G4V9V4_SCHMA Loading...

Putative synaptobrevin

AlphaFold DB , UniProt , Accession G4V9V4, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 101 aa.

						>G4V9V4_SCHMA|G4V9V4
MNNQYNYQADDRIRQQQAKVQEVVGIMKDNVNLVLERETRLAEIDTRADELQVQSKQFQAVAGRVRRKYFWQNMKMWFVMGGLAVVIVVVIIVWSVSNKHS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.3	Low	80.4	Confident	199 Å²	199	119.9 Å²	119.9	98%	0.98	59%	0.59	S	S	*	*				0	-43.2	0	-70.3	164.5	-175.6	0	0	112.7	N3 Q4 Y5	M1-N3 PolarHBondContact O-N 3.36Å; M1-Q4 PolarHBondContact O-N 3.29Å; M1-Y5 VanDerWaalsContact O-CD2 3.24Å; M1-Y5 WeakPolarHBondContact O-CD2 3.11Å; M1-Y5 PolarHBondContact O-N 2.99Å
2	N	75.6	Confident	81.2	Confident	143 Å²	143	123.3 Å²	123.3	77%	0.765	59%	0.592	S	S	*	*	H	α-helix	trans	-55.4	-44.2	177.9	-110.4	-10.5	0	0	0	115.1	Q4 Y5 N6	N2-Q4 VanDerWaalsContact C-N 3.34Å; N2-Q4 PolarHBondContact O-N 3.17Å; N2-Y5 PolarHBondContact O-N 3.5Å; N2-N6 PolarHBondContact O-N 3.44Å
3	N	77.9	Confident	82.1	Confident	119 Å²	119	120 Å²	120	64%	0.636	58%	0.578	S	S	*	*	H	α-helix	trans	-62.2	-38.6	179.7	-81.6	23.8	0	0	0	113.1	M1 Y5 N6 Y7	M1-N3 PolarHBondContact O-N 3.36Å; N3-Y5 PolarHBondContact O-N 3.27Å; N3-N6 PolarHBondContact O-N 3.47Å; N3-Y7 HydrophobicContact CB-CE2 4.44Å; N3-Y7 WeakPolarHBondContact O-CD2 3.36Å; N3-Y7 PolarHBondContact O-N 2.79Å
4	Q	74.9	Confident	82.8	Confident	126 Å²	126	122.6 Å²	122.6	59%	0.589	58%	0.579	S	S	*	*	H	α-helix	trans	-66.2	-39.5	-178.7	-173.4	-179.8	-41.2	0	0	111.8	M1 N2 N6 Y7 Q8	M1-Q4 PolarHBondContact O-N 3.29Å; N2-Q4 VanDerWaalsContact C-N 3.34Å; N2-Q4 PolarHBondContact O-N 3.17Å; Q4-N6 VanDerWaalsContact C-N 3.29Å; Q4-N6 PolarHBondContact O-N 3.25Å; Q4-Y7 PolarHBondContact O-N 3.34Å; Q4-Q8 WeakPolarHBondContact O-CG 3.33Å; Q4-Q8 PolarHBondContact O-N 2.91Å
5	Y	78.1	Confident	83.5	Confident	165 Å²	165	123.5 Å²	123.5	65%	0.647	58%	0.583	S	S	*	*	H	α-helix	trans	-62.6	-38	172.9	-74.1	-74.1	0	0	0	111.8	M1 N2 N3 Q8 A9	M1-Y5 VanDerWaalsContact O-CD2 3.24Å; M1-Y5 WeakPolarHBondContact O-CD2 3.11Å; M1-Y5 PolarHBondContact O-N 2.99Å; N2-Y5 PolarHBondContact O-N 3.5Å; N3-Y5 PolarHBondContact O-N 3.27Å; Y5-Q8 PolarHBondContact O-N 2.95Å; Y5-A9 VanDerWaalsContact O-CB 3.3Å; Y5-A9 WeakPolarHBondContact O-CB 3.24Å; Y5-A9 PolarHBondContact O-N 3.45Å
6	N	83.8	Confident	84.1	Confident	117 Å²	117	123.1 Å²	123.1	63%	0.626	58%	0.581	S	S	*	*	H	α-helix	trans	-68.2	-41.1	178.9	-158.9	31.7	0	0	0	112.4	N2 N3 Q4 A9 D10	N2-N6 PolarHBondContact O-N 3.44Å; N3-N6 PolarHBondContact O-N 3.47Å; Q4-N6 VanDerWaalsContact C-N 3.29Å; Q4-N6 PolarHBondContact O-N 3.25Å; N6-A9 PolarHBondContact O-N 3.5Å; N6-D10 PolarHBondContact O-N 3.19Å
7	Y	83.6	Confident	84.7	Confident	158 Å²	158	122.2 Å²	122.2	62%	0.62	58%	0.576	S	S	*	*	H	α-helix	trans	-61.5	-48	173.4	-80.2	-73.1	0	0	0	111.8	N3 Q4 A9 D10 D11	N3-Y7 HydrophobicContact CB-CE2 4.44Å; N3-Y7 WeakPolarHBondContact O-CD2 3.36Å; N3-Y7 PolarHBondContact O-N 2.79Å; Q4-Y7 PolarHBondContact O-N 3.34Å; Y7-A9 VanDerWaalsContact C-N 3.27Å; Y7-A9 PolarHBondContact O-N 2.92Å; Y7-D10 PolarHBondContact O-N 3.33Å; Y7-D11 PolarHBondContact O-N 3.47Å
8	Q	86.3	Confident	85.3	Confident	89 Å²	89	118.4 Å²	118.4	42%	0.416	57%	0.569	S	S	.	*	H	α-helix	trans	-61.4	-37.3	177.3	-70.8	-179.4	6.4	0	0	112.1	Q4 Y5 R12	Q4-Q8 WeakPolarHBondContact O-CG 3.33Å; Q4-Q8 PolarHBondContact O-N 2.91Å; Y5-Q8 PolarHBondContact O-N 2.95Å; Q8-R12 WeakPolarHBondContact O-CG 3.3Å; Q8-R12 PolarHBondContact O-N 3.38Å; Q8-R12 VanDerWaalsContact O-N 3.13Å
9	A	86.7	Confident	85.8	Confident	45 Å²	45	119.6 Å²	119.6	37%	0.372	57%	0.571	S	S	.	*	H	α-helix	trans	-65.7	-47.9	175.5	0	0	0	0	0	111.6	Y5 N6 Y7 D11 R12 I13	Y5-A9 VanDerWaalsContact O-CB 3.3Å; Y5-A9 WeakPolarHBondContact O-CB 3.24Å; Y5-A9 PolarHBondContact O-N 3.45Å; N6-A9 PolarHBondContact O-N 3.5Å; Y7-A9 VanDerWaalsContact C-N 3.27Å; Y7-A9 PolarHBondContact O-N 2.92Å; A9-D11 VanDerWaalsContact C-N 3.34Å; A9-D11 PolarHBondContact O-N 3.37Å; A9-R12 PolarHBondContact O-N 3.06Å; A9-I13 WeakPolarHBondContact O-CG1 3.32Å; A9-I13 PolarHBondContact O-N 3.48Å
10	D	87.6	Confident	86.3	Confident	72 Å²	72	118.3 Å²	118.3	39%	0.385	57%	0.571	S	S	.	*	H	α-helix	trans	-59.5	-44	177.6	-166.3	59.5	0	0	0	111.5	N6 Y7 R12 I13 R14	N6-D10 PolarHBondContact O-N 3.19Å; Y7-D10 PolarHBondContact O-N 3.33Å; D10-R12 PolarHBondContact O-N 3.45Å; D10-I13 PolarHBondContact O-N 2.96Å; D10-R14 WeakPolarHBondContact O-CG 3.27Å; D10-R14 PolarHBondContact O-N 3.49Å; D10-R14 IonicContact OD2-CZ 3.46Å; D10-R14 IonicContact OD2-NE 2.79Å; D10-R14 PolarHBondContact OD2-NE 3.22Å; D10-R14 IonicContact OD2-NH2 3.29Å; D10-R14 PolarHBondContact OD2-NH2 3.17Å
11	D	90.6	Very high	86.8	Confident	86 Å²	86	119.3 Å²	119.3	46%	0.46	58%	0.575	S	S	.	*	H	α-helix	trans	-59.9	-44.2	176.9	-73.6	-25.7	0	0	0	111.9	Y7 A9 R14 Q15	Y7-D11 PolarHBondContact O-N 3.47Å; A9-D11 VanDerWaalsContact C-N 3.34Å; A9-D11 PolarHBondContact O-N 3.37Å; D11-R14 PolarHBondContact O-N 3.39Å; D11-Q15 VanDerWaalsContact O-CG 3.29Å; D11-Q15 WeakPolarHBondContact O-CG 3.36Å; D11-Q15 PolarHBondContact O-N 2.96Å
12	R	90.5	Very high	88.5	Confident	160 Å²	160	115.7 Å²	115.7	60%	0.604	56%	0.556	S	S	*	*	H	α-helix	trans	-64.8	-39.1	176	-70.3	-138.8	-57.9	-102.6	3	112.1	Q8 A9 D10 Q15 Q16	Q8-R12 WeakPolarHBondContact O-CG 3.3Å; Q8-R12 PolarHBondContact O-N 3.38Å; Q8-R12 VanDerWaalsContact O-N 3.13Å; A9-R12 PolarHBondContact O-N 3.06Å; D10-R12 PolarHBondContact O-N 3.45Å; R12-Q15 PolarHBondContact O-N 2.94Å; R12-Q16 WeakPolarHBondContact O-CB 3.41Å; R12-Q16 VanDerWaalsContact O-CG 3.27Å; R12-Q16 WeakPolarHBondContact O-CG 3.29Å; R12-Q16 PolarHBondContact O-N 2.89Å
13	I	91.9	Very high	89.5	Confident	81 Å²	81	112.4 Å²	112.4	42%	0.415	54%	0.541	S	S	.	.	H	α-helix	trans	-65	-44.4	176.5	-67.7	-63.9	0	0	0	110.6	A9 D10 Q15 Q16 Q17	A9-I13 WeakPolarHBondContact O-CG1 3.32Å; A9-I13 PolarHBondContact O-N 3.48Å; D10-I13 PolarHBondContact O-N 2.96Å; I13-Q15 PolarHBondContact O-N 3.42Å; I13-Q16 PolarHBondContact O-N 3.46Å; I13-Q17 HydrophobicContact CG2-CG 4.38Å; I13-Q17 WeakPolarHBondContact O-CB 3.43Å; I13-Q17 WeakPolarHBondContact O-CG 3.36Å; I13-Q17 PolarHBondContact O-N 3.24Å
14	R	92.5	Very high	90.4	Very high	156 Å²	156	110.1 Å²	110.1	59%	0.589	53%	0.531	S	S	*	.	H	α-helix	trans	-60.9	-43.8	175.9	-72.2	176.3	-176.8	-123.4	-0.7	112.1	D10 D11 Q16 Q17 A18	D10-R14 WeakPolarHBondContact O-CG 3.27Å; D10-R14 PolarHBondContact O-N 3.49Å; D10-R14 IonicContact OD2-CZ 3.46Å; D10-R14 IonicContact OD2-NE 2.79Å; D10-R14 PolarHBondContact OD2-NE 3.22Å; D10-R14 IonicContact OD2-NH2 3.29Å; D10-R14 PolarHBondContact OD2-NH2 3.17Å; D11-R14 PolarHBondContact O-N 3.39Å; R14-Q16 VanDerWaalsContact C-N 3.34Å; R14-Q16 PolarHBondContact O-N 2.85Å; R14-Q17 PolarHBondContact O-N 3.13Å; R14-A18 WeakPolarHBondContact O-CB 3.34Å; R14-A18 PolarHBondContact O-N 2.91Å
15	Q	93.1	Very high	91.5	Very high	137 Å²	137	105.4 Å²	105.4	64%	0.64	52%	0.516	S	S	*	.	H	α-helix	trans	-61.6	-42.4	174.9	-73.2	174.7	9.3	0	0	111.8	D11 R12 I13 A18 K19	D11-Q15 VanDerWaalsContact O-CG 3.29Å; D11-Q15 WeakPolarHBondContact O-CG 3.36Å; D11-Q15 PolarHBondContact O-N 2.96Å; R12-Q15 PolarHBondContact O-N 2.94Å; I13-Q15 PolarHBondContact O-N 3.42Å; Q15-A18 PolarHBondContact O-N 2.91Å; Q15-K19 WeakPolarHBondContact O-CB 3.5Å; Q15-K19 PolarHBondContact O-N 3.41Å
16	Q	93.6	Very high	92.4	Very high	117 Å²	117	101.4 Å²	101.4	55%	0.547	51%	0.505	S	S	.	.	H	α-helix	trans	-65.2	-41.7	176.1	-75.2	177.8	-21.4	0	0	112	R12 I13 R14 K19 V20	R12-Q16 WeakPolarHBondContact O-CB 3.41Å; R12-Q16 VanDerWaalsContact O-CG 3.27Å; R12-Q16 WeakPolarHBondContact O-CG 3.29Å; R12-Q16 PolarHBondContact O-N 2.89Å; I13-Q16 PolarHBondContact O-N 3.46Å; R14-Q16 VanDerWaalsContact C-N 3.34Å; R14-Q16 PolarHBondContact O-N 2.85Å; Q16-K19 PolarHBondContact O-N 2.89Å; Q16-V20 VanDerWaalsContact O-CG2 3.29Å; Q16-V20 WeakPolarHBondContact O-CG2 3.31Å; Q16-V20 PolarHBondContact O-N 3.24Å
17	Q	93.9	Very high	93.1	Very high	107 Å²	107	100.8 Å²	100.8	50%	0.5	50%	0.5	S	S	.	.	H	α-helix	trans	-63.5	-42.9	175.3	-74	178	-5.1	0	0	112	I13 R14 K19 V20 Q21	I13-Q17 HydrophobicContact CG2-CG 4.38Å; I13-Q17 WeakPolarHBondContact O-CB 3.43Å; I13-Q17 WeakPolarHBondContact O-CG 3.36Å; I13-Q17 PolarHBondContact O-N 3.24Å; R14-Q17 PolarHBondContact O-N 3.13Å; Q17-K19 VanDerWaalsContact C-N 3.34Å; Q17-K19 PolarHBondContact O-N 3.47Å; Q17-V20 PolarHBondContact O-N 3.44Å; Q17-Q21 WeakPolarHBondContact O-CG 3.43Å; Q17-Q21 PolarHBondContact O-N 2.83Å
18	A	95	Very high	93.7	Very high	55 Å²	55	99.7 Å²	99.7	46%	0.455	50%	0.498	S	S	.	.	H	α-helix	trans	-60.7	-44.6	175.5	0	0	0	0	0	111.2	R14 Q15 V20 Q21 E22	R14-A18 WeakPolarHBondContact O-CB 3.34Å; R14-A18 PolarHBondContact O-N 2.91Å; Q15-A18 PolarHBondContact O-N 2.91Å; A18-V20 VanDerWaalsContact C-N 3.35Å; A18-V20 PolarHBondContact O-N 3.49Å; A18-Q21 PolarHBondContact O-N 3.46Å; A18-E22 WeakPolarHBondContact O-CB 3.41Å; A18-E22 PolarHBondContact O-N 3.36Å
19	K	94.9	Very high	94.3	Very high	140 Å²	140	100.4 Å²	100.4	61%	0.609	51%	0.505	S	S	*	.	H	α-helix	trans	-62.3	-40.3	175.1	-172.5	174.3	-176.1	176.8	0	112.3	Q15 Q16 Q17 E22 V23	Q15-K19 WeakPolarHBondContact O-CB 3.5Å; Q15-K19 PolarHBondContact O-N 3.41Å; Q16-K19 PolarHBondContact O-N 2.89Å; Q17-K19 VanDerWaalsContact C-N 3.34Å; Q17-K19 PolarHBondContact O-N 3.47Å; K19-E22 PolarHBondContact O-N 2.98Å; K19-V23 VanDerWaalsContact O-CG2 3.31Å; K19-V23 WeakPolarHBondContact O-CG2 3.49Å; K19-V23 PolarHBondContact O-N 3.24Å
20	V	95.9	Very high	94.8	Very high	93 Å²	93	101.8 Å²	101.8	56%	0.564	51%	0.506	S	S	*	.	H	α-helix	trans	-64.3	-43.7	175.2	170.2	0	0	0	0	110.7	Q16 Q17 A18 E22 V23 V24	Q16-V20 VanDerWaalsContact O-CG2 3.29Å; Q16-V20 WeakPolarHBondContact O-CG2 3.31Å; Q16-V20 PolarHBondContact O-N 3.24Å; Q17-V20 PolarHBondContact O-N 3.44Å; A18-V20 VanDerWaalsContact C-N 3.35Å; A18-V20 PolarHBondContact O-N 3.49Å; V20-E22 VanDerWaalsContact C-N 3.34Å; V20-E22 PolarHBondContact O-N 3.07Å; V20-V23 PolarHBondContact O-N 3.33Å; V20-V24 HydrophobicContact CG1-CG2 4.34Å; V20-V24 WeakPolarHBondContact O-CB 3.35Å; V20-V24 VanDerWaalsContact O-CG2 3.24Å; V20-V24 WeakPolarHBondContact O-CG2 3.47Å; V20-V24 PolarHBondContact O-N 3.31Å
21	Q	96.1	Very high	95.3	Very high	140 Å²	140	102 Å²	102	65%	0.654	51%	0.509	S	S	*	.	H	α-helix	trans	-62.2	-40.4	176.7	-71.9	175.7	18.6	0	0	112.3	Q17 A18 V24 G25	Q17-Q21 WeakPolarHBondContact O-CG 3.43Å; Q17-Q21 PolarHBondContact O-N 2.83Å; A18-Q21 PolarHBondContact O-N 3.46Å; Q21-V24 PolarHBondContact O-N 2.9Å; Q21-G25 PolarHBondContact O-N 2.99Å
22	E	96.7	Very high	95.6	Very high	124 Å²	124	102.6 Å²	102.6	58%	0.579	51%	0.513	S	S	*	.	H	α-helix	trans	-60.2	-51	174	-177.9	-174.2	-175.7	0	0	111.4	A18 K19 V20 V24 G25 I26	A18-E22 WeakPolarHBondContact O-CB 3.41Å; A18-E22 PolarHBondContact O-N 3.36Å; K19-E22 PolarHBondContact O-N 2.98Å; V20-E22 VanDerWaalsContact C-N 3.34Å; V20-E22 PolarHBondContact O-N 3.07Å; E22-V24 VanDerWaalsContact C-N 3.31Å; E22-V24 PolarHBondContact O-N 2.93Å; E22-G25 WeakPolarHBondContact O-CA 3.46Å; E22-G25 PolarHBondContact O-N 3.47Å; E22-I26 HydrophobicContact CG-CD1 4.27Å; E22-I26 WeakPolarHBondContact O-CG1 3.36Å; E22-I26 PolarHBondContact O-N 3.39Å
23	V	96.3	Very high	96	Very high	74 Å²	74	98.2 Å²	98.2	45%	0.448	50%	0.501	S	S	.	.	H	α-helix	trans	-62.8	-38.4	178.5	173.6	0	0	0	0	111.4	K19 V20 G25 I26 M27	K19-V23 VanDerWaalsContact O-CG2 3.31Å; K19-V23 WeakPolarHBondContact O-CG2 3.49Å; K19-V23 PolarHBondContact O-N 3.24Å; V20-V23 PolarHBondContact O-N 3.33Å; V23-G25 VanDerWaalsContact C-N 3.3Å; V23-G25 PolarHBondContact O-N 3.03Å; V23-I26 PolarHBondContact O-N 2.87Å; V23-M27 HydrophobicContact CG1-CG 4.42Å; V23-M27 WeakPolarHBondContact O-CB 3.38Å; V23-M27 WeakPolarHBondContact O-CG 3.44Å; V23-M27 PolarHBondContact O-N 3.32Å
24	V	96.9	Very high	96.2	Very high	70 Å²	70	97.6 Å²	97.6	42%	0.424	50%	0.501	S	S	.	.	H	α-helix	trans	-61.9	-39.7	172.8	168.3	0	0	0	0	110.9	V20 Q21 E22 M27 K28	V20-V24 HydrophobicContact CG1-CG2 4.34Å; V20-V24 WeakPolarHBondContact O-CB 3.35Å; V20-V24 VanDerWaalsContact O-CG2 3.24Å; V20-V24 WeakPolarHBondContact O-CG2 3.47Å; V20-V24 PolarHBondContact O-N 3.31Å; Q21-V24 PolarHBondContact O-N 2.9Å; E22-V24 VanDerWaalsContact C-N 3.31Å; E22-V24 PolarHBondContact O-N 2.93Å; V24-M27 PolarHBondContact O-N 3.09Å; V24-K28 HydrophobicContact CG1-CD 4.46Å; V24-K28 WeakPolarHBondContact O-CG 3.29Å; V24-K28 PolarHBondContact O-N 3.28Å
25	G	97.5	Very high	96.5	Very high	28 Å²	28	94.3 Å²	94.3	29%	0.289	50%	0.495	S	S	.	.	H	α-helix	trans	-57.3	-53.8	171.9	0	0	0	0	0	111.8	Q21 E22 V23 M27 K28 D29	Q21-G25 PolarHBondContact O-N 2.99Å; E22-G25 WeakPolarHBondContact O-CA 3.46Å; E22-G25 PolarHBondContact O-N 3.47Å; V23-G25 VanDerWaalsContact C-N 3.3Å; V23-G25 PolarHBondContact O-N 3.03Å; G25-M27 VanDerWaalsContact C-N 3.27Å; G25-M27 PolarHBondContact O-N 3.39Å; G25-K28 WeakPolarHBondContact O-CB 3.24Å; G25-K28 PolarHBondContact O-N 2.98Å; G25-K28 VanDerWaalsContact O-N 3.09Å; G25-D29 PolarHBondContact O-N 3.26Å
26	I	97.2	Very high	96.7	Very high	81 Å²	81	92 Å²	92	42%	0.415	48%	0.484	S	S	.	.	H	α-helix	trans	-57.1	-41.2	177.7	-64.7	167	0	0	0	111.4	E22 V23 D29 N30	E22-I26 HydrophobicContact CG-CD1 4.27Å; E22-I26 WeakPolarHBondContact O-CG1 3.36Å; E22-I26 PolarHBondContact O-N 3.39Å; V23-I26 PolarHBondContact O-N 2.87Å; I26-D29 PolarHBondContact O-N 3.03Å; I26-N30 WeakPolarHBondContact O-CB 3.41Å; I26-N30 VanDerWaalsContact O-CG 3.26Å; I26-N30 PolarHBondContact O-N 3.5Å; I26-N30 PolarHBondContact O-ND2 2.87Å
27	M	97.4	Very high	96.9	Very high	103 Å²	103	93.3 Å²	93.3	51%	0.507	48%	0.484	S	S	.	.	H	α-helix	trans	-68.9	-35.3	178.9	-73.8	-58.9	-63	0	0	112.6	V23 V24 G25 D29 N30 V31	V23-M27 HydrophobicContact CG1-CG 4.42Å; V23-M27 WeakPolarHBondContact O-CB 3.38Å; V23-M27 WeakPolarHBondContact O-CG 3.44Å; V23-M27 PolarHBondContact O-N 3.32Å; V24-M27 PolarHBondContact O-N 3.09Å; G25-M27 VanDerWaalsContact C-N 3.27Å; G25-M27 PolarHBondContact O-N 3.39Å; M27-D29 VanDerWaalsContact C-N 3.33Å; M27-N30 PolarHBondContact O-N 2.64Å; M27-V31 VanDerWaalsContact O-CG2 3.29Å; M27-V31 WeakPolarHBondContact O-CG2 3.32Å; M27-V31 PolarHBondContact O-N 3.22Å
28	K	97.9	Very high	97	Very high	135 Å²	135	93.6 Å²	93.6	59%	0.587	49%	0.485	S	S	*	.	H	α-helix	trans	-61.7	-43.8	171.8	-73.5	172.8	178.4	-179.3	0	110.9	V24 G25 N30 V31 N32	V24-K28 HydrophobicContact CG1-CD 4.46Å; V24-K28 WeakPolarHBondContact O-CG 3.29Å; V24-K28 PolarHBondContact O-N 3.28Å; G25-K28 WeakPolarHBondContact O-CB 3.24Å; G25-K28 PolarHBondContact O-N 2.98Å; G25-K28 VanDerWaalsContact O-N 3.09Å; K28-N30 VanDerWaalsContact C-N 3.35Å; K28-N30 PolarHBondContact O-N 3.34Å; K28-V31 PolarHBondContact O-N 3.36Å; K28-N32 PolarHBondContact O-N 3.46Å; K28-N32 PolarHBondContact O-ND2 3.36Å
29	D	98	Very high	97.1	Very high	104 Å²	104	95.5 Å²	95.5	56%	0.556	49%	0.491	S	S	*	.	H	α-helix	trans	-64.2	-41	176.9	-64.4	-21.4	0	0	0	111.4	G25 I26 M27 V31 N32 L33	G25-D29 PolarHBondContact O-N 3.26Å; I26-D29 PolarHBondContact O-N 3.03Å; M27-D29 VanDerWaalsContact C-N 3.33Å; D29-V31 VanDerWaalsContact C-N 3.34Å; D29-V31 PolarHBondContact O-N 3.25Å; D29-N32 PolarHBondContact O-N 2.89Å; D29-L33 WeakPolarHBondContact O-CB 3.3Å; D29-L33 PolarHBondContact O-N 2.89Å
30	N	97.2	Very high	97.2	Very high	75 Å²	75	95.4 Å²	95.4	40%	0.401	49%	0.487	S	S	.	.	H	α-helix	trans	-64	-37.3	174.8	-73.3	-20.5	0	0	0	112.8	I26 M27 K28 L33 V34	I26-N30 WeakPolarHBondContact O-CB 3.41Å; I26-N30 VanDerWaalsContact O-CG 3.26Å; I26-N30 PolarHBondContact O-N 3.5Å; I26-N30 PolarHBondContact O-ND2 2.87Å; M27-N30 PolarHBondContact O-N 2.64Å; K28-N30 VanDerWaalsContact C-N 3.35Å; K28-N30 PolarHBondContact O-N 3.34Å; N30-L33 PolarHBondContact O-N 3.46Å; N30-V34 PolarHBondContact O-N 2.91Å
31	V	98.2	Very high	97.3	Very high	75 Å²	75	96.3 Å²	96.3	46%	0.455	49%	0.488	S	S	.	.	H	α-helix	trans	-62.9	-45.3	174.1	168.1	0	0	0	0	110.2	M27 K28 D29 L33 V34 L35	M27-V31 VanDerWaalsContact O-CG2 3.29Å; M27-V31 WeakPolarHBondContact O-CG2 3.32Å; M27-V31 PolarHBondContact O-N 3.22Å; K28-V31 PolarHBondContact O-N 3.36Å; D29-V31 VanDerWaalsContact C-N 3.34Å; D29-V31 PolarHBondContact O-N 3.25Å; V31-L33 VanDerWaalsContact C-N 3.29Å; V31-L33 PolarHBondContact O-N 2.89Å; V31-V34 VanDerWaalsContact O-CG1 3.22Å; V31-V34 WeakPolarHBondContact O-CG1 3.49Å; V31-V34 PolarHBondContact O-N 3.31Å; V31-L35 HydrophobicContact CG1-CD1 4.18Å; V31-L35 VanDerWaalsContact O-CG 3.3Å; V31-L35 WeakPolarHBondContact O-CG 3.22Å; V31-L35 PolarHBondContact O-N 3.45Å; V31-L35 VanDerWaalsContact O-N 3.08Å
32	N	97.9	Very high	97.4	Very high	100 Å²	100	92.3 Å²	92.3	54%	0.535	48%	0.479	S	S	.	.	H	α-helix	trans	-60.9	-41.5	174.9	-65.9	-29.1	0	0	0	111.5	K28 D29 L35 E36	K28-N32 PolarHBondContact O-N 3.46Å; K28-N32 PolarHBondContact O-ND2 3.36Å; D29-N32 PolarHBondContact O-N 2.89Å; N32-L35 PolarHBondContact O-N 3.04Å; N32-E36 PolarHBondContact O-N 3.42Å
33	L	97.6	Very high	97.4	Very high	68 Å²	68	91 Å²	91	36%	0.356	47%	0.473	S	S	.	.	H	α-helix	trans	-66.1	-40	178.9	-176.3	62.2	0	0	0	112.6	D29 N30 V31 E36 R37	D29-L33 WeakPolarHBondContact O-CB 3.3Å; D29-L33 PolarHBondContact O-N 2.89Å; N30-L33 PolarHBondContact O-N 3.46Å; V31-L33 VanDerWaalsContact C-N 3.29Å; V31-L33 PolarHBondContact O-N 2.89Å; L33-E36 PolarHBondContact O-N 3.08Å; L33-R37 VanDerWaalsContact O-CG 3.24Å; L33-R37 WeakPolarHBondContact O-CG 3.49Å; L33-R37 PolarHBondContact O-N 2.95Å
34	V	97.3	Very high	97.5	Very high	67 Å²	67	92.4 Å²	92.4	41%	0.406	48%	0.477	S	S	.	.	H	α-helix	trans	-69.6	-36.5	177.6	70.1	0	0	0	0	111.4	N30 V31 R37 E38	N30-V34 PolarHBondContact O-N 2.91Å; V31-V34 VanDerWaalsContact O-CG1 3.22Å; V31-V34 WeakPolarHBondContact O-CG1 3.49Å; V31-V34 PolarHBondContact O-N 3.31Å; V34-R37 WeakPolarHBondContact O-CB 3.47Å; V34-R37 PolarHBondContact O-N 3.1Å; V34-R37 VanDerWaalsContact O-N 3.14Å; V34-E38 WeakPolarHBondContact O-CG 3.4Å; V34-E38 PolarHBondContact O-N 3.45Å
35	L	97.2	Very high	97.5	Very high	88 Å²	88	94 Å²	94	46%	0.461	48%	0.483	S	S	.	.	H	α-helix	trans	-63.3	-41.9	173.6	-68	170.8	0	0	0	111.8	V31 N32 R37 E38 T39	V31-L35 HydrophobicContact CG1-CD1 4.18Å; V31-L35 VanDerWaalsContact O-CG 3.3Å; V31-L35 WeakPolarHBondContact O-CG 3.22Å; V31-L35 PolarHBondContact O-N 3.45Å; V31-L35 VanDerWaalsContact O-N 3.08Å; N32-L35 PolarHBondContact O-N 3.04Å; L35-R37 VanDerWaalsContact C-N 3.3Å; L35-R37 PolarHBondContact O-N 3.22Å; L35-E38 PolarHBondContact O-N 3.26Å; L35-T39 PolarHBondContact O-N 3.45Å
36	E	97.6	Very high	97.5	Very high	87 Å²	87	96.5 Å²	96.5	41%	0.407	49%	0.493	S	S	.	.	H	α-helix	trans	-64.5	-35.6	172.9	-172.4	-177.4	179.9	0	0	112.1	N32 L33 E38 T39 R40	N32-E36 PolarHBondContact O-N 3.42Å; L33-E36 PolarHBondContact O-N 3.08Å; E36-E38 VanDerWaalsContact C-N 3.34Å; E36-T39 PolarHBondContact O-N 2.89Å; E36-T39 PolarHBondContact O-OG1 3.49Å; E36-R40 VanDerWaalsContact O-CG 3.32Å; E36-R40 WeakPolarHBondContact O-CG 3.29Å; E36-R40 PolarHBondContact O-N 3.14Å; E36-R40 VanDerWaalsContact O-N 3.1Å; E36-R40 IonicContact OE1-CZ 2.64Å; E36-R40 VanDerWaalsContact OE1-CZ 3.26Å; E36-R40 IonicContact OE1-NE 2.63Å; E36-R40 PolarHBondContact OE1-NE 3.34Å; E36-R40 IonicContact OE1-NH2 3.22Å; E36-R40 PolarHBondContact OE1-NH2 3.4Å
37	R	97.6	Very high	97.5	Very high	145 Å²	145	99.8 Å²	99.8	55%	0.547	50%	0.5	S	S	.	.	H	α-helix	trans	-65.5	-38.2	174.2	-73.7	169.2	-177.4	-175.6	2	111.8	L33 V34 L35 R40 L41	L33-R37 VanDerWaalsContact O-CG 3.24Å; L33-R37 WeakPolarHBondContact O-CG 3.49Å; L33-R37 PolarHBondContact O-N 2.95Å; V34-R37 WeakPolarHBondContact O-CB 3.47Å; V34-R37 PolarHBondContact O-N 3.1Å; V34-R37 VanDerWaalsContact O-N 3.14Å; L35-R37 VanDerWaalsContact C-N 3.3Å; L35-R37 PolarHBondContact O-N 3.22Å; R37-R40 PolarHBondContact O-N 3.42Å; R37-L41 VanDerWaalsContact O-CB 3.28Å; R37-L41 WeakPolarHBondContact O-CB 3.24Å; R37-L41 VanDerWaalsContact O-CG 3.25Å; R37-L41 WeakPolarHBondContact O-CG 3.25Å; R37-L41 PolarHBondContact O-N 3.31Å
38	E	97.6	Very high	97.6	Very high	113 Å²	113	97.1 Å²	97.1	53%	0.528	49%	0.494	S	S	.	.	H	α-helix	trans	-61.3	-43.9	176.2	-74.6	178.8	173.2	0	0	111.6	V34 L35 E36 L41 A42	V34-E38 WeakPolarHBondContact O-CG 3.4Å; V34-E38 PolarHBondContact O-N 3.45Å; L35-E38 PolarHBondContact O-N 3.26Å; E36-E38 VanDerWaalsContact C-N 3.34Å; E38-L41 PolarHBondContact O-N 2.85Å; E38-A42 PolarHBondContact O-N 2.63Å
39	T	97.1	Very high	97.5	Very high	95 Å²	95	95 Å²	95	58%	0.583	49%	0.489	S	S	*	.	H	α-helix	trans	-66	-42.5	178	64.3	0	0	0	0	112.1	L35 E36 L41 A42 E43	L35-T39 PolarHBondContact O-N 3.45Å; E36-T39 PolarHBondContact O-N 2.89Å; E36-T39 PolarHBondContact O-OG1 3.49Å; T39-L41 VanDerWaalsContact C-N 3.34Å; T39-L41 PolarHBondContact O-N 3.34Å; T39-A42 PolarHBondContact O-N 3.11Å; T39-E43 PolarHBondContact O-N 3.38Å; T39-E43 VanDerWaalsContact O-N 3.11Å
40	R	97.1	Very high	97.5	Very high	139 Å²	139	95.2 Å²	95.2	53%	0.525	49%	0.487	S	S	.	.	H	α-helix	trans	-64.2	-38.2	174.7	-69.3	177.1	-177.7	-155.1	3.2	112	E36 R37 E43 I44	E36-R40 VanDerWaalsContact O-CG 3.32Å; E36-R40 WeakPolarHBondContact O-CG 3.29Å; E36-R40 PolarHBondContact O-N 3.14Å; E36-R40 VanDerWaalsContact O-N 3.1Å; E36-R40 IonicContact OE1-CZ 2.64Å; E36-R40 VanDerWaalsContact OE1-CZ 3.26Å; E36-R40 IonicContact OE1-NE 2.63Å; E36-R40 PolarHBondContact OE1-NE 3.34Å; E36-R40 IonicContact OE1-NH2 3.22Å; E36-R40 PolarHBondContact OE1-NH2 3.4Å; R37-R40 PolarHBondContact O-N 3.42Å; R40-E43 PolarHBondContact O-N 2.82Å; R40-I44 WeakPolarHBondContact O-CB 3.25Å; R40-I44 VanDerWaalsContact O-CG1 3.25Å; R40-I44 WeakPolarHBondContact O-CG1 3.28Å; R40-I44 PolarHBondContact O-N 2.93Å
41	L	97.9	Very high	97.5	Very high	111 Å²	111	97.1 Å²	97.1	58%	0.581	50%	0.496	S	S	*	.	H	α-helix	trans	-66	-42.8	176.5	-81	167.4	0	0	0	111.3	R37 E38 T39 E43 I44 D45	R37-L41 VanDerWaalsContact O-CB 3.28Å; R37-L41 WeakPolarHBondContact O-CB 3.24Å; R37-L41 VanDerWaalsContact O-CG 3.25Å; R37-L41 WeakPolarHBondContact O-CG 3.25Å; R37-L41 PolarHBondContact O-N 3.31Å; E38-L41 PolarHBondContact O-N 2.85Å; T39-L41 VanDerWaalsContact C-N 3.34Å; T39-L41 PolarHBondContact O-N 3.34Å; L41-E43 VanDerWaalsContact C-N 3.29Å; L41-E43 PolarHBondContact O-N 2.92Å; L41-I44 PolarHBondContact O-N 3.41Å; L41-D45 WeakPolarHBondContact O-CB 3.21Å; L41-D45 PolarHBondContact O-N 2.79Å
42	A	97.4	Very high	97.5	Very high	56 Å²	56	98.1 Å²	98.1	46%	0.463	50%	0.496	S	S	.	.	H	α-helix	trans	-61.4	-38.8	176.3	0	0	0	0	0	112.2	E38 T39 T46	E38-A42 PolarHBondContact O-N 2.63Å; T39-A42 PolarHBondContact O-N 3.11Å; A42-T46 PolarHBondContact O-N 2.94Å; A42-T46 VanDerWaalsContact O-N 3.09Å; A42-T46 PolarHBondContact O-OG1 3.39Å
43	E	97.3	Very high	97.4	Very high	97 Å²	97	97 Å²	97	45%	0.453	49%	0.493	S	S	.	.	H	α-helix	trans	-65.4	-44.9	173	-175.8	179.7	-169.9	0	0	111.8	T39 R40 L41 D45 T46 R47	T39-E43 PolarHBondContact O-N 3.38Å; T39-E43 VanDerWaalsContact O-N 3.11Å; R40-E43 PolarHBondContact O-N 2.82Å; L41-E43 VanDerWaalsContact C-N 3.29Å; L41-E43 PolarHBondContact O-N 2.92Å; E43-D45 VanDerWaalsContact C-N 3.33Å; E43-D45 PolarHBondContact O-N 3.44Å; E43-T46 PolarHBondContact O-N 3.48Å; E43-R47 VanDerWaalsContact O-CG 3.3Å; E43-R47 WeakPolarHBondContact O-CG 3.48Å; E43-R47 PolarHBondContact O-N 3Å; E43-R47 IonicContact OE1-CZ 3.25Å; E43-R47 VanDerWaalsContact OE1-CZ 3.25Å; E43-R47 IonicContact OE1-NE 3.34Å; E43-R47 PolarHBondContact OE1-NE 3.44Å; E43-R47 IonicContact OE1-NH2 3.26Å; E43-R47 PolarHBondContact OE1-NH2 2.9Å
44	I	97.4	Very high	97.4	Very high	104 Å²	104	99.3 Å²	99.3	53%	0.533	50%	0.502	S	S	.	.	H	α-helix	trans	-62.8	-40.5	177	-71.6	167	0	0	0	111	R40 L41 R47 A48	R40-I44 WeakPolarHBondContact O-CB 3.25Å; R40-I44 VanDerWaalsContact O-CG1 3.25Å; R40-I44 WeakPolarHBondContact O-CG1 3.28Å; R40-I44 PolarHBondContact O-N 2.93Å; L41-I44 PolarHBondContact O-N 3.41Å; I44-R47 CarbonylContact O-C 3.59Å; I44-R47 PolarHBondContact O-N 3.4Å; I44-A48 WeakPolarHBondContact O-CB 3.3Å; I44-A48 PolarHBondContact O-N 3.09Å
45	D	97.6	Very high	97.4	Very high	103 Å²	103	98.9 Å²	98.9	55%	0.551	50%	0.501	S	S	*	.	H	α-helix	trans	-62.4	-47.1	179.1	-166.8	57	0	0	0	110.8	L41 E43 R47 A48 D49	L41-D45 WeakPolarHBondContact O-CB 3.21Å; L41-D45 PolarHBondContact O-N 2.79Å; E43-D45 VanDerWaalsContact C-N 3.33Å; E43-D45 PolarHBondContact O-N 3.44Å; D45-R47 PolarHBondContact O-N 3.46Å; D45-A48 WeakPolarHBondContact O-CB 3.42Å; D45-A48 PolarHBondContact O-N 2.75Å; D45-A48 VanDerWaalsContact O-N 3.12Å; D45-D49 PolarHBondContact O-N 3.18Å
46	T	97.4	Very high	97.4	Very high	81 Å²	81	100.2 Å²	100.2	50%	0.497	50%	0.504	S	S	.	.	H	α-helix	trans	-58.4	-46.7	174.3	-55.7	0	0	0	0	111.4	A42 E43 A48 D49 E50	A42-T46 PolarHBondContact O-N 2.94Å; A42-T46 VanDerWaalsContact O-N 3.09Å; A42-T46 PolarHBondContact O-OG1 3.39Å; E43-T46 PolarHBondContact O-N 3.48Å; T46-A48 VanDerWaalsContact C-N 3.33Å; T46-A48 PolarHBondContact O-N 3.03Å; T46-D49 PolarHBondContact O-N 3.31Å; T46-E50 WeakPolarHBondContact O-CG 3.33Å; T46-E50 PolarHBondContact O-N 3.12Å
47	R	97.6	Very high	97.3	Very high	150 Å²	150	101.8 Å²	101.8	57%	0.566	51%	0.511	S	S	*	.	H	α-helix	trans	-66.2	-34.2	177.1	-70.3	175.3	-178.9	-153.9	3	112.4	E43 I44 D45 L51	E43-R47 VanDerWaalsContact O-CG 3.3Å; E43-R47 WeakPolarHBondContact O-CG 3.48Å; E43-R47 PolarHBondContact O-N 3Å; E43-R47 IonicContact OE1-CZ 3.25Å; E43-R47 VanDerWaalsContact OE1-CZ 3.25Å; E43-R47 IonicContact OE1-NE 3.34Å; E43-R47 PolarHBondContact OE1-NE 3.44Å; E43-R47 IonicContact OE1-NH2 3.26Å; E43-R47 PolarHBondContact OE1-NH2 2.9Å; I44-R47 CarbonylContact O-C 3.59Å; I44-R47 PolarHBondContact O-N 3.4Å; D45-R47 PolarHBondContact O-N 3.46Å; R47-L51 VanDerWaalsContact O-CB 3.22Å; R47-L51 WeakPolarHBondContact O-CB 3.22Å; R47-L51 PolarHBondContact O-N 3.41Å
48	A	98	Very high	97.3	Very high	46 Å²	46	102.2 Å²	102.2	38%	0.38	52%	0.517	S	S	.	.	H	α-helix	trans	-69.2	-39.2	178.4	0	0	0	0	0	111	I44 D45 T46 L51 Q52	I44-A48 WeakPolarHBondContact O-CB 3.3Å; I44-A48 PolarHBondContact O-N 3.09Å; D45-A48 WeakPolarHBondContact O-CB 3.42Å; D45-A48 PolarHBondContact O-N 2.75Å; D45-A48 VanDerWaalsContact O-N 3.12Å; T46-A48 VanDerWaalsContact C-N 3.33Å; T46-A48 PolarHBondContact O-N 3.03Å; A48-L51 PolarHBondContact O-N 2.78Å; A48-Q52 VanDerWaalsContact O-CB 3.32Å; A48-Q52 WeakPolarHBondContact O-CB 3.31Å; A48-Q52 PolarHBondContact O-N 2.77Å
49	D	97.6	Very high	97.2	Very high	90 Å²	90	103.8 Å²	103.8	48%	0.481	52%	0.524	S	S	.	.	H	α-helix	trans	-63.6	-47.7	172.2	-86.3	-12.4	0	0	0	111.6	D45 T46 L51 Q52 V53	D45-D49 PolarHBondContact O-N 3.18Å; T46-D49 PolarHBondContact O-N 3.31Å; D49-L51 VanDerWaalsContact C-N 3.31Å; D49-L51 PolarHBondContact O-N 3.49Å; D49-Q52 PolarHBondContact O-N 3.48Å; D49-Q52 VanDerWaalsContact O-N 3.16Å; D49-V53 WeakPolarHBondContact O-CG2 3.38Å; D49-V53 PolarHBondContact O-N 2.87Å
50	E	97.3	Very high	97.1	Very high	110 Å²	110	101.8 Å²	101.8	51%	0.514	52%	0.517	S	S	.	.	H	α-helix	trans	-57.4	-45.7	174.4	-73.7	-179.9	-179.7	0	0	111.5	T46 Q52 V53 Q54	T46-E50 WeakPolarHBondContact O-CG 3.33Å; T46-E50 PolarHBondContact O-N 3.12Å; E50-Q52 VanDerWaalsContact C-N 3.35Å; E50-Q52 PolarHBondContact O-N 2.87Å; E50-V53 PolarHBondContact O-N 3.4Å; E50-Q54 WeakPolarHBondContact O-CB 3.19Å; E50-Q54 VanDerWaalsContact O-CG 3.26Å; E50-Q54 WeakPolarHBondContact O-CG 3.34Å; E50-Q54 PolarHBondContact O-N 3.37Å
51	L	97.6	Very high	97	Very high	115 Å²	115	98.2 Å²	98.2	60%	0.602	51%	0.511	S	S	*	.	H	α-helix	trans	-64.7	-38.3	177	-178.1	62.6	0	0	0	111.8	R47 A48 D49 Q54 S55	R47-L51 VanDerWaalsContact O-CB 3.22Å; R47-L51 WeakPolarHBondContact O-CB 3.22Å; R47-L51 PolarHBondContact O-N 3.41Å; A48-L51 PolarHBondContact O-N 2.78Å; D49-L51 VanDerWaalsContact C-N 3.31Å; D49-L51 PolarHBondContact O-N 3.49Å; L51-Q54 PolarHBondContact O-N 3.5Å; L51-S55 WeakPolarHBondContact O-CB 3.39Å; L51-S55 PolarHBondContact O-N 2.79Å; L51-S55 PolarHBondContact O-OG 3.29Å
52	Q	97.7	Very high	96.9	Very high	96 Å²	96	94.9 Å²	94.9	45%	0.449	50%	0.499	S	S	.	.	H	α-helix	trans	-65.5	-43.3	177.1	-167.4	-168.5	91	0	0	110.9	A48 D49 E50 S55 K56	A48-Q52 VanDerWaalsContact O-CB 3.32Å; A48-Q52 WeakPolarHBondContact O-CB 3.31Å; A48-Q52 PolarHBondContact O-N 2.77Å; D49-Q52 PolarHBondContact O-N 3.48Å; D49-Q52 VanDerWaalsContact O-N 3.16Å; E50-Q52 VanDerWaalsContact C-N 3.35Å; E50-Q52 PolarHBondContact O-N 2.87Å; Q52-S55 WeakPolarHBondContact CA-OG 3.26Å; Q52-S55 PolarHBondContact O-OG 2.9Å; Q52-K56 HydrophobicContact CG-CD 4.5Å; Q52-K56 WeakPolarHBondContact O-CG 3.44Å; Q52-K56 PolarHBondContact O-N 2.83Å
53	V	96.5	Very high	96.8	Very high	77 Å²	77	94.2 Å²	94.2	47%	0.467	50%	0.498	S	S	.	.	H	α-helix	trans	-64.1	-47.5	176.5	172.2	0	0	0	0	110.3	D49 E50 S55 K56 Q57	D49-V53 WeakPolarHBondContact O-CG2 3.38Å; D49-V53 PolarHBondContact O-N 2.87Å; E50-V53 PolarHBondContact O-N 3.4Å; V53-S55 PolarHBondContact O-N 3.36Å; V53-K56 PolarHBondContact O-N 3.27Å; V53-Q57 WeakPolarHBondContact O-CG 3.36Å; V53-Q57 PolarHBondContact O-N 3.46Å
54	Q	96.9	Very high	96.7	Very high	116 Å²	116	96.9 Å²	96.9	54%	0.542	50%	0.504	S	S	.	.	H	α-helix	trans	-63.6	-41.3	178.3	-73.1	178.7	51	0	0	112.3	E50 L51 Q57 F58	E50-Q54 WeakPolarHBondContact O-CB 3.19Å; E50-Q54 VanDerWaalsContact O-CG 3.26Å; E50-Q54 WeakPolarHBondContact O-CG 3.34Å; E50-Q54 PolarHBondContact O-N 3.37Å; L51-Q54 PolarHBondContact O-N 3.5Å; Q54-Q57 PolarHBondContact O-N 2.9Å; Q54-F58 VanDerWaalsContact O-CB 3.31Å; Q54-F58 WeakPolarHBondContact O-CB 3.32Å; Q54-F58 PolarHBondContact O-N 3.16Å
55	S	97.6	Very high	96.6	Very high	57 Å²	57	95 Å²	95	40%	0.399	50%	0.497	S	S	.	.	H	α-helix	trans	-65.3	-40	177.9	59.7	0	0	0	0	112.2	L51 Q52 V53 F58 Q59	L51-S55 WeakPolarHBondContact O-CB 3.39Å; L51-S55 PolarHBondContact O-N 2.79Å; L51-S55 PolarHBondContact O-OG 3.29Å; Q52-S55 WeakPolarHBondContact CA-OG 3.26Å; Q52-S55 PolarHBondContact O-OG 2.9Å; V53-S55 PolarHBondContact O-N 3.36Å; S55-F58 PolarHBondContact O-N 2.89Å; S55-Q59 WeakPolarHBondContact O-CB 3.43Å; S55-Q59 PolarHBondContact O-N 2.84Å
56	K	96.4	Very high	96.5	Very high	117 Å²	117	100 Å²	100	51%	0.509	51%	0.508	S	S	.	.	H	α-helix	trans	-62.5	-43.7	172.6	-74.4	174	179.5	165.7	0	111.7	Q52 V53 Q59 A60	Q52-K56 HydrophobicContact CG-CD 4.5Å; Q52-K56 WeakPolarHBondContact O-CG 3.44Å; Q52-K56 PolarHBondContact O-N 2.83Å; V53-K56 PolarHBondContact O-N 3.27Å; K56-Q59 PolarHBondContact O-N 3.5Å; K56-A60 WeakPolarHBondContact O-CB 3.26Å; K56-A60 PolarHBondContact O-N 3.01Å
57	Q	96.4	Very high	96.4	Very high	120 Å²	120	103.7 Å²	103.7	56%	0.561	51%	0.513	S	S	*	.	H	α-helix	trans	-63.2	-45.4	175.4	-70.5	-180	22.6	0	0	111.5	V53 Q54 Q59 A60 V61	V53-Q57 WeakPolarHBondContact O-CG 3.36Å; V53-Q57 PolarHBondContact O-N 3.46Å; Q54-Q57 PolarHBondContact O-N 2.9Å; Q57-Q59 PolarHBondContact O-N 3Å; Q57-A60 PolarHBondContact O-N 3.38Å; Q57-V61 WeakPolarHBondContact O-CB 3.34Å; Q57-V61 VanDerWaalsContact O-CG2 3.26Å; Q57-V61 WeakPolarHBondContact O-CG2 3.23Å; Q57-V61 PolarHBondContact O-N 3.04Å
58	F	96.1	Very high	96.3	Very high	154 Å²	154	103.7 Å²	103.7	68%	0.675	52%	0.517	S	S	*	.	H	α-helix	trans	-59.7	-46.4	176.5	179.5	-97.7	0	0	0	111.3	Q54 S55 A60 V61 A62	Q54-F58 VanDerWaalsContact O-CB 3.31Å; Q54-F58 WeakPolarHBondContact O-CB 3.32Å; Q54-F58 PolarHBondContact O-N 3.16Å; S55-F58 PolarHBondContact O-N 2.89Å; F58-A60 PolarHBondContact O-N 2.76Å; F58-V61 PolarHBondContact O-N 3.27Å; F58-A62 VanDerWaalsContact O-CB 3.23Å; F58-A62 WeakPolarHBondContact O-CB 3.35Å; F58-A62 PolarHBondContact O-N 3.43Å
59	Q	96.1	Very high	96.2	Very high	145 Å²	145	107.8 Å²	107.8	68%	0.678	52%	0.524	S	S	*	.	H	α-helix	trans	-58.8	-45.9	176	-174.3	-176.7	9	0	0	111.5	S55 K56 Q57 A62 G63	S55-Q59 WeakPolarHBondContact O-CB 3.43Å; S55-Q59 PolarHBondContact O-N 2.84Å; K56-Q59 PolarHBondContact O-N 3.5Å; Q57-Q59 PolarHBondContact O-N 3Å; Q59-A62 PolarHBondContact O-N 3.39Å; Q59-G63 PolarHBondContact O-N 3.09Å
60	A	95.6	Very high	96.1	Very high	53 Å²	53	109.6 Å²	109.6	44%	0.438	53%	0.528	S	S	.	.	H	α-helix	trans	-65.4	-39.8	177.9	0	0	0	0	0	112.4	K56 Q57 F58 R64	K56-A60 WeakPolarHBondContact O-CB 3.26Å; K56-A60 PolarHBondContact O-N 3.01Å; Q57-A60 PolarHBondContact O-N 3.38Å; F58-A60 PolarHBondContact O-N 2.76Å; A60-R64 VanDerWaalsContact O-CG 3.32Å; A60-R64 WeakPolarHBondContact O-CG 3.42Å; A60-R64 PolarHBondContact O-N 3.11Å; A60-R64 VanDerWaalsContact O-N 3.11Å; A60-R64 PolarHBondContact O-NE 3.5Å
61	V	95.3	Very high	96	Very high	64 Å²	64	112.7 Å²	112.7	39%	0.388	54%	0.535	S	S	.	.	H	α-helix	trans	-67.2	-49.2	175.6	171.7	0	0	0	0	110.5	Q57 F58 G63 R64 V65	Q57-V61 WeakPolarHBondContact O-CB 3.34Å; Q57-V61 VanDerWaalsContact O-CG2 3.26Å; Q57-V61 WeakPolarHBondContact O-CG2 3.23Å; Q57-V61 PolarHBondContact O-N 3.04Å; F58-V61 PolarHBondContact O-N 3.27Å; V61-G63 VanDerWaalsContact C-N 3.31Å; V61-G63 PolarHBondContact O-N 3.4Å; V61-R64 CarbonylContact O-C 3.6Å; V61-R64 PolarHBondContact O-N 2.79Å; V61-R64 VanDerWaalsContact O-N 3.09Å; V61-V65 HydrophobicContact CG1-CG2 4.01Å; V61-V65 WeakPolarHBondContact O-CB 3.29Å; V61-V65 VanDerWaalsContact O-CG2 3.25Å; V61-V65 WeakPolarHBondContact O-CG2 3.38Å; V61-V65 PolarHBondContact O-N 2.88Å
62	A	95.9	Very high	95.9	Very high	41 Å²	41	111.7 Å²	111.7	34%	0.339	53%	0.527	S	S	.	.	H	α-helix	trans	-57.9	-42.5	178.6	0	0	0	0	0	111.7	F58 Q59 V65 R66	F58-A62 VanDerWaalsContact O-CB 3.23Å; F58-A62 WeakPolarHBondContact O-CB 3.35Å; F58-A62 PolarHBondContact O-N 3.43Å; Q59-A62 PolarHBondContact O-N 3.39Å; A62-V65 PolarHBondContact O-N 3.35Å; A62-R66 WeakPolarHBondContact O-CB 3.32Å; A62-R66 PolarHBondContact O-N 3.17Å
63	G	95.2	Very high	95.8	Very high	43 Å²	43	112.2 Å²	112.2	44%	0.443	53%	0.533	S	S	.	.	H	α-helix	trans	-61.2	-45.3	173.8	0	0	0	0	0	112.8	Q59 V61 R67	Q59-G63 PolarHBondContact O-N 3.09Å; V61-G63 VanDerWaalsContact C-N 3.31Å; V61-G63 PolarHBondContact O-N 3.4Å; G63-R67 WeakPolarHBondContact O-CB 3.25Å; G63-R67 PolarHBondContact O-N 3.35Å
64	R	94.9	Very high	95.7	Very high	152 Å²	152	111.8 Å²	111.8	57%	0.574	53%	0.527	S	S	*	.	H	α-helix	trans	-64.5	-42	176	-75.2	-175.2	-67.7	170.2	-2.4	112.3	A60 V61 R67 K68	A60-R64 VanDerWaalsContact O-CG 3.32Å; A60-R64 WeakPolarHBondContact O-CG 3.42Å; A60-R64 PolarHBondContact O-N 3.11Å; A60-R64 VanDerWaalsContact O-N 3.11Å; A60-R64 PolarHBondContact O-NE 3.5Å; V61-R64 CarbonylContact O-C 3.6Å; V61-R64 PolarHBondContact O-N 2.79Å; V61-R64 VanDerWaalsContact O-N 3.09Å; R64-R67 PolarHBondContact O-N 2.96Å; R64-K68 VanDerWaalsContact O-CB 3.32Å; R64-K68 WeakPolarHBondContact O-CB 3.32Å; R64-K68 PolarHBondContact O-N 3.02Å
65	V	96	Very high	95.7	Very high	65 Å²	65	113.4 Å²	113.4	39%	0.394	53%	0.532	S	S	.	.	H	α-helix	trans	-62.1	-51.2	177.7	169.2	0	0	0	0	110.1	V61 A62 R67 K68 Y69	V61-V65 HydrophobicContact CG1-CG2 4.01Å; V61-V65 WeakPolarHBondContact O-CB 3.29Å; V61-V65 VanDerWaalsContact O-CG2 3.25Å; V61-V65 WeakPolarHBondContact O-CG2 3.38Å; V61-V65 PolarHBondContact O-N 2.88Å; A62-V65 PolarHBondContact O-N 3.35Å; V65-R67 VanDerWaalsContact C-N 3.31Å; V65-R67 PolarHBondContact O-N 2.95Å; V65-K68 PolarHBondContact O-N 3.48Å; V65-Y69 HydrophobicContact CG1-CD2 3.65Å; V65-Y69 HydrophobicContact CG1-CE2 3.68Å; V65-Y69 VanDerWaalsContact O-CD2 3.29Å; V65-Y69 WeakPolarHBondContact O-CD2 3.33Å; V65-Y69 PolarHBondContact O-N 2.83Å
66	R	94.9	Very high	95.6	Very high	207 Å²	207	115.7 Å²	115.7	78%	0.781	54%	0.538	S	S	*	.	H	α-helix	trans	-55.7	-46.9	176.4	-177.4	177.8	-179.6	176.3	1	111.4	A62 Y69 F70	A62-R66 WeakPolarHBondContact O-CB 3.32Å; A62-R66 PolarHBondContact O-N 3.17Å; R66-Y69 PolarHBondContact O-N 3.34Å; R66-F70 WeakPolarHBondContact O-CB 3.36Å; R66-F70 PolarHBondContact O-N 2.93Å
67	R	95.6	Very high	95.5	Very high	160 Å²	160	119.1 Å²	119.1	60%	0.604	55%	0.547	S	S	*	.	H	α-helix	trans	-62.4	-46.9	177.7	-172.3	168.5	72.1	-159.2	4.2	111.3	G63 R64 V65 Y69 F70 W71	G63-R67 WeakPolarHBondContact O-CB 3.25Å; G63-R67 PolarHBondContact O-N 3.35Å; R64-R67 PolarHBondContact O-N 2.96Å; V65-R67 VanDerWaalsContact C-N 3.31Å; V65-R67 PolarHBondContact O-N 2.95Å; R67-Y69 PolarHBondContact O-N 2.94Å; R67-F70 PolarHBondContact O-N 3.46Å; R67-W71 PolarHBondContact O-N 3.41Å
68	K	95.6	Very high	95.5	Very high	149 Å²	149	119.8 Å²	119.8	65%	0.648	55%	0.549	S	S	*	.	H	α-helix	trans	-56.2	-49.5	178.5	-177.2	179.3	178	-178.1	0	111.5	R64 V65 W71 Q72	R64-K68 VanDerWaalsContact O-CB 3.32Å; R64-K68 WeakPolarHBondContact O-CB 3.32Å; R64-K68 PolarHBondContact O-N 3.02Å; V65-K68 PolarHBondContact O-N 3.48Å; K68-W71 PolarHBondContact O-N 2.86Å; K68-Q72 WeakPolarHBondContact O-CB 3.34Å; K68-Q72 PolarHBondContact O-N 3.46Å
69	Y	95	Very high	95.5	Very high	133 Å²	133	116.3 Å²	116.3	52%	0.522	54%	0.54	S	S	.	.	H	α-helix	trans	-67.8	-36.9	178.7	-80.3	-71.4	0	0	0	112.9	V65 R66 R67 Q72 N73	V65-Y69 HydrophobicContact CG1-CD2 3.65Å; V65-Y69 HydrophobicContact CG1-CE2 3.68Å; V65-Y69 VanDerWaalsContact O-CD2 3.29Å; V65-Y69 WeakPolarHBondContact O-CD2 3.33Å; V65-Y69 PolarHBondContact O-N 2.83Å; R66-Y69 PolarHBondContact O-N 3.34Å; R67-Y69 PolarHBondContact O-N 2.94Å; Y69-Q72 PolarHBondContact O-N 3.01Å; Y69-N73 WeakPolarHBondContact O-CB 3.42Å; Y69-N73 PolarHBondContact O-N 3.3Å; Y69-N73 PolarHBondContact O-OD1 3.25Å
70	F	95.7	Very high	95.5	Very high	128 Å²	128	115.1 Å²	115.1	56%	0.561	54%	0.536	S	S	*	.	H	α-helix	trans	-60.1	-48.2	175.1	-176.5	-100.5	0	0	0	111.7	R66 R67 N73 M74	R66-F70 WeakPolarHBondContact O-CB 3.36Å; R66-F70 PolarHBondContact O-N 2.93Å; R67-F70 PolarHBondContact O-N 3.46Å; F70-N73 PolarHBondContact O-N 3.44Å; F70-M74 HydrophobicContact CE1-CE 3.95Å; F70-M74 HydrophobicContact CE2-CE 4.17Å; F70-M74 HydrophobicContact CZ-CE 3.55Å; F70-M74 VanDerWaalsContact O-CB 3.26Å; F70-M74 WeakPolarHBondContact O-CB 3.32Å; F70-M74 PolarHBondContact O-N 3.44Å
71	W	95.5	Very high	95.5	Very high	174 Å²	174	114.3 Å²	114.3	66%	0.659	53%	0.533	S	S	*	.	H	α-helix	trans	-65.8	-38.7	176.4	-78.5	101.6	0	0	0	112.8	R67 K68 M74 K75	R67-W71 PolarHBondContact O-N 3.41Å; K68-W71 PolarHBondContact O-N 2.86Å; W71-M74 PolarHBondContact O-N 3.49Å; W71-K75 WeakPolarHBondContact O-CB 3.33Å; W71-K75 PolarHBondContact O-N 3.42Å
72	Q	95.4	Very high	95.6	Very high	95 Å²	95	113.1 Å²	113.1	44%	0.444	53%	0.533	S	S	.	.	H	α-helix	trans	-63.2	-48.2	176.6	-175.2	174.1	6.6	0	0	111.3	K68 Y69 M74 K75 M76	K68-Q72 WeakPolarHBondContact O-CB 3.34Å; K68-Q72 PolarHBondContact O-N 3.46Å; Y69-Q72 PolarHBondContact O-N 3.01Å; Q72-M74 VanDerWaalsContact C-N 3.34Å; Q72-M74 PolarHBondContact O-N 3.06Å; Q72-K75 PolarHBondContact O-N 3.28Å; Q72-M76 WeakPolarHBondContact O-CG 3.41Å; Q72-M76 PolarHBondContact O-N 3.48Å
73	N	95.1	Very high	95.6	Very high	106 Å²	106	115.9 Å²	115.9	57%	0.567	54%	0.542	S	S	*	.	H	α-helix	trans	-63.6	-42	178.1	-68.8	-5.9	0	0	0	111.2	Y69 F70 M76 W77	Y69-N73 WeakPolarHBondContact O-CB 3.42Å; Y69-N73 PolarHBondContact O-N 3.3Å; Y69-N73 PolarHBondContact O-OD1 3.25Å; F70-N73 PolarHBondContact O-N 3.44Å; N73-M76 PolarHBondContact O-N 2.93Å; N73-W77 PolarHBondContact O-N 3.3Å
74	M	95.1	Very high	95.7	Very high	69 Å²	69	116.3 Å²	116.3	34%	0.34	54%	0.541	S	S	.	.	H	α-helix	trans	-61.1	-46.5	176.2	-169	67.1	69.7	0	0	111.6	F70 W71 Q72 M76 W77 F78	F70-M74 HydrophobicContact CE1-CE 3.95Å; F70-M74 HydrophobicContact CE2-CE 4.17Å; F70-M74 HydrophobicContact CZ-CE 3.55Å; F70-M74 VanDerWaalsContact O-CB 3.26Å; F70-M74 WeakPolarHBondContact O-CB 3.32Å; F70-M74 PolarHBondContact O-N 3.44Å; W71-M74 PolarHBondContact O-N 3.49Å; Q72-M74 VanDerWaalsContact C-N 3.34Å; Q72-M74 PolarHBondContact O-N 3.06Å; M74-M76 VanDerWaalsContact C-N 3.33Å; M74-M76 PolarHBondContact O-N 2.98Å; M74-W77 WeakPolarHBondContact O-CB 3.48Å; M74-W77 PolarHBondContact O-N 3.22Å; M74-F78 HydrophobicContact CG-CD2 4.18Å; M74-F78 HydrophobicContact CG-CE2 3.68Å; M74-F78 WeakPolarHBondContact O-CD2 3.39Å; M74-F78 PolarHBondContact O-N 2.97Å; M74-F78 VanDerWaalsContact O-N 3.17Å; M74-F78 HydrophobicContact SD-CE2 4.09Å
75	K	95.9	Very high	95.8	Very high	149 Å²	149	113.5 Å²	113.5	65%	0.648	54%	0.541	S	S	*	.	H	α-helix	trans	-59.2	-43.8	175.7	-179.7	179.5	173.9	-179.8	0	111.5	W71 Q72 W77 F78 V79	W71-K75 WeakPolarHBondContact O-CB 3.33Å; W71-K75 PolarHBondContact O-N 3.42Å; Q72-K75 PolarHBondContact O-N 3.28Å; K75-W77 VanDerWaalsContact C-N 3.3Å; K75-W77 PolarHBondContact O-N 3.34Å; K75-F78 PolarHBondContact O-N 2.89Å; K75-V79 WeakPolarHBondContact O-CG2 3.26Å; K75-V79 PolarHBondContact O-N 3.49Å
76	M	95.5	Very high	95.9	Very high	105 Å²	105	114.6 Å²	114.6	52%	0.517	55%	0.548	S	S	.	.	H	α-helix	trans	-62.8	-37.6	178.1	-72.1	-57.3	-62.1	0	0	112.2	Q72 N73 M74 V79 M80	Q72-M76 WeakPolarHBondContact O-CG 3.41Å; Q72-M76 PolarHBondContact O-N 3.48Å; N73-M76 PolarHBondContact O-N 2.93Å; M74-M76 VanDerWaalsContact C-N 3.33Å; M74-M76 PolarHBondContact O-N 2.98Å; M76-V79 PolarHBondContact O-N 3.41Å; M76-M80 WeakPolarHBondContact O-CG 3.17Å; M76-M80 PolarHBondContact O-N 3.17Å
77	W	95.7	Very high	96	Very high	189 Å²	189	109.2 Å²	109.2	72%	0.716	53%	0.533	S	S	*	.	H	α-helix	trans	-63.6	-41.6	176.7	-163	72.7	0	0	0	112.1	N73 M74 K75 M80 G81	N73-W77 PolarHBondContact O-N 3.3Å; M74-W77 WeakPolarHBondContact O-CB 3.48Å; M74-W77 PolarHBondContact O-N 3.22Å; K75-W77 VanDerWaalsContact C-N 3.3Å; K75-W77 PolarHBondContact O-N 3.34Å; W77-M80 PolarHBondContact O-N 3.03Å; W77-G81 PolarHBondContact O-N 3.48Å
78	F	96.3	Very high	96.1	Very high	134 Å²	134	105.4 Å²	105.4	59%	0.588	53%	0.528	S	S	*	.	H	α-helix	trans	-64.6	-40	173.7	-73.7	-62.1	0	0	0	113.3	M74 K75 G81 G82	M74-F78 HydrophobicContact CG-CD2 4.18Å; M74-F78 HydrophobicContact CG-CE2 3.68Å; M74-F78 WeakPolarHBondContact O-CD2 3.39Å; M74-F78 PolarHBondContact O-N 2.97Å; M74-F78 VanDerWaalsContact O-N 3.17Å; M74-F78 HydrophobicContact SD-CE2 4.09Å; K75-F78 PolarHBondContact O-N 2.89Å; F78-G81 PolarHBondContact O-N 3.42Å; F78-G82 PolarHBondContact O-N 2.86Å
79	V	95.9	Very high	96.2	Very high	82 Å²	82	102 Å²	102	50%	0.497	52%	0.519	S	S	.	.	H	α-helix	trans	-62.7	-45.2	176.4	172.2	0	0	0	0	110.7	K75 M76 G82 L83	K75-V79 WeakPolarHBondContact O-CG2 3.26Å; K75-V79 PolarHBondContact O-N 3.49Å; M76-V79 PolarHBondContact O-N 3.41Å; V79-G82 PolarHBondContact O-N 3Å; V79-L83 PolarHBondContact O-N 3.31Å
80	M	96	Very high	96.2	Very high	119 Å²	119	100 Å²	100	59%	0.586	52%	0.521	S	S	*	.	H	α-helix	trans	-63	-42.7	176	-72.8	-60.2	-66.5	0	0	112.2	M76 W77 L83 A84	M76-M80 WeakPolarHBondContact O-CG 3.17Å; M76-M80 PolarHBondContact O-N 3.17Å; W77-M80 PolarHBondContact O-N 3.03Å; M80-L83 PolarHBondContact O-N 3.47Å; M80-A84 PolarHBondContact O-N 3.3Å
81	G	96.3	Very high	96.3	Very high	36 Å²	36	98.7 Å²	98.7	37%	0.371	52%	0.518	S	S	.	.	H	α-helix	trans	-62.1	-44.1	175.4	0	0	0	0	0	112.6	W77 F78 L83 A84 V85	W77-G81 PolarHBondContact O-N 3.48Å; F78-G81 PolarHBondContact O-N 3.42Å; G81-L83 PolarHBondContact O-N 3.27Å; G81-A84 PolarHBondContact O-N 3.48Å; G81-V85 WeakPolarHBondContact O-CG2 3.41Å; G81-V85 PolarHBondContact O-N 3.38Å
82	G	96.5	Very high	96.3	Very high	39 Å²	39	95 Å²	95	40%	0.402	51%	0.511	S	S	.	.	H	α-helix	trans	-60.9	-43.9	176.4	0	0	0	0	0	112.7	F78 V79 A84 V85 V86	F78-G82 PolarHBondContact O-N 2.86Å; V79-G82 PolarHBondContact O-N 3Å; G82-A84 PolarHBondContact O-N 3.37Å; G82-V85 PolarHBondContact O-N 2.9Å; G82-V86 WeakPolarHBondContact O-CG2 3.41Å; G82-V86 PolarHBondContact O-N 3.12Å; G82-V86 VanDerWaalsContact O-N 3.09Å
83	L	96.6	Very high	96.3	Very high	100 Å²	100	95 Å²	95	52%	0.524	52%	0.517	S	S	.	.	H	α-helix	trans	-61.4	-43.2	175.4	-177.4	63.7	0	0	0	111.9	V79 M80 G81 V85 V86 I87	V79-L83 PolarHBondContact O-N 3.31Å; M80-L83 PolarHBondContact O-N 3.47Å; G81-L83 PolarHBondContact O-N 3.27Å; L83-V85 VanDerWaalsContact C-N 3.34Å; L83-V85 PolarHBondContact O-N 3.04Å; L83-V86 PolarHBondContact O-N 3Å; L83-I87 HydrophobicContact CG-CD1 4.26Å; L83-I87 WeakPolarHBondContact O-CG1 3.38Å; L83-I87 PolarHBondContact O-N 3.09Å; L83-I87 VanDerWaalsContact O-N 3.12Å
84	A	97.1	Very high	96.3	Very high	52 Å²	52	98.6 Å²	98.6	43%	0.43	52%	0.523	S	S	.	.	H	α-helix	trans	-61.5	-41.6	176.9	0	0	0	0	0	112.1	M80 G81 G82 I87 V88	M80-A84 PolarHBondContact O-N 3.3Å; G81-A84 PolarHBondContact O-N 3.48Å; G82-A84 PolarHBondContact O-N 3.37Å; A84-I87 PolarHBondContact O-N 3.46Å; A84-V88 WeakPolarHBondContact O-CG2 3.37Å; A84-V88 PolarHBondContact O-N 3.02Å
85	V	97.4	Very high	96.3	Very high	93 Å²	93	98.7 Å²	98.7	56%	0.564	53%	0.53	S	S	*	.	H	α-helix	trans	-62	-43.5	176.5	171.5	0	0	0	0	111.5	G81 G82 L83 I87 V88 V89	G81-V85 WeakPolarHBondContact O-CG2 3.41Å; G81-V85 PolarHBondContact O-N 3.38Å; G82-V85 PolarHBondContact O-N 2.9Å; L83-V85 VanDerWaalsContact C-N 3.34Å; L83-V85 PolarHBondContact O-N 3.04Å; V85-I87 VanDerWaalsContact C-N 3.34Å; V85-I87 PolarHBondContact O-N 3.34Å; V85-V88 PolarHBondContact O-N 3.32Å; V85-V89 HydrophobicContact CG1-CG2 4.46Å; V85-V89 WeakPolarHBondContact O-CG2 3.44Å; V85-V89 PolarHBondContact O-N 3.28Å
86	V	97.1	Very high	96.2	Very high	88 Å²	88	96.2 Å²	96.2	53%	0.533	53%	0.527	S	S	.	.	H	α-helix	trans	-60.2	-44.9	177.4	172.2	0	0	0	0	111.2	G82 L83 V88 V89 V90	G82-V86 WeakPolarHBondContact O-CG2 3.41Å; G82-V86 PolarHBondContact O-N 3.12Å; G82-V86 VanDerWaalsContact O-N 3.09Å; L83-V86 PolarHBondContact O-N 3Å; V86-V88 VanDerWaalsContact C-N 3.34Å; V86-V88 PolarHBondContact O-N 3.02Å; V86-V89 PolarHBondContact O-N 2.95Å; V86-V90 WeakPolarHBondContact O-CG2 3.33Å; V86-V90 PolarHBondContact O-N 3.45Å
87	I	97.2	Very high	96.1	Very high	93 Å²	93	95.1 Å²	95.1	48%	0.477	53%	0.53	S	S	.	.	H	α-helix	trans	-60.7	-44.5	177.3	-67.4	168.2	0	0	0	110.7	L83 A84 V85 V89 V90 I91	L83-I87 HydrophobicContact CG-CD1 4.26Å; L83-I87 WeakPolarHBondContact O-CG1 3.38Å; L83-I87 PolarHBondContact O-N 3.09Å; L83-I87 VanDerWaalsContact O-N 3.12Å; A84-I87 PolarHBondContact O-N 3.46Å; V85-I87 VanDerWaalsContact C-N 3.34Å; V85-I87 PolarHBondContact O-N 3.34Å; I87-V89 PolarHBondContact O-N 3.46Å; I87-V90 PolarHBondContact O-N 3.34Å; I87-I91 HydrophobicContact CG2-CD1 3.83Å; I87-I91 VanDerWaalsContact O-CG1 3.32Å; I87-I91 WeakPolarHBondContact O-CG1 3.32Å; I87-I91 PolarHBondContact O-N 3.49Å
88	V	97.2	Very high	95.9	Very high	80 Å²	80	90.9 Å²	90.9	49%	0.485	52%	0.521	S	S	.	.	H	α-helix	trans	-60.8	-43.4	177.3	169.9	0	0	0	0	111.4	A84 V85 V86 I91 I92	A84-V88 WeakPolarHBondContact O-CG2 3.37Å; A84-V88 PolarHBondContact O-N 3.02Å; V85-V88 PolarHBondContact O-N 3.32Å; V86-V88 VanDerWaalsContact C-N 3.34Å; V86-V88 PolarHBondContact O-N 3.02Å; V88-I91 PolarHBondContact O-N 2.93Å; V88-I92 HydrophobicContact CG1-CD1 3.72Å; V88-I92 HydrophobicContact CG1-CG1 4.42Å; V88-I92 VanDerWaalsContact O-CG1 3.26Å; V88-I92 WeakPolarHBondContact O-CG1 3.33Å; V88-I92 PolarHBondContact O-N 3.46Å
89	V	97	Very high	95.4	Very high	79 Å²	79	93.4 Å²	93.4	48%	0.479	53%	0.532	S	S	.	.	H	α-helix	trans	-62.4	-44.3	177.6	171.2	0	0	0	0	111.4	V85 V86 I87 I91 I92 V93	V85-V89 HydrophobicContact CG1-CG2 4.46Å; V85-V89 WeakPolarHBondContact O-CG2 3.44Å; V85-V89 PolarHBondContact O-N 3.28Å; V86-V89 PolarHBondContact O-N 2.95Å; I87-V89 PolarHBondContact O-N 3.46Å; V89-I91 VanDerWaalsContact C-N 3.34Å; V89-I91 PolarHBondContact O-N 3.27Å; V89-I92 PolarHBondContact O-N 3.25Å; V89-V93 HydrophobicContact CG1-CG2 4.34Å; V89-V93 WeakPolarHBondContact O-CG2 3.48Å; V89-V93 PolarHBondContact O-N 3.01Å
90	V	96.6	Very high	94.4	Very high	91 Å²	91	98 Å²	98	55%	0.552	55%	0.548	S	S	*	.	H	α-helix	trans	-61.2	-43.5	177.4	173.1	0	0	0	0	111.2	V86 I87 I92 V93 W94	V86-V90 WeakPolarHBondContact O-CG2 3.33Å; V86-V90 PolarHBondContact O-N 3.45Å; I87-V90 PolarHBondContact O-N 3.34Å; V90-I92 PolarHBondContact O-N 2.97Å; V90-V93 PolarHBondContact O-N 2.9Å; V90-W94 VanDerWaalsContact O-CB 3.32Å; V90-W94 WeakPolarHBondContact O-CB 3.26Å; V90-W94 PolarHBondContact O-N 3.39Å
91	I	96.2	Very high	92.5	Very high	99 Å²	99	99.7 Å²	99.7	51%	0.508	57%	0.571	S	S	.	*	H	α-helix	trans	-62.1	-43.7	177.3	-68.5	167.7	0	0	0	111	I87 V88 V89 S95	I87-I91 HydrophobicContact CG2-CD1 3.83Å; I87-I91 VanDerWaalsContact O-CG1 3.32Å; I87-I91 WeakPolarHBondContact O-CG1 3.32Å; I87-I91 PolarHBondContact O-N 3.49Å; V88-I91 PolarHBondContact O-N 2.93Å; V89-I91 VanDerWaalsContact C-N 3.34Å; V89-I91 PolarHBondContact O-N 3.27Å; I91-S95 VanDerWaalsContact O-CB 3.25Å; I91-S95 WeakPolarHBondContact O-CB 3.32Å; I91-S95 PolarHBondContact O-N 3.4Å
92	I	95.9	Very high	92.3	Very high	97 Å²	97	102.9 Å²	102.9	50%	0.497	58%	0.581	S	S	.	*	H	α-helix	trans	-62.4	-48.3	177.9	-68.8	166.4	0	0	0	110.5	V88 V89 V90 W94 S95 V96	V88-I92 HydrophobicContact CG1-CD1 3.72Å; V88-I92 HydrophobicContact CG1-CG1 4.42Å; V88-I92 VanDerWaalsContact O-CG1 3.26Å; V88-I92 WeakPolarHBondContact O-CG1 3.33Å; V88-I92 PolarHBondContact O-N 3.46Å; V89-I92 PolarHBondContact O-N 3.25Å; V90-I92 PolarHBondContact O-N 2.97Å; I92-W94 PolarHBondContact O-N 3.5Å; I92-S95 PolarHBondContact O-N 2.95Å; I92-V96 HydrophobicContact CG2-CG2 4.47Å; I92-V96 WeakPolarHBondContact O-CB 3.44Å; I92-V96 VanDerWaalsContact O-CG2 3.28Å; I92-V96 WeakPolarHBondContact O-CG2 3.38Å; I92-V96 PolarHBondContact O-N 2.89Å
93	V	95.8	Very high	92.1	Very high	95 Å²	95	106.3 Å²	106.3	58%	0.576	59%	0.591	S	S	*	*	H	α-helix	trans	-62.3	-45.2	179.9	172.2	0	0	0	0	111.2	V89 V90 V96 S97	V89-V93 HydrophobicContact CG1-CG2 4.34Å; V89-V93 WeakPolarHBondContact O-CG2 3.48Å; V89-V93 PolarHBondContact O-N 3.01Å; V90-V93 PolarHBondContact O-N 2.9Å; V93-V96 PolarHBondContact O-N 3.5Å; V93-S97 WeakPolarHBondContact O-CB 3.28Å; V93-S97 PolarHBondContact O-N 2.94Å
94	W	95.5	Very high	91.9	Very high	182 Å²	182	106.6 Å²	106.6	69%	0.689	59%	0.594	S	S	*	*	H	α-helix	trans	-63.3	-44.5	177.7	-177.1	74	0	0	0	112	V90 I92 V96 S97 N98	V90-W94 VanDerWaalsContact O-CB 3.32Å; V90-W94 WeakPolarHBondContact O-CB 3.26Å; V90-W94 PolarHBondContact O-N 3.39Å; I92-W94 PolarHBondContact O-N 3.5Å; W94-V96 VanDerWaalsContact C-N 3.35Å; W94-V96 PolarHBondContact O-N 3.34Å; W94-S97 PolarHBondContact O-N 3.44Å; W94-N98 WeakPolarHBondContact O-CB 3.48Å; W94-N98 PolarHBondContact O-N 3.43Å
95	S	94.2	Very high	91.6	Very high	70 Å²	70	109.8 Å²	109.8	49%	0.49	60%	0.604	S	S	.	*	H	α-helix	trans	-64.9	-36.3	178.2	-175.7	0	0	0	0	112.8	I91 I92 K99	I91-S95 VanDerWaalsContact O-CB 3.25Å; I91-S95 WeakPolarHBondContact O-CB 3.32Å; I91-S95 PolarHBondContact O-N 3.4Å; I92-S95 PolarHBondContact O-N 2.95Å; S95-K99 WeakPolarHBondContact O-CB 3.25Å; S95-K99 PolarHBondContact O-N 3.38Å
96	V	95.1	Very high	91.2	Very high	98 Å²	98	110.9 Å²	110.9	59%	0.594	61%	0.607	S	S	*	*	H	α-helix	trans	-70.8	-43.9	175.8	170.4	0	0	0	0	110.7	I92 V93 W94 N98 K99 H100	I92-V96 HydrophobicContact CG2-CG2 4.47Å; I92-V96 WeakPolarHBondContact O-CB 3.44Å; I92-V96 VanDerWaalsContact O-CG2 3.28Å; I92-V96 WeakPolarHBondContact O-CG2 3.38Å; I92-V96 PolarHBondContact O-N 2.89Å; V93-V96 PolarHBondContact O-N 3.5Å; W94-V96 VanDerWaalsContact C-N 3.35Å; W94-V96 PolarHBondContact O-N 3.34Å; V96-N98 PolarHBondContact O-N 3.36Å; V96-K99 PolarHBondContact O-N 2.93Å; V96-H100 PolarHBondContact O-N 3.32Å
97	S	93	Very high	90.8	Very high	81 Å²	81	112.4 Å²	112.4	57%	0.566	61%	0.611	S	S	*	*	H	α-helix	trans	-63.2	-41.4	178.7	-171.3	0	0	0	0	112.5	V93 W94 K99 H100 S101	V93-S97 WeakPolarHBondContact O-CB 3.28Å; V93-S97 PolarHBondContact O-N 2.94Å; W94-S97 PolarHBondContact O-N 3.44Å; S97-K99 VanDerWaalsContact C-N 3.34Å; S97-H100 PolarHBondContact O-N 3.45Å; S97-S101 PolarHBondContact O-N 3.49Å
98	N	91.9	Very high	90.3	Very high	101 Å²	101	113.8 Å²	113.8	54%	0.54	62%	0.621	S	S	.	*	H	α-helix	trans	-73.5	-24.3	-179.5	-170.1	82.7	0	0	0	113.1	W94 V96 H100	W94-N98 WeakPolarHBondContact O-CB 3.48Å; W94-N98 PolarHBondContact O-N 3.43Å; V96-N98 PolarHBondContact O-N 3.36Å; N98-H100 VanDerWaalsContact C-N 3.35Å
99	K	85.5	Confident	89.8	Confident	187 Å²	187	116.4 Å²	116.4	81%	0.813	63%	0.631	S	S	*	*	H	α-helix	trans	-76.2	-23.7	176.5	-175.2	175.8	177.8	-177.3	0	112.7	S95 V96 S97	S95-K99 WeakPolarHBondContact O-CB 3.25Å; S95-K99 PolarHBondContact O-N 3.38Å; V96-K99 PolarHBondContact O-N 2.93Å; S97-K99 VanDerWaalsContact C-N 3.34Å
100	H	74.4	Confident	89.2	Confident	179 Å²	179	119.5 Å²	119.5	83%	0.829	64%	0.644	S	S	*	*	H	α-helix	trans	-92.4	-11.4	-179.9	-164	55.2	0	0	0	113.8	V96 S97 N98	V96-H100 PolarHBondContact O-N 3.32Å; S97-H100 PolarHBondContact O-N 3.45Å; N98-H100 VanDerWaalsContact C-N 3.35Å
101	S	56.5	Low	88.5	Confident	154 Å²	154	122.1 Å²	122.1	100%	1.077	65%	0.653	S	S	*	*			trans	-92.8	0	168.9	-170.4	0	0	0	0	111.3	S97	S97-S101 PolarHBondContact O-N 3.49Å

Retrieved 101 of 101 residues in 130.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).