWaalsContact C-N 3.28Å; V75-A77 PolarHBondContact O-N 3.39Å; V75-V78 PolarHBondContact O-N 3.29Å; V75-V79 WeakPolarHBondContact O-CG2 3.41Å; V75-V79 PolarHBondContact O-N 2.83Å
76	N	93.2	Very high	93.1	Very high	84 Å²	84	96.3 Å²	96.3	45%	0.449	53%	0.529	S	S	.	.	H	α-helix	trans	-62	-36.7	176.9	-70.1	-22.6	0	0	0	112.1	E72 G73 T80	E72-N76 PolarHBondContact O-N 3.26Å; E72-N76 PolarHBondContact O-ND2 3.47Å; G73-N76 PolarHBondContact O-N 3.45Å; N76-T80 WeakPolarHBondContact O-CB 3.34Å; N76-T80 PolarHBondContact O-N 3.41Å; N76-T80 PolarHBondContact O-OG1 3.48Å
77	A	94.2	Very high	93.4	Very high	47 Å²	47	95.8 Å²	95.8	39%	0.388	53%	0.527	S	S	.	.	H	α-helix	trans	-65.6	-44	175.5	0	0	0	0	0	112	G73 L74 V75 T80 V81	G73-A77 WeakPolarHBondContact O-CB 3.48Å; G73-A77 PolarHBondContact O-N 3Å; L74-A77 WeakPolarHBondContact O-CB 3.17Å; L74-A77 PolarHBondContact O-N 2.93Å; V75-A77 VanDerWaalsContact C-N 3.28Å; V75-A77 PolarHBondContact O-N 3.39Å; A77-T80 WeakPolarHBondContact O-CB 3.37Å; A77-T80 PolarHBondContact O-N 3.43Å; A77-V81 WeakPolarHBondContact O-CG2 3.32Å; A77-V81 PolarHBondContact O-N 2.91Å
78	V	97.3	Very high	93.5	Very high	92 Å²	92	94.3 Å²	94.3	56%	0.558	51%	0.513	S	S	*	.	H	α-helix	trans	-62.3	-45.2	177.6	172.9	0	0	0	0	111.3	L74 V75 T80 V81 E82	L74-V78 WeakPolarHBondContact O-CG2 3.47Å; L74-V78 PolarHBondContact O-N 3.09Å; V75-V78 PolarHBondContact O-N 3.29Å; V78-T80 VanDerWaalsContact C-N 3.3Å; V78-T80 PolarHBondContact O-N 2.87Å; V78-V81 PolarHBondContact O-N 2.89Å; V78-E82 PolarHBondContact O-N 3.38Å
79	V	95	Very high	93.6	Very high	70 Å²	70	95.9 Å²	95.9	42%	0.424	52%	0.518	S	S	.	.	H	α-helix	trans	-62.3	-39.2	175.5	175.7	0	0	0	0	111	V75 V81 E82 V83	V75-V79 WeakPolarHBondContact O-CG2 3.41Å; V75-V79 PolarHBondContact O-N 2.83Å; V79-V81 PolarHBondContact O-N 2.87Å; V79-E82 WeakPolarHBondContact O-CB 3.4Å; V79-E82 PolarHBondContact O-N 2.8Å; V79-V83 WeakPolarHBondContact O-CG2 3.22Å; V79-V83 PolarHBondContact O-N 2.65Å
80	T	94.1	Very high	93.5	Very high	83 Å²	83	94.9 Å²	94.9	51%	0.509	52%	0.517	S	S	.	.	H	α-helix	trans	-62.2	-43.7	175.8	-57.6	0	0	0	0	111.3	N76 A77 V78 E82 V83 L84	N76-T80 WeakPolarHBondContact O-CB 3.34Å; N76-T80 PolarHBondContact O-N 3.41Å; N76-T80 PolarHBondContact O-OG1 3.48Å; A77-T80 WeakPolarHBondContact O-CB 3.37Å; A77-T80 PolarHBondContact O-N 3.43Å; V78-T80 VanDerWaalsContact C-N 3.3Å; V78-T80 PolarHBondContact O-N 2.87Å; T80-E82 VanDerWaalsContact C-N 3.33Å; T80-E82 PolarHBondContact O-N 3.46Å; T80-V83 PolarHBondContact O-N 3.42Å; T80-L84 HydrophobicContact CG2-CD1 4.44Å; T80-L84 WeakPolarHBondContact O-CG 3.32Å; T80-L84 PolarHBondContact O-N 2.86Å
81	V	96.8	Very high	93.2	Very high	85 Å²	85	91.7 Å²	91.7	52%	0.515	49%	0.494	S	S	.	.	H	α-helix	trans	-62.5	-41.3	175.3	171.6	0	0	0	0	111	A77 V78 V79 V83 L84 C85	A77-V81 WeakPolarHBondContact O-CG2 3.32Å; A77-V81 PolarHBondContact O-N 2.91Å; V78-V81 PolarHBondContact O-N 2.89Å; V79-V81 PolarHBondContact O-N 2.87Å; V81-V83 PolarHBondContact O-N 3.46Å; V81-L84 PolarHBondContact O-N 3.25Å; V81-C85 PolarHBondContact O-N 2.88Å; V81-C85 PolarHBondContact O-SG 3.36Å
82	E	94.6	Very high	92.9	Very high	103 Å²	103	86.4 Å²	86.4	48%	0.481	47%	0.472	S	S	.	.	H	α-helix	trans	-57	-49.6	175.9	-172.2	-167.6	167.5	0	0	111.7	V78 V79 T80 L84 C85 W86	V78-E82 PolarHBondContact O-N 3.38Å; V79-E82 WeakPolarHBondContact O-CB 3.4Å; V79-E82 PolarHBondContact O-N 2.8Å; T80-E82 VanDerWaalsContact C-N 3.33Å; T80-E82 PolarHBondContact O-N 3.46Å; E82-L84 VanDerWaalsContact C-N 3.31Å; E82-L84 PolarHBondContact O-N 3.41Å; E82-C85 WeakPolarHBondContact O-CB 3.38Å; E82-C85 PolarHBondContact O-N 3.44Å; E82-C85 VanDerWaalsContact O-N 3.14Å; E82-W86 PolarHBondContact O-N 2.95Å
83	V	92.8	Very high	92.7	Very high	93 Å²	93	87.5 Å²	87.5	56%	0.564	48%	0.48	S	S	*	.	H	α-helix	trans	-62.4	-37.7	178.5	176.5	0	0	0	0	111.6	V79 T80 V81 W86 F87	V79-V83 WeakPolarHBondContact O-CG2 3.22Å; V79-V83 PolarHBondContact O-N 2.65Å; T80-V83 PolarHBondContact O-N 3.42Å; V81-V83 PolarHBondContact O-N 3.46Å; V83-W86 WeakPolarHBondContact O-CB 3.4Å; V83-W86 PolarHBondContact O-N 2.83Å; V83-F87 PolarHBondContact O-N 2.86Å
84	L	94	Very high	92.3	Very high	95 Å²	95	89 Å²	89	50%	0.497	50%	0.495	S	S	.	.	H	α-helix	trans	-66.2	-39.5	174	-69.9	173.8	0	0	0	112.1	T80 V81 E82 W86 F87 F88	T80-L84 HydrophobicContact CG2-CD1 4.44Å; T80-L84 WeakPolarHBondContact O-CG 3.32Å; T80-L84 PolarHBondContact O-N 2.86Å; V81-L84 PolarHBondContact O-N 3.25Å; E82-L84 VanDerWaalsContact C-N 3.31Å; E82-L84 PolarHBondContact O-N 3.41Å; L84-W86 VanDerWaalsContact C-N 3.29Å; L84-W86 PolarHBondContact O-N 2.85Å; L84-F87 WeakPolarHBondContact O-CB 3.21Å; L84-F87 PolarHBondContact O-N 2.86Å; L84-F87 VanDerWaalsContact O-N 3.11Å; L84-F88 WeakPolarHBondContact O-CD2 3.25Å; L84-F88 PolarHBondContact O-N 3.28Å
85	C	94.7	Very high	91.7	Very high	67 Å²	67	86.2 Å²	86.2	45%	0.453	48%	0.477	S	S	.	.	H	α-helix	trans	-61.1	-37.1	174.5	-72.3	0	0	0	0	112	V81 E82 F87 F88 M89	V81-C85 PolarHBondContact O-N 2.88Å; V81-C85 PolarHBondContact O-SG 3.36Å; E82-C85 WeakPolarHBondContact O-CB 3.38Å; E82-C85 PolarHBondContact O-N 3.44Å; E82-C85 VanDerWaalsContact O-N 3.14Å; C85-F87 VanDerWaalsContact C-N 3.28Å; C85-F87 PolarHBondContact O-N 3.44Å; C85-F88 PolarHBondContact O-N 2.68Å; C85-M89 WeakPolarHBondContact O-CG 3.32Å; C85-M89 PolarHBondContact O-N 2.83Å
86	W	91.4	Very high	91	Very high	145 Å²	145	91.6 Å²	91.6	55%	0.549	49%	0.488	S	S	.	.	H	α-helix	trans	-60.5	-35.8	173.2	-79.7	107.9	0	0	0	112.9	L38 E82 V83 L84 G90	L38-W86 HydrophobicContact CD2-CH2 4.35Å; L38-W86 HydrophobicContact CD2-CZ2 3.9Å; E82-W86 PolarHBondContact O-N 2.95Å; V83-W86 WeakPolarHBondContact O-CB 3.4Å; V83-W86 PolarHBondContact O-N 2.83Å; L84-W86 VanDerWaalsContact C-N 3.29Å; L84-W86 PolarHBondContact O-N 2.85Å; W86-G90 PolarHBondContact O-N 3.45Å
87	F	91.4	Very high	90.3	Very high	142 Å²	142	88.8 Å²	88.8	62%	0.623	48%	0.475	S	S	*	.	H	α-helix	trans	-63.4	-47.6	173.2	176.3	-93.5	0	0	0	111.8	V83 L84 C85 M89 G90 E91	V83-F87 PolarHBondContact O-N 2.86Å; L84-F87 WeakPolarHBondContact O-CB 3.21Å; L84-F87 PolarHBondContact O-N 2.86Å; L84-F87 VanDerWaalsContact O-N 3.11Å; C85-F87 VanDerWaalsContact C-N 3.28Å; C85-F87 PolarHBondContact O-N 3.44Å; F87-M89 PolarHBondContact O-N 3.38Å; F87-G90 WeakPolarHBondContact O-CA 3.36Å; F87-G90 PolarHBondContact O-N 3.19Å; F87-G90 VanDerWaalsContact O-N 3.12Å; F87-E91 PolarHBondContact O-N 2.85Å
88	F	90.1	Very high	89.4	Confident	117 Å²	117	94.7 Å²	94.7	51%	0.513	49%	0.492	S	S	.	.	H	α-helix	trans	-64	-39.4	177	-68.5	-66.4	0	0	0	112.7	L84 C85 G90 E91 M92	L84-F88 WeakPolarHBondContact O-CD2 3.25Å; L84-F88 PolarHBondContact O-N 3.28Å; C85-F88 PolarHBondContact O-N 2.68Å; F88-G90 VanDerWaalsContact C-N 3.26Å; F88-G90 PolarHBondContact O-N 3.23Å; F88-E91 WeakPolarHBondContact O-CB 3.37Å; F88-E91 PolarHBondContact O-N 3.23Å; F88-E91 VanDerWaalsContact O-N 3.11Å; F88-M92 VanDerWaalsContact O-CG 3.31Å; F88-M92 WeakPolarHBondContact O-CG 3.47Å; F88-M92 PolarHBondContact O-N 2.91Å
89	M	90.5	Very high	88.3	Confident	90 Å²	90	95.5 Å²	95.5	44%	0.443	49%	0.493	S	S	.	.	H	α-helix	trans	-59.6	-38.9	172.4	-73.7	-64.4	-66.2	0	0	111.5	C85 F87 M92 I93	C85-M89 WeakPolarHBondContact O-CG 3.32Å; C85-M89 PolarHBondContact O-N 2.83Å; F87-M89 PolarHBondContact O-N 3.38Å; M89-M92 PolarHBondContact O-N 3.35Å; M89-M92 HydrophobicContact SD-CE 4.49Å; M89-M92 HydrophobicContact SD-SD 3.86Å; M89-I93 VanDerWaalsContact O-CG1 3.31Å; M89-I93 WeakPolarHBondContact O-CG1 3.32Å; M89-I93 PolarHBondContact O-N 3.48Å
90	G	89.8	Confident	86.9	Confident	41 Å²	41	93 Å²	93	42%	0.423	48%	0.482	S	S	.	.	H	α-helix	trans	-61.4	-42.4	171.7	0	0	0	0	0	113.1	W86 F87 F88 I93 G94	W86-G90 PolarHBondContact O-N 3.45Å; F87-G90 WeakPolarHBondContact O-CA 3.36Å; F87-G90 PolarHBondContact O-N 3.19Å; F87-G90 VanDerWaalsContact O-N 3.12Å; F88-G90 VanDerWaalsContact C-N 3.26Å; F88-G90 PolarHBondContact O-N 3.23Å; G90-I93 PolarHBondContact O-N 2.85Å; G90-G94 PolarHBondContact O-N 3.22Å
91	E	88.3	Confident	85.5	Confident	67 Å²	67	94.5 Å²	94.5	31%	0.313	48%	0.478	S	S	.	.	H	α-helix	trans	-62.5	-42.9	174.5	-163	-159.9	135.3	0	0	111.6	F87 F88 I93 G94 R95	F87-E91 PolarHBondContact O-N 2.85Å; F88-E91 WeakPolarHBondContact O-CB 3.37Å; F88-E91 PolarHBondContact O-N 3.23Å; F88-E91 VanDerWaalsContact O-N 3.11Å; E91-I93 PolarHBondContact O-N 3.03Å; E91-G94 PolarHBondContact O-N 2.87Å; E91-R95 HydrophobicContact CG-CG 4.38Å; E91-R95 WeakPolarHBondContact O-CB 3.28Å; E91-R95 VanDerWaalsContact O-CG 3.25Å; E91-R95 WeakPolarHBondContact O-CG 3.43Å; E91-R95 PolarHBondContact O-N 3.32Å; E91-R95 VanDerWaalsContact OE1-CD 3.23Å; E91-R95 WeakPolarHBondContact OE1-CD 3.41Å; E91-R95 IonicContact OE1-CZ 3.87Å; E91-R95 IonicContact OE1-NE 2.87Å; E91-R95 IonicContact OE1-NH1 3.36Å; E91-R95 PolarHBondContact OE1-NH1 3.14Å
92	M	86.8	Confident	83.8	Confident	61 Å²	61	94.5 Å²	94.5	30%	0.3	48%	0.482	S	S	.	.	H	α-helix	trans	-61	-43.3	176.8	-67.6	169.1	72	0	0	111.7	F88 M89 R96 S97 F98	F88-M92 VanDerWaalsContact O-CG 3.31Å; F88-M92 WeakPolarHBondContact O-CG 3.47Å; F88-M92 PolarHBondContact O-N 2.91Å; M89-M92 PolarHBondContact O-N 3.35Å; M89-M92 HydrophobicContact SD-CE 4.49Å; M89-M92 HydrophobicContact SD-SD 3.86Å; M92-R96 PolarHBondContact O-N 3.21Å; M92-S97 PolarHBondContact O-N 3.08Å; M92-F98 HydrophobicContact CE-CB 4.3Å; M92-F98 HydrophobicContact CE-CD1 3.55Å; M92-F98 HydrophobicContact CE-CE1 4.34Å; M92-F98 HydrophobicContact CE-CG 4.35Å
93	I	88.1	Confident	82.1	Confident	125 Å²	125	97 Å²	97	64%	0.641	49%	0.488	S	S	*	.	H	α-helix	trans	-65.2	-44.7	175	-66.8	164.6	0	0	0	110.6	M89 G90 E91 R95 R96	M89-I93 VanDerWaalsContact O-CG1 3.31Å; M89-I93 WeakPolarHBondContact O-CG1 3.32Å; M89-I93 PolarHBondContact O-N 3.48Å; G90-I93 PolarHBondContact O-N 2.85Å; E91-I93 PolarHBondContact O-N 3.03Å; I93-R95 PolarHBondContact O-N 3.44Å; I93-R96 WeakPolarHBondContact O-CG 3.31Å; I93-R96 PolarHBondContact O-N 3.4Å; I93-R96 VanDerWaalsContact O-N 3.13Å
94	G	85.2	Confident	80.5	Confident	63 Å²	63	95.7 Å²	95.7	65%	0.649	48%	0.479	S	S	*	.	H	α-helix	trans	-63.4	-40.7	179.6	0	0	0	0	0	113.3	G90 E91 R96	G90-G94 PolarHBondContact O-N 3.22Å; E91-G94 PolarHBondContact O-N 2.87Å; G94-R96 VanDerWaalsContact C-N 3.28Å; G94-R96 PolarHBondContact O-N 3.08Å
95	R	82.1	Confident	78.8	Confident	57 Å²	57	95.4 Å²	95.4	22%	0.215	48%	0.483	C	S	.	.	H	α-helix	trans	-73.6	-21	174.8	-68.4	170.4	58.2	178.1	-3	112.6	E91 I93 S97 G100 Y101 R103	E91-R95 HydrophobicContact CG-CG 4.38Å; E91-R95 WeakPolarHBondContact O-CB 3.28Å; E91-R95 VanDerWaalsContact O-CG 3.25Å; E91-R95 WeakPolarHBondContact O-CG 3.43Å; E91-R95 PolarHBondContact O-N 3.32Å; E91-R95 VanDerWaalsContact OE1-CD 3.23Å; E91-R95 WeakPolarHBondContact OE1-CD 3.41Å; E91-R95 IonicContact OE1-CZ 3.87Å; E91-R95 IonicContact OE1-NE 2.87Å; E91-R95 IonicContact OE1-NH1 3.36Å; E91-R95 PolarHBondContact OE1-NH1 3.14Å; I93-R95 PolarHBondContact O-N 3.44Å; R95-S97 PolarHBondContact O-N 2.94Å; R95-G100 PolarHBondContact NH2-O 3.23Å; R95-Y101 VanDerWaalsContact CD-CE1 3.4Å; R95-Y101 HydrophobicContact CG-CD1 4.09Å; R95-Y101 HydrophobicContact CG-CE1 3.54Å; R95-Y101 VanDerWaalsContact NE-CD1 3.33Å; R95-R103 PolarHBondContact O-NH1 3.18Å
96	R	81.6	Confident	77.2	Confident	197 Å²	197	100.8 Å²	100.8	74%	0.743	50%	0.501	S	S	*	.	T	Hydrogen-bonded Turn	trans	54.4	39.7	-172.2	-53.8	173.8	179.3	162.6	-0.5	111.9	M92 I93 G94	M92-R96 PolarHBondContact O-N 3.21Å; I93-R96 WeakPolarHBondContact O-CG 3.31Å; I93-R96 PolarHBondContact O-N 3.4Å; I93-R96 VanDerWaalsContact O-N 3.13Å; G94-R96 VanDerWaalsContact C-N 3.28Å; G94-R96 PolarHBondContact O-N 3.08Å
97	S	76.8	Confident	75.6	Confident	25 Å²	25	96.9 Å²	96.9	18%	0.175	49%	0.493	C	S	.	.			trans	-149.3	131.4	178.2	-161.4	0	0	0	0	109.1	M92 R95 L99 G100	M92-S97 PolarHBondContact O-N 3.08Å; R95-S97 PolarHBondContact O-N 2.94Å; S97-L99 PolarHBondContact OG-O 3.37Å; S97-G100 VanDerWaalsContact CB-O 3.25Å; S97-G100 WeakPolarHBondContact CB-O 3.39Å; S97-G100 PolarHBondContact OG-O 3.41Å
98	F	75	Confident	73.8	Confident	171 Å²	171	97.9 Å²	97.9	75%	0.75	49%	0.494	S	S	*	.	S	Bend	trans	-74.7	-39.2	177.6	-72.6	-83.9	0	0	0	111.8	M92	M92-F98 HydrophobicContact CE-CB 4.3Å; M92-F98 HydrophobicContact CE-CD1 3.55Å; M92-F98 HydrophobicContact CE-CE1 4.34Å; M92-F98 HydrophobicContact CE-CG 4.35Å
99	L	74.5	Confident	72.3	Confident	109 Å²	109	98.7 Å²	98.7	57%	0.571	50%	0.503	S	S	*	.	S	Bend	trans	-124.7	138.4	174	-96.6	75.2	0	0	0	109.3	S97 Q111	S97-L99 PolarHBondContact OG-O 3.37Å; L99-Q111 HydrophobicContact CD2-CG 4.44Å
100	G	66.8	Low	70.6	Confident	18 Å²	18	99 Å²	99	19%	0.186	51%	0.51	C	S	.	.	S	Bend	trans	63.8	173.8	171.2	0	0	0	0	0	115	R95 S97	R95-G100 PolarHBondContact NH2-O 3.23Å; S97-G100 VanDerWaalsContact CB-O 3.25Å; S97-G100 WeakPolarHBondContact CB-O 3.39Å; S97-G100 PolarHBondContact OG-O 3.41Å
101	Y	63.9	Low	68.9	Low	113 Å²	113	104.5 Å²	104.5	44%	0.443	52%	0.524	S	S	.	.			trans	-100.2	104.2	172.9	-72.3	-90.5	0	0	0	108.1	R95 R103 V104	R95-Y101 VanDerWaalsContact CD-CE1 3.4Å; R95-Y101 HydrophobicContact CG-CD1 4.09Å; R95-Y101 HydrophobicContact CG-CE1 3.54Å; R95-Y101 VanDerWaalsContact NE-CD1 3.33Å; Y101-R103 PolarHBondContact O-N 3.22Å; Y101-V104 HydrophobicContact CD1-CG2 4.41Å; Y101-V104 HydrophobicContact CG-CG2 3.98Å
102	S	60.5	Low	66.7	Low	85 Å²	85	113 Å²	113	59%	0.594	56%	0.563	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.2	-17.4	-179.9	173.6	0	0	0	0	113.5
103	R	59.3	Low	65.7	Low	157 Å²	157	115.6 Å²	115.6	59%	0.592	58%	0.577	S	S	*	*	T	Hydrogen-bonded Turn	trans	-108.1	11.2	-170.6	-58	-169.1	-163.8	77.2	14.1	115.7	R95 Y101	R95-R103 PolarHBondContact O-NH1 3.18Å; Y101-R103 PolarHBondContact O-N 3.22Å
104	V	60.1	Low	64.5	Low	65 Å²	65	115.1 Å²	115.1	39%	0.394	57%	0.573	S	S	.	*	S	Bend	trans	-116.4	123.4	173.6	-119	0	0	0	0	109.6	Y101 H106 T107	Y101-V104 HydrophobicContact CD1-CG2 4.41Å; Y101-V104 HydrophobicContact CG-CG2 3.98Å; V104-H106 PolarHBondContact O-N 3.29Å; V104-T107 HydrophobicContact CB-CG2 4.44Å; V104-T107 HydrophobicContact CG2-CG2 4.48Å
105	P	57.8	Low	63.4	Low	89 Å²	89	118 Å²	118	58%	0.578	57%	0.569	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.5	136	168.6	-19	31.4	0	0	0	109.6
106	H	62.2	Low	62.3	Low	179 Å²	179	121.6 Å²	121.6	83%	0.829	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	83.6	9	176.8	-42.2	91.4	0	0	0	118.1	V104	V104-H106 PolarHBondContact O-N 3.29Å
107	T	56.6	Low	61	Low	63 Å²	63	116.9 Å²	116.9	39%	0.387	58%	0.58	S	S	.	*			trans	-119.2	55.2	170.8	81.5	0	0	0	0	111.8	V104 I109	V104-T107 HydrophobicContact CB-CG2 4.44Å; V104-T107 HydrophobicContact CG2-CG2 4.48Å; T107-I109 PolarHBondContact O-N 3.02Å
108	Y	53	Low	60	Low	163 Å²	163	123 Å²	123	64%	0.639	61%	0.607	S	S	*	*			trans	-89.1	102.3	173.7	-55.5	-75.1	0	0	0	108.9	V110	Y108-V110 PolarHBondContact O-N 3.34Å
109	I	59.4	Low	58.9	Low	134 Å²	134	119.6 Å²	119.6	69%	0.687	60%	0.597	S	S	*	*			trans	-70.9	95.4	152.9	-40.9	175	0	0	0	103.9	T107 Q111	T107-I109 PolarHBondContact O-N 3.02Å; I109-Q111 PolarHBondContact O-N 3.03Å; I109-Q111 VanDerWaalsContact O-N 3.09Å
110	V	54	Low	57.7	Low	98 Å²	98	120.4 Å²	120.4	59%	0.594	60%	0.599	S	S	*	*			trans	-63.9	108.9	174.9	-168.1	0	0	0	0	105.7	Y108 H112	Y108-V110 PolarHBondContact O-N 3.34Å; V110-H112 PolarHBondContact O-N 3.29Å; V110-H112 VanDerWaalsContact O-N 3.09Å
111	Q	54.5	Low	57	Low	156 Å²	156	128.9 Å²	128.9	73%	0.729	63%	0.633	S	S	*	*			trans	-66.7	106.8	159.4	-67.7	-171.7	-77.2	0	0	105.2	L99 I109	L99-Q111 HydrophobicContact CD2-CG 4.44Å; I109-Q111 PolarHBondContact O-N 3.03Å; I109-Q111 VanDerWaalsContact O-N 3.09Å
112	H	42.4	Very low	56.3	Low	245 Å²	245	130.4 Å²	130.4	100%	1.134	65%	0.651	S	S	*	*			trans	-62.7	0	161.3	-77.9	-76	0	0	0	110	V110	V110-H112 PolarHBondContact O-N 3.29Å; V110-H112 VanDerWaalsContact O-N 3.09Å

Retrieved 112 of 112 residues in 218.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).