G4V9Z3_SCHMA Loading...

U6 snRNA-associated Sm-like protein LSm3

Binds specifically to the 3'-terminal U-tract of U6 snRNA.

AlphaFold DB , UniProt , Accession G4V9Z3, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene LSM3, Length 103 aa.

						>G4V9Z3_SCHMA|G4V9Z3|LSM3
MEGNREDEDVEQPVLVEEPLDLIRLSLDEKIYVKMKRNRELRGVLHAFDSHLNMILGNVEETVTTLEIDEETYEEVYKTTKRTIPMLFIRGDGVILVSPPQKD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.6	Low	59.8	Low	246 Å²	246	168.3 Å²	168.3	100%	1.212	85%	0.852	S	S	*	*				0	84.8	0	-71.9	176.6	178.3	0	0	106.1	G3	M1-G3 PolarHBondContact O-N 3.34Å
2	E	51.5	Low	59.9	Low	198 Å²	198	168.4 Å²	168.4	93%	0.925	85%	0.847	S	S	*	*			trans	-82	101.1	172.1	-74.5	174.5	153.1	0	0	105.9	N4	E2-N4 PolarHBondContact O-N 3.11Å
3	G	54.8	Low	60.5	Low	69 Å²	69	163.6 Å²	163.6	71%	0.711	84%	0.835	S	S	*	*			trans	-68.9	118.6	171.6	0	0	0	0	0	108.1	M1 R5	M1-G3 PolarHBondContact O-N 3.34Å; G3-R5 PolarHBondContact O-N 3.34Å; G3-R5 VanDerWaalsContact O-N 3.11Å
4	N	60.4	Low	60.9	Low	152 Å²	152	159.4 Å²	159.4	81%	0.813	82%	0.821	S	S	*	*			trans	-49	118.4	164.3	-88.4	-1.8	0	0	0	107.7	E2 E6	E2-N4 PolarHBondContact O-N 3.11Å; N4-E6 VanDerWaalsContact C-N 3.29Å; N4-E6 PolarHBondContact O-N 3.04Å
5	R	62.2	Low	61.8	Low	230 Å²	230	157.5 Å²	157.5	87%	0.868	81%	0.812	S	S	*	*			trans	-68.4	99.7	160.3	-77.1	177.2	-101.6	-179.8	-4.1	104.6	G3 D7	G3-R5 PolarHBondContact O-N 3.34Å; G3-R5 VanDerWaalsContact O-N 3.11Å; R5-D7 PolarHBondContact O-N 2.86Å; R5-D7 VanDerWaalsContact O-N 3.08Å
6	E	62.4	Low	63.2	Low	171 Å²	171	151 Å²	151	80%	0.799	78%	0.781	S	S	*	*			trans	-58	110.9	163	-69.2	177.2	170.7	0	0	104.8	N4 E8	N4-E6 VanDerWaalsContact C-N 3.29Å; N4-E6 PolarHBondContact O-N 3.04Å; E6-E8 VanDerWaalsContact C-N 3.28Å; E6-E8 PolarHBondContact O-N 3.08Å
7	D	61	Low	64.7	Low	148 Å²	148	151.6 Å²	151.6	79%	0.791	78%	0.779	S	S	*	*			trans	-57.1	101.9	169.4	-68.7	-49	0	0	0	105.3	R5 D9	R5-D7 PolarHBondContact O-N 2.86Å; R5-D7 VanDerWaalsContact O-N 3.08Å; D7-D9 VanDerWaalsContact C-N 3.32Å; D7-D9 PolarHBondContact O-N 2.74Å
8	E	63.1	Low	66.1	Low	172 Å²	172	149.9 Å²	149.9	80%	0.804	77%	0.768	S	S	*	*			trans	-60.2	102.4	172.9	-73.5	-178.1	170.8	0	0	105.6	E6 V10	E6-E8 VanDerWaalsContact C-N 3.28Å; E6-E8 PolarHBondContact O-N 3.08Å; E8-V10 PolarHBondContact O-N 2.87Å
9	D	62.5	Low	67.3	Low	158 Å²	158	147.9 Å²	147.9	85%	0.845	77%	0.766	S	S	*	*			trans	-58.7	90.6	167.1	-80.7	-40.5	0	0	0	106.3	D7 E11	D7-D9 VanDerWaalsContact C-N 3.32Å; D7-D9 PolarHBondContact O-N 2.74Å; D9-E11 PolarHBondContact O-N 2.83Å
10	V	65.8	Low	68.5	Low	122 Å²	122	143.1 Å²	143.1	74%	0.739	74%	0.741	S	S	*	*			trans	-67.3	94.7	174	-178.3	0	0	0	0	105.6	E8 Q12	E8-V10 PolarHBondContact O-N 2.87Å; V10-Q12 PolarHBondContact O-N 3.17Å
11	E	61.9	Low	69.6	Low	185 Å²	185	137.3 Å²	137.3	86%	0.864	71%	0.711	S	S	*	*			trans	-56.9	105.5	176.9	-154.6	176.3	-161.8	0	0	107.2	D9	D9-E11 PolarHBondContact O-N 2.83Å
12	Q	61.3	Low	71.5	Confident	170 Å²	170	130 Å²	130	79%	0.794	68%	0.677	S	S	*	*			trans	-64.1	131.1	178	-69.1	-159.4	15.8	0	0	107.6	V10 V14	V10-Q12 PolarHBondContact O-N 3.17Å; Q12-V14 PolarHBondContact O-N 2.91Å
13	P	67.5	Low	73.5	Confident	106 Å²	106	121.6 Å²	121.6	69%	0.688	64%	0.638	S	S	*	*			trans	-59.6	127	179.3	23.5	-31.7	0	0	0	108.9	L15	P13-L15 PolarHBondContact O-N 3.18Å
14	V	66.1	Low	75.3	Confident	105 Å²	105	125.2 Å²	125.2	64%	0.636	63%	0.63	S	S	*	*			trans	-63.9	108.4	174.3	-170.4	0	0	0	0	106.9	Q12 V16	Q12-V14 PolarHBondContact O-N 2.91Å; V14-V16 WeakPolarHBondContact CG1-O 3.34Å; V14-V16 PolarHBondContact O-N 3.12Å
15	L	74.1	Confident	76.8	Confident	131 Å²	131	122.7 Å²	122.7	69%	0.686	62%	0.616	S	S	*	*	S	Bend	trans	-69.1	-13.3	-174.4	-67.6	175.6	0	0	0	113.8	P13	P13-L15 PolarHBondContact O-N 3.18Å
16	V	84.5	Confident	78.3	Confident	53 Å²	53	111.9 Å²	111.9	32%	0.321	58%	0.576	S	S	.	*			trans	-135.7	101	-175.6	-178.2	0	0	0	0	107.9	V14 D21 L22 L25	V14-V16 WeakPolarHBondContact CG1-O 3.34Å; V14-V16 PolarHBondContact O-N 3.12Å; V16-D21 HydrophobicContact CG1-CB 4.3Å; V16-L22 HydrophobicContact CB-CD2 4.46Å; V16-L22 HydrophobicContact CG1-CD1 4.49Å; V16-L22 HydrophobicContact CG1-CD2 3.88Å; V16-L22 HydrophobicContact CG1-CG 3.76Å; V16-L22 HydrophobicContact CG2-CD2 3.73Å; V16-L22 HydrophobicContact CG2-CG 4.4Å; V16-L25 HydrophobicContact CG2-CD1 3.48Å; V16-L25 VanDerWaalsContact CG2-CD1 3.48Å
17	E	89.2	Confident	80	Confident	161 Å²	161	107.2 Å²	107.2	75%	0.752	56%	0.556	S	S	*	*	S	Bend	trans	-98.4	-37.4	175.5	-64.1	-175	172.9	0	0	110.4	D21	E17-D21 PolarHBondContact N-OD2 3.45Å
18	E	90.1	Very high	81.7	Confident	121 Å²	121	106 Å²	106	57%	0.565	55%	0.549	S	S	*	.	S	Bend	trans	-124	156.7	-178.1	-62	-172.4	169	0	0	112.3	L20 D21	E18-L20 PolarHBondContact O-N 3.01Å; E18-L20 VanDerWaalsContact O-N 3.1Å; E18-D21 PolarHBondContact N-OD2 2.83Å; E18-D21 WeakPolarHBondContact O-CB 3.47Å; E18-D21 PolarHBondContact O-N 3.4Å
19	P	88.2	Confident	83.3	Confident	113 Å²	113	102.6 Å²	102.6	73%	0.734	53%	0.533	S	S	*	.	H	α-helix	trans	-55.1	-32.5	179.9	-28	35.6	0	0	0	114.7	D21 L22	P19-D21 VanDerWaalsContact C-N 3.25Å; P19-D21 PolarHBondContact O-N 2.88Å; P19-L22 PolarHBondContact O-N 2.92Å
20	L	92.1	Very high	84.9	Confident	50 Å²	50	100.7 Å²	100.7	26%	0.262	52%	0.518	S	S	.	.	H	α-helix	trans	-69.4	-21.5	177.9	-72.9	177.9	0	0	0	113	E18 L22 I23 R24 F48 L52	E18-L20 PolarHBondContact O-N 3.01Å; E18-L20 VanDerWaalsContact O-N 3.1Å; L20-L22 VanDerWaalsContact C-N 3.27Å; L20-L22 PolarHBondContact O-N 3.45Å; L20-I23 WeakPolarHBondContact O-CB 3.4Å; L20-I23 PolarHBondContact O-N 3.13Å; L20-I23 VanDerWaalsContact O-N 3.07Å; L20-R24 PolarHBondContact O-N 3.16Å; L20-R24 VanDerWaalsContact O-N 3.07Å; L20-F48 HydrophobicContact CD2-CE2 4.42Å; L20-L52 HydrophobicContact CD2-CD2 3.64Å; L20-L52 HydrophobicContact CD2-CG 4.35Å
21	D	91.9	Very high	86.4	Confident	22 Å²	22	95.1 Å²	95.1	12%	0.118	48%	0.483	C	S	.	.	H	α-helix	trans	-66	-32.8	177.3	-63.9	-32.2	0	0	0	111.4	V16 E17 E18 P19 I23 R24 L25	V16-D21 HydrophobicContact CG1-CB 4.3Å; E17-D21 PolarHBondContact N-OD2 3.45Å; E18-D21 PolarHBondContact N-OD2 2.83Å; E18-D21 WeakPolarHBondContact O-CB 3.47Å; E18-D21 PolarHBondContact O-N 3.4Å; P19-D21 VanDerWaalsContact C-N 3.25Å; P19-D21 PolarHBondContact O-N 2.88Å; D21-I23 PolarHBondContact O-N 3.39Å; D21-R24 WeakPolarHBondContact O-CB 3.43Å; D21-R24 PolarHBondContact O-N 3.02Å; D21-R24 VanDerWaalsContact O-N 3.12Å; D21-R24 IonicContact OD1-CZ 3.69Å; D21-R24 IonicContact OD1-NH1 2.81Å; D21-R24 PolarHBondContact OD1-NH1 3.37Å; D21-L25 WeakPolarHBondContact O-CG 3.38Å; D21-L25 PolarHBondContact O-N 3.45Å
22	L	89.8	Confident	88.2	Confident	94 Å²	94	88.8 Å²	88.8	49%	0.492	45%	0.452	S	S	.	.	H	α-helix	trans	-61	-34.2	172.3	-68.5	173.6	0	0	0	112.5	V16 P19 L20 S26	V16-L22 HydrophobicContact CB-CD2 4.46Å; V16-L22 HydrophobicContact CG1-CD1 4.49Å; V16-L22 HydrophobicContact CG1-CD2 3.88Å; V16-L22 HydrophobicContact CG1-CG 3.76Å; V16-L22 HydrophobicContact CG2-CD2 3.73Å; V16-L22 HydrophobicContact CG2-CG 4.4Å; P19-L22 PolarHBondContact O-N 2.92Å; L20-L22 VanDerWaalsContact C-N 3.27Å; L20-L22 PolarHBondContact O-N 3.45Å; L22-S26 PolarHBondContact O-N 2.92Å; L22-S26 PolarHBondContact O-OG 3.25Å
23	I	93.7	Very high	89.9	Confident	21 Å²	21	80.7 Å²	80.7	11%	0.108	41%	0.414	C	S	.	.	H	α-helix	trans	-72.5	-39.4	176.2	-52.4	-65	0	0	0	110.1	L20 D21 L25 S26 L45 F48 L52 M54 V97	L20-I23 WeakPolarHBondContact O-CB 3.4Å; L20-I23 PolarHBondContact O-N 3.13Å; L20-I23 VanDerWaalsContact O-N 3.07Å; D21-I23 PolarHBondContact O-N 3.39Å; I23-L25 VanDerWaalsContact C-N 3.32Å; I23-L25 PolarHBondContact O-N 2.91Å; I23-S26 WeakPolarHBondContact O-CB 3.37Å; I23-S26 PolarHBondContact O-N 3.12Å; I23-L45 HydrophobicContact CG2-CD2 3.88Å; I23-F48 HydrophobicContact CB-CD2 4.45Å; I23-F48 HydrophobicContact CB-CE2 4.17Å; I23-F48 HydrophobicContact CB-CZ 4.26Å; I23-F48 HydrophobicContact CG2-CB 4.48Å; I23-F48 HydrophobicContact CG2-CD1 3.89Å; I23-F48 HydrophobicContact CG2-CD2 3.72Å; I23-F48 HydrophobicContact CG2-CE1 4.07Å; I23-F48 HydrophobicContact CG2-CE2 3.9Å; I23-F48 HydrophobicContact CG2-CG 3.75Å; I23-F48 HydrophobicContact CG2-CZ 4.08Å; I23-L52 HydrophobicContact CG1-CD2 4.3Å; I23-M54 HydrophobicContact CG2-CE 4.15Å; I23-V97 HydrophobicContact CD1-CB 3.78Å; I23-V97 HydrophobicContact CD1-CG1 3.7Å; I23-V97 HydrophobicContact CD1-CG2 4.24Å
24	R	93.2	Very high	91.4	Very high	145 Å²	145	77.6 Å²	77.6	55%	0.547	39%	0.39	S	S	.	.	H	α-helix	trans	-58.4	-44.2	173	-66.1	179.1	176.1	156.5	-5.9	112	L20 D21 S26 L27 F48	L20-R24 PolarHBondContact O-N 3.16Å; L20-R24 VanDerWaalsContact O-N 3.07Å; D21-R24 WeakPolarHBondContact O-CB 3.43Å; D21-R24 PolarHBondContact O-N 3.02Å; D21-R24 VanDerWaalsContact O-N 3.12Å; D21-R24 IonicContact OD1-CZ 3.69Å; D21-R24 IonicContact OD1-NH1 2.81Å; D21-R24 PolarHBondContact OD1-NH1 3.37Å; R24-S26 PolarHBondContact O-N 3.07Å; R24-S26 VanDerWaalsContact O-N 3.16Å; R24-L27 WeakPolarHBondContact O-CB 3.33Å; R24-L27 WeakPolarHBondContact O-CG 3.43Å; R24-L27 PolarHBondContact O-N 3.41Å; R24-L27 VanDerWaalsContact O-N 3.13Å; R24-F48 HydrophobicContact CB-CE1 4.47Å; R24-F48 HydrophobicContact CB-CZ 4.37Å; R24-F48 HydrophobicContact CG-CE1 3.86Å; R24-F48 HydrophobicContact CG-CZ 3.42Å; R24-F48 VanDerWaalsContact CG-CZ 3.42Å
25	L	92.3	Very high	93	Very high	98 Å²	98	73.3 Å²	73.3	51%	0.513	36%	0.363	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64.9	-14.6	177	-67.5	176	0	0	0	113.2	V16 D21 I23	V16-L25 HydrophobicContact CG2-CD1 3.48Å; V16-L25 VanDerWaalsContact CG2-CD1 3.48Å; D21-L25 WeakPolarHBondContact O-CG 3.38Å; D21-L25 PolarHBondContact O-N 3.45Å; I23-L25 VanDerWaalsContact C-N 3.32Å; I23-L25 PolarHBondContact O-N 2.91Å
26	S	94.4	Very high	94.1	Very high	4 Å²	4	72.8 Å²	72.8	3%	0.028	36%	0.355	C	S	.	.	T	Hydrogen-bonded Turn	trans	-96.6	6.6	177.3	-53.2	0	0	0	0	113.4	L22 I23 R24 E29	L22-S26 PolarHBondContact O-N 2.92Å; L22-S26 PolarHBondContact O-OG 3.25Å; I23-S26 WeakPolarHBondContact O-CB 3.37Å; I23-S26 PolarHBondContact O-N 3.12Å; R24-S26 PolarHBondContact O-N 3.07Å; R24-S26 VanDerWaalsContact O-N 3.16Å; S26-E29 WeakPolarHBondContact O-CB 3.34Å; S26-E29 PolarHBondContact O-N 3.3Å
27	L	96.5	Very high	94.5	Very high	72 Å²	72	81.4 Å²	81.4	38%	0.377	38%	0.382	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.4	140.7	174.2	-77.7	170	0	0	0	111	R24 E29 L45 F48	R24-L27 WeakPolarHBondContact O-CB 3.33Å; R24-L27 WeakPolarHBondContact O-CG 3.43Å; R24-L27 PolarHBondContact O-N 3.41Å; R24-L27 VanDerWaalsContact O-N 3.13Å; L27-E29 PolarHBondContact O-N 3.4Å; L27-E29 VanDerWaalsContact O-N 3.12Å; L27-L45 HydrophobicContact CD2-CD2 4.41Å; L27-L45 HydrophobicContact CD2-CG 4.27Å; L27-F48 HydrophobicContact CD1-CE1 4.42Å; L27-F48 HydrophobicContact CD2-CD1 4.12Å; L27-F48 HydrophobicContact CD2-CE1 4.39Å; L27-F48 HydrophobicContact CG-CE1 4.38Å
28	D	96.6	Very high	94.8	Very high	122 Å²	122	78 Å²	78	65%	0.652	37%	0.369	S	S	*	.	T	Hydrogen-bonded Turn	trans	60.7	7.3	-173.5	-65.8	-41.4	0	0	0	115.4	L45 H46	D28-L45 PolarHBondContact N-O 2.86Å; D28-H46 IonicContact OD1-ND1 3.9Å
29	E	97	Very high	95.2	Very high	102 Å²	102	75 Å²	75	48%	0.477	35%	0.352	S	S	.	.	S	Bend	trans	-105	159.7	177.6	-68.4	-71.1	171	0	0	112.6	S26 L27 I31 V44 L45 P100	S26-E29 WeakPolarHBondContact O-CB 3.34Å; S26-E29 PolarHBondContact O-N 3.3Å; L27-E29 PolarHBondContact O-N 3.4Å; L27-E29 VanDerWaalsContact O-N 3.12Å; E29-I31 PolarHBondContact O-N 3.4Å; E29-V44 CarbonylContact O-C 3.59Å; E29-V44 WeakPolarHBondContact O-CA 3.26Å; E29-L45 PolarHBondContact O-N 2.87Å; E29-P100 HydrophobicContact CB-CB 4.36Å; E29-P100 HydrophobicContact CB-CG 3.32Å; E29-P100 HydrophobicContact CG-CG 3.92Å
30	K	97.2	Very high	95.7	Very high	118 Å²	118	72.1 Å²	72.1	51%	0.513	33%	0.329	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.4	117.7	175.7	-169.5	174.9	-176	175.8	0	110.6	G43 P100	K30-G43 CarbonylContact C-O 3.51Å; K30-G43 WeakPolarHBondContact CA-O 3.49Å; K30-P100 VanDerWaalsContact O-CA 3.32Å; K30-P100 WeakPolarHBondContact O-CA 3.42Å
31	I	97.6	Very high	96	Very high	4 Å²	4	69.8 Å²	69.8	2%	0.021	32%	0.317	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.6	162.5	179.1	63.6	165.7	0	0	0	112	E29 V33 R42 G43 L45 M54 L56 V97	E29-I31 PolarHBondContact O-N 3.4Å; I31-V33 HydrophobicContact CD1-CG2 3.65Å; I31-V33 HydrophobicContact CG1-CG2 4.15Å; I31-R42 WeakPolarHBondContact O-CA 3.42Å; I31-G43 PolarHBondContact N-O 3.24Å; I31-G43 PolarHBondContact O-N 2.79Å; I31-G43 VanDerWaalsContact O-N 3.16Å; I31-L45 HydrophobicContact CD1-CB 3.87Å; I31-L45 HydrophobicContact CD1-CD1 4.1Å; I31-L45 HydrophobicContact CD1-CD2 4.22Å; I31-L45 HydrophobicContact CD1-CG 4.27Å; I31-L45 HydrophobicContact CG1-CB 4.12Å; I31-L45 HydrophobicContact CG2-CB 4.33Å; I31-M54 HydrophobicContact CD1-SD 4.14Å; I31-L56 HydrophobicContact CD1-CD2 3.92Å; I31-L56 HydrophobicContact CG1-CD2 4.25Å; I31-V97 HydrophobicContact CD1-CG1 3.87Å
32	Y	98.1	Very high	96.3	Very high	52 Å²	52	74.1 Å²	74.1	20%	0.204	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.5	133.1	166.8	168.1	-92.7	0	0	0	110.3	K34 E40 L41 R42 L96 V97 S98	Y32-K34 HydrophobicContact CE1-CB 4.05Å; Y32-E40 HydrophobicContact CE2-CB 3.96Å; Y32-E40 HydrophobicContact CE2-CG 4.14Å; Y32-E40 VanDerWaalsContact CE2-OE2 3.28Å; Y32-E40 WeakPolarHBondContact CE2-OE2 3.19Å; Y32-E40 WeakPolarHBondContact OH-CG 3.46Å; Y32-E40 PolarHBondContact OH-OE2 2.81Å; Y32-L41 CarbonylContact C-O 3.57Å; Y32-L41 WeakPolarHBondContact CA-O 3.31Å; Y32-R42 HydrophobicContact CD2-CG 3.81Å; Y32-L96 HydrophobicContact CD1-CD1 4.13Å; Y32-L96 HydrophobicContact CE1-CD1 4Å; Y32-V97 CarbonylContact O-C 3.57Å; Y32-V97 WeakPolarHBondContact O-CA 3.35Å; Y32-S98 PolarHBondContact N-O 3.41Å; Y32-S98 VanDerWaalsContact N-O 3.08Å; Y32-S98 PolarHBondContact O-N 2.79Å
33	V	98.5	Very high	96.7	Very high	0 Å²	0	69.7 Å²	69.7	0%	0	31%	0.308	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125	118.9	177.8	-173	0	0	0	0	109.1	I31 M35 L41 M54 L56 V94 V97	I31-V33 HydrophobicContact CD1-CG2 3.65Å; I31-V33 HydrophobicContact CG1-CG2 4.15Å; V33-M35 HydrophobicContact CG1-CG 4.21Å; V33-M35 HydrophobicContact CG1-SD 3.77Å; V33-L41 HydrophobicContact CB-CB 4.32Å; V33-L41 PolarHBondContact N-O 2.79Å; V33-L41 PolarHBondContact O-N 2.91Å; V33-M54 HydrophobicContact CG2-SD 4.33Å; V33-L56 HydrophobicContact CG2-CD1 4.24Å; V33-V94 HydrophobicContact CG1-CG1 4.05Å; V33-V94 HydrophobicContact CG1-CG2 4.17Å; V33-V97 HydrophobicContact CG1-CG2 4.43Å; V33-V97 HydrophobicContact CG2-CG1 4.4Å; V33-V97 HydrophobicContact CG2-CG2 4.45Å
34	K	98.4	Very high	96.9	Very high	42 Å²	42	70.3 Å²	70.3	18%	0.183	31%	0.313	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87	126.7	166.8	-174.9	63.6	172	-176.3	0	108.3	Y32 E40 I95 L96	Y32-K34 HydrophobicContact CE1-CB 4.05Å; K34-E40 HydrophobicContact CD-CG 3.49Å; K34-E40 VanDerWaalsContact CD-CG 3.49Å; K34-E40 IonicContact NZ-OE1 3.05Å; K34-E40 PolarHBondContact NZ-OE1 2.81Å; K34-I95 HydrophobicContact CB-CB 4.45Å; K34-I95 HydrophobicContact CG-CB 4.29Å; K34-I95 HydrophobicContact CG-CD1 4.34Å; K34-I95 PolarHBondContact O-N 3.48Å; K34-L96 HydrophobicContact CB-CD1 4.23Å; K34-L96 HydrophobicContact CB-CD2 4.48Å; K34-L96 HydrophobicContact CB-CG 3.87Å; K34-L96 PolarHBondContact N-O 2.92Å; K34-L96 PolarHBondContact O-N 2.81Å
35	M	98.3	Very high	97.2	Very high	14 Å²	14	63.4 Å²	63.4	7%	0.069	29%	0.287	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.6	158.4	176.5	-60.9	-71.1	-71.9	0	0	110	V33 R39 L41 I89 G93 V94	V33-M35 HydrophobicContact CG1-CG 4.21Å; V33-M35 HydrophobicContact CG1-SD 3.77Å; M35-R39 WeakPolarHBondContact CA-O 3.49Å; M35-R39 HydrophobicContact CB-CB 3.96Å; M35-R39 HydrophobicContact CB-CG 4.13Å; M35-R39 WeakPolarHBondContact CB-O 3.43Å; M35-R39 HydrophobicContact CG-CG 4.44Å; M35-R39 PolarHBondContact N-O 2.94Å; M35-L41 HydrophobicContact CG-CD1 3.93Å; M35-L41 HydrophobicContact CG-CG 4.35Å; M35-I89 HydrophobicContact CE-CG2 3.45Å; M35-I89 VanDerWaalsContact CE-CG2 3.45Å; M35-I89 HydrophobicContact SD-CG2 3.75Å; M35-G93 CarbonylContact C-O 3.46Å; M35-G93 VanDerWaalsContact CA-O 3.31Å; M35-G93 WeakPolarHBondContact CA-O 3.11Å; M35-V94 HydrophobicContact CE-CG2 4.43Å; M35-V94 HydrophobicContact SD-CB 4.28Å; M35-V94 HydrophobicContact SD-CG2 3.66Å
36	K	97.3	Very high	97.5	Very high	121 Å²	121	62.5 Å²	62.5	53%	0.526	28%	0.28	S	S	.	.	T	Hydrogen-bonded Turn	trans	-55.1	158.2	165.7	-68.3	173.7	-177.7	162.6	0	110.6	D92 G93 I95	K36-D92 PolarHBondContact NZ-O 2.86Å; K36-G93 PolarHBondContact N-O 2.92Å; K36-I95 HydrophobicContact CB-CD1 4.45Å; K36-I95 HydrophobicContact CG-CD1 3.93Å; K36-I95 HydrophobicContact CG-CG1 3.79Å
37	R	94.4	Very high	97.7	Very high	233 Å²	233	64.2 Å²	64.2	88%	0.879	30%	0.295	S	S	*	.	T	Hydrogen-bonded Turn	trans	63.5	46.1	178.6	-52.4	177.2	179.4	168.9	-1.1	113.2	R39	R37-R39 PolarHBondContact O-N 3.06Å; R37-R39 VanDerWaalsContact O-N 3.11Å
38	N	95.5	Very high	97.7	Very high	90 Å²	90	63 Å²	63	48%	0.481	29%	0.286	S	S	.	.	T	Hydrogen-bonded Turn	trans	53.2	36.5	172.1	-58.3	-31.9	0	0	0	113.9	V63 T64	N38-V63 WeakPolarHBondContact O-CA 3.41Å; N38-T64 WeakPolarHBondContact CB-O 3.25Å; N38-T64 PolarHBondContact O-N 2.78Å
39	R	98.1	Very high	97.8	Very high	57 Å²	57	60 Å²	60	22%	0.215	27%	0.27	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	136.6	-179.4	176.6	-176.3	-163	-161.9	6.7	109.7	M35 R37 L41 E61 T62 V63	M35-R39 WeakPolarHBondContact CA-O 3.49Å; M35-R39 HydrophobicContact CB-CB 3.96Å; M35-R39 HydrophobicContact CB-CG 4.13Å; M35-R39 WeakPolarHBondContact CB-O 3.43Å; M35-R39 HydrophobicContact CG-CG 4.44Å; M35-R39 PolarHBondContact N-O 2.94Å; R37-R39 PolarHBondContact O-N 3.06Å; R37-R39 VanDerWaalsContact O-N 3.11Å; R39-L41 HydrophobicContact CG-CD2 4.39Å; R39-E61 IonicContact CZ-OE1 2.67Å; R39-E61 IonicContact NE-OE1 2.93Å; R39-E61 PolarHBondContact NE-OE1 2.88Å; R39-E61 VanDerWaalsContact NH2-CD 3.25Å; R39-E61 IonicContact NH2-OE1 3.33Å; R39-E61 PolarHBondContact NH2-OE1 2.85Å; R39-E61 IonicContact NH2-OE2 2.76Å; R39-E61 PolarHBondContact NH2-OE2 2.83Å; R39-T62 CarbonylContact C-O 3.55Å; R39-T62 WeakPolarHBondContact CA-O 3.38Å; R39-V63 HydrophobicContact CB-CG2 4.31Å; R39-V63 HydrophobicContact CG-CG2 4.1Å
40	E	98.6	Very high	97.7	Very high	54 Å²	54	59.4 Å²	59.4	25%	0.252	28%	0.277	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.3	137.2	-178.1	-67.4	-178.3	-148	0	0	109.2	Y32 K34 E61 T62	Y32-E40 HydrophobicContact CE2-CB 3.96Å; Y32-E40 HydrophobicContact CE2-CG 4.14Å; Y32-E40 VanDerWaalsContact CE2-OE2 3.28Å; Y32-E40 WeakPolarHBondContact CE2-OE2 3.19Å; Y32-E40 WeakPolarHBondContact OH-CG 3.46Å; Y32-E40 PolarHBondContact OH-OE2 2.81Å; K34-E40 HydrophobicContact CD-CG 3.49Å; K34-E40 VanDerWaalsContact CD-CG 3.49Å; K34-E40 IonicContact NZ-OE1 3.05Å; K34-E40 PolarHBondContact NZ-OE1 2.81Å; E40-E61 WeakPolarHBondContact O-CA 3.32Å; E40-T62 PolarHBondContact N-O 3.36Å; E40-T62 PolarHBondContact O-N 3.08Å
41	L	98.6	Very high	97.7	Very high	0 Å²	0	60.1 Å²	60.1	0%	0	28%	0.282	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.7	134.9	-177.7	-55	172.9	0	0	0	109	Y32 V33 M35 R39 L56 V59 E60 E61 L87 I89	Y32-L41 CarbonylContact C-O 3.57Å; Y32-L41 WeakPolarHBondContact CA-O 3.31Å; V33-L41 HydrophobicContact CB-CB 4.32Å; V33-L41 PolarHBondContact N-O 2.79Å; V33-L41 PolarHBondContact O-N 2.91Å; M35-L41 HydrophobicContact CG-CD1 3.93Å; M35-L41 HydrophobicContact CG-CG 4.35Å; R39-L41 HydrophobicContact CG-CD2 4.39Å; L41-L56 HydrophobicContact CB-CD1 4.43Å; L41-V59 HydrophobicContact CB-CG1 4.1Å; L41-V59 HydrophobicContact CD2-CG1 3.97Å; L41-E60 WeakPolarHBondContact CA-O 3.12Å; L41-E61 HydrophobicContact CD2-CB 3.64Å; L41-E61 HydrophobicContact CD2-CG 3.69Å; L41-L87 HydrophobicContact CD1-CD2 4.01Å; L41-L87 HydrophobicContact CD2-CD2 4.05Å; L41-I89 HydrophobicContact CD1-CD1 3.37Å; L41-I89 HydrophobicContact CD1-CG1 3.96Å
42	R	98.1	Very high	97.7	Very high	114 Å²	114	62.2 Å²	62.2	43%	0.43	29%	0.293	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.8	119.4	167.9	-70.1	-179.7	172.4	-152.8	-6.9	108.1	I31 Y32 V59 E60	I31-R42 WeakPolarHBondContact O-CA 3.42Å; Y32-R42 HydrophobicContact CD2-CG 3.81Å; R42-V59 CarbonylContact O-C 3.54Å; R42-V59 WeakPolarHBondContact O-CA 3.35Å; R42-E60 HydrophobicContact CB-CB 4.49Å; R42-E60 PolarHBondContact N-O 3.37Å; R42-E60 PolarHBondContact O-N 2.78Å
43	G	98.3	Very high	97.7	Very high	0 Å²	0	61.2 Å²	61.2	0%	0	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-166.9	171.5	-175.5	0	0	0	0	0	112	K30 I31 G57	K30-G43 CarbonylContact C-O 3.51Å; K30-G43 WeakPolarHBondContact CA-O 3.49Å; I31-G43 PolarHBondContact N-O 3.24Å; I31-G43 PolarHBondContact O-N 2.79Å; I31-G43 VanDerWaalsContact O-N 3.16Å; G43-G57 WeakPolarHBondContact CA-O 3.23Å
44	V	98.3	Very high	97.7	Very high	34 Å²	34	61.2 Å²	61.2	21%	0.206	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82	127	178.2	-178.5	0	0	0	0	109.3	E29 H46 L56 G57	E29-V44 CarbonylContact O-C 3.59Å; E29-V44 WeakPolarHBondContact O-CA 3.26Å; V44-H46 PolarHBondContact O-N 2.88Å; V44-L56 CarbonylContact O-C 3.58Å; V44-L56 WeakPolarHBondContact O-CA 3.49Å; V44-G57 PolarHBondContact N-O 3.41Å; V44-G57 PolarHBondContact O-N 2.85Å
45	L	98.5	Very high	97.7	Very high	0 Å²	0	62.3 Å²	62.3	0%	0	30%	0.299	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.6	109.8	177.7	179.5	64.2	0	0	0	110.9	I23 L27 D28 E29 I31 A47 F48 M54 L56	I23-L45 HydrophobicContact CG2-CD2 3.88Å; L27-L45 HydrophobicContact CD2-CD2 4.41Å; L27-L45 HydrophobicContact CD2-CG 4.27Å; D28-L45 PolarHBondContact N-O 2.86Å; E29-L45 PolarHBondContact O-N 2.87Å; I31-L45 HydrophobicContact CD1-CB 3.87Å; I31-L45 HydrophobicContact CD1-CD1 4.1Å; I31-L45 HydrophobicContact CD1-CD2 4.22Å; I31-L45 HydrophobicContact CD1-CG 4.27Å; I31-L45 HydrophobicContact CG1-CB 4.12Å; I31-L45 HydrophobicContact CG2-CB 4.33Å; L45-A47 WeakPolarHBondContact CD1-O 3.1Å; L45-F48 HydrophobicContact CD1-CB 4.38Å; L45-F48 HydrophobicContact CD2-CD1 4.44Å; L45-M54 HydrophobicContact CD1-CB 4.05Å; L45-M54 HydrophobicContact CD1-CG 4.04Å; L45-M54 HydrophobicContact CD1-SD 4.04Å; L45-L56 HydrophobicContact CB-CD2 4.1Å; L45-L56 HydrophobicContact CD1-CD2 3.62Å; L45-L56 HydrophobicContact CG-CD2 4.49Å
46	H	98.5	Very high	97.8	Very high	80 Å²	80	61.7 Å²	61.7	37%	0.37	30%	0.295	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.1	-36.6	178.1	-73.1	-55.2	0	0	0	113.6	D28 V44 I55 G57	D28-H46 IonicContact OD1-ND1 3.9Å; V44-H46 PolarHBondContact O-N 2.88Å; H46-I55 HydrophobicContact CB-CB 4.42Å; H46-I55 HydrophobicContact CB-CG2 4.19Å; H46-I55 PolarHBondContact N-O 3.15Å; H46-G57 PolarHBondContact CD2-N 2.93Å
47	A	98.5	Very high	97.8	Very high	40 Å²	40	56 Å²	56	33%	0.331	27%	0.271	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-157.9	155.4	-179.4	0	0	0	0	0	110.7	L45 M54 I55	L45-A47 WeakPolarHBondContact CD1-O 3.1Å; A47-M54 CarbonylContact O-C 3.53Å; A47-M54 VanDerWaalsContact O-CA 3.31Å; A47-M54 WeakPolarHBondContact O-CA 3.34Å; A47-I55 HydrophobicContact CB-CB 4.24Å; A47-I55 HydrophobicContact CB-CD1 4.19Å; A47-I55 HydrophobicContact CB-CG1 4.36Å; A47-I55 PolarHBondContact N-O 3.15Å; A47-I55 PolarHBondContact O-N 2.96Å
48	F	98	Very high	98	Very high	47 Å²	47	50.5 Å²	50.5	21%	0.206	26%	0.259	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-151.6	169.2	170.6	76.5	-74.1	0	0	0	111.7	L20 I23 R24 L27 L45 N53 M54	L20-F48 HydrophobicContact CD2-CE2 4.42Å; I23-F48 HydrophobicContact CB-CD2 4.45Å; I23-F48 HydrophobicContact CB-CE2 4.17Å; I23-F48 HydrophobicContact CB-CZ 4.26Å; I23-F48 HydrophobicContact CG2-CB 4.48Å; I23-F48 HydrophobicContact CG2-CD1 3.89Å; I23-F48 HydrophobicContact CG2-CD2 3.72Å; I23-F48 HydrophobicContact CG2-CE1 4.07Å; I23-F48 HydrophobicContact CG2-CE2 3.9Å; I23-F48 HydrophobicContact CG2-CG 3.75Å; I23-F48 HydrophobicContact CG2-CZ 4.08Å; R24-F48 HydrophobicContact CB-CE1 4.47Å; R24-F48 HydrophobicContact CB-CZ 4.37Å; R24-F48 HydrophobicContact CG-CE1 3.86Å; R24-F48 HydrophobicContact CG-CZ 3.42Å; R24-F48 VanDerWaalsContact CG-CZ 3.42Å; L27-F48 HydrophobicContact CD1-CE1 4.42Å; L27-F48 HydrophobicContact CD2-CD1 4.12Å; L27-F48 HydrophobicContact CD2-CE1 4.39Å; L27-F48 HydrophobicContact CG-CE1 4.38Å; L45-F48 HydrophobicContact CD1-CB 4.38Å; L45-F48 HydrophobicContact CD2-CD1 4.44Å; F48-N53 CarbonylContact C-O 3.6Å; F48-N53 WeakPolarHBondContact CA-O 3.26Å; F48-N53 WeakPolarHBondContact CB-O 3.39Å; F48-M54 HydrophobicContact CB-CG 3.95Å
49	D	97.4	Very high	98.2	Very high	59 Å²	59	46.2 Å²	46.2	32%	0.316	24%	0.236	S	C	.	.			trans	-128.3	-179	173.4	68.4	18.7	0	0	0	112.7	H51 L52 N53	D49-H51 PolarHBondContact O-N 2.9Å; D49-H51 WeakPolarHBondContact OD1-CA 3.36Å; D49-H51 WeakPolarHBondContact OD1-CB 3.38Å; D49-H51 PolarHBondContact OD1-N 3.21Å; D49-L52 PolarHBondContact O-N 2.98Å; D49-L52 PolarHBondContact OD1-N 2.84Å; D49-L52 VanDerWaalsContact OD1-N 3.15Å; D49-N53 PolarHBondContact N-O 3.1Å; D49-N53 VanDerWaalsContact N-O 3.15Å; D49-N53 WeakPolarHBondContact OD1-CB 3.41Å; D49-N53 PolarHBondContact OD1-N 3.16Å; D49-N53 PolarHBondContact OD1-ND2 3.15Å; D49-N53 WeakPolarHBondContact OD2-CB 3.32Å; D49-N53 PolarHBondContact OD2-ND2 3.07Å
50	S	96.3	Very high	98.2	Very high	89 Å²	89	46.3 Å²	46.3	62%	0.622	24%	0.239	S	C	*	.	T	Hydrogen-bonded Turn	trans	-64.5	-18.4	179.2	55.7	0	0	0	0	114.2	L52	S50-L52 VanDerWaalsContact C-N 3.29Å
51	H	97	Very high	98.2	Very high	132 Å²	132	44.2 Å²	44.2	61%	0.611	23%	0.229	S	C	*	.	T	Hydrogen-bonded Turn	trans	-88.4	1	174.6	-61.7	-66.6	0	0	0	112.3	D49 N53 G91	D49-H51 PolarHBondContact O-N 2.9Å; D49-H51 WeakPolarHBondContact OD1-CA 3.36Å; D49-H51 WeakPolarHBondContact OD1-CB 3.38Å; D49-H51 PolarHBondContact OD1-N 3.21Å; H51-N53 PolarHBondContact O-N 3.1Å; H51-G91 VanDerWaalsContact O-CA 3.32Å; H51-G91 WeakPolarHBondContact O-CA 3.45Å
52	L	97.1	Very high	98.2	Very high	48 Å²	48	45.3 Å²	45.3	25%	0.251	24%	0.236	S	C	.	.			trans	59.4	27.8	-170.7	-61	173.7	0	0	0	113.1	L20 I23 D49 S50 M54 G91	L20-L52 HydrophobicContact CD2-CD2 3.64Å; L20-L52 HydrophobicContact CD2-CG 4.35Å; I23-L52 HydrophobicContact CG1-CD2 4.3Å; D49-L52 PolarHBondContact O-N 2.98Å; D49-L52 PolarHBondContact OD1-N 2.84Å; D49-L52 VanDerWaalsContact OD1-N 3.15Å; S50-L52 VanDerWaalsContact C-N 3.29Å; L52-M54 HydrophobicContact CB-CE 4.27Å; L52-M54 HydrophobicContact CD2-CE 3.87Å; L52-G91 VanDerWaalsContact C-CA 3.45Å; L52-G91 WeakPolarHBondContact O-CA 3.48Å
53	N	98.5	Very high	98.2	Very high	32 Å²	32	41.5 Å²	41.5	17%	0.171	23%	0.225	C	C	.	.			trans	-65	139.6	158.2	-57	-51.8	0	0	0	107.6	F48 D49 H51 F88 I89 R90 G91	F48-N53 CarbonylContact C-O 3.6Å; F48-N53 WeakPolarHBondContact CA-O 3.26Å; F48-N53 WeakPolarHBondContact CB-O 3.39Å; D49-N53 PolarHBondContact N-O 3.1Å; D49-N53 VanDerWaalsContact N-O 3.15Å; D49-N53 WeakPolarHBondContact OD1-CB 3.41Å; D49-N53 PolarHBondContact OD1-N 3.16Å; D49-N53 PolarHBondContact OD1-ND2 3.15Å; D49-N53 WeakPolarHBondContact OD2-CB 3.32Å; D49-N53 PolarHBondContact OD2-ND2 3.07Å; H51-N53 PolarHBondContact O-N 3.1Å; N53-F88 HydrophobicContact CB-CE2 4.11Å; N53-F88 HydrophobicContact CB-CZ 3.93Å; N53-I89 CarbonylContact C-O 3.57Å; N53-I89 WeakPolarHBondContact CA-O 3.43Å; N53-R90 WeakPolarHBondContact OD1-CA 3.48Å; N53-G91 PolarHBondContact OD1-N 3.24Å
54	M	98.6	Very high	98.1	Very high	0 Å²	0	43 Å²	43	0%	0	23%	0.234	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-135.1	147.2	-174.5	-61.8	-178.9	177	0	0	111.6	I23 I31 V33 L45 A47 F48 L52 L56 F88 I89 V97	I23-M54 HydrophobicContact CG2-CE 4.15Å; I31-M54 HydrophobicContact CD1-SD 4.14Å; V33-M54 HydrophobicContact CG2-SD 4.33Å; L45-M54 HydrophobicContact CD1-CB 4.05Å; L45-M54 HydrophobicContact CD1-CG 4.04Å; L45-M54 HydrophobicContact CD1-SD 4.04Å; A47-M54 CarbonylContact O-C 3.53Å; A47-M54 VanDerWaalsContact O-CA 3.31Å; A47-M54 WeakPolarHBondContact O-CA 3.34Å; F48-M54 HydrophobicContact CB-CG 3.95Å; L52-M54 HydrophobicContact CB-CE 4.27Å; L52-M54 HydrophobicContact CD2-CE 3.87Å; M54-L56 HydrophobicContact CB-CD2 4.24Å; M54-F88 CarbonylContact O-C 3.52Å; M54-F88 WeakPolarHBondContact O-CA 3.21Å; M54-I89 HydrophobicContact CB-CB 4.28Å; M54-I89 HydrophobicContact CB-CD1 4.47Å; M54-I89 PolarHBondContact N-O 3.11Å; M54-I89 PolarHBondContact O-N 2.78Å; M54-V97 HydrophobicContact CE-CG1 4.49Å; M54-V97 HydrophobicContact CE-CG2 3.62Å; M54-V97 HydrophobicContact SD-CG2 4.44Å
55	I	98.8	Very high	97.8	Very high	65 Å²	65	43.9 Å²	43.9	33%	0.333	24%	0.24	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-107.1	115.4	165	-60.1	178.8	0	0	0	106.7	H46 A47 M86 F88	H46-I55 HydrophobicContact CB-CB 4.42Å; H46-I55 HydrophobicContact CB-CG2 4.19Å; H46-I55 PolarHBondContact N-O 3.15Å; A47-I55 HydrophobicContact CB-CB 4.24Å; A47-I55 HydrophobicContact CB-CD1 4.19Å; A47-I55 HydrophobicContact CB-CG1 4.36Å; A47-I55 PolarHBondContact N-O 3.15Å; A47-I55 PolarHBondContact O-N 2.96Å; I55-M86 HydrophobicContact CG2-CE 3.42Å; I55-M86 VanDerWaalsContact CG2-CE 3.42Å; I55-F88 HydrophobicContact CG1-CD2 4.19Å
56	L	98.8	Very high	97.5	Very high	0 Å²	0	48 Å²	48	0%	0	26%	0.262	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109	140.9	174.5	-55.6	-169.7	0	0	0	111.5	I31 V33 L41 V44 L45 M54 V59 M86 L87 I89	I31-L56 HydrophobicContact CD1-CD2 3.92Å; I31-L56 HydrophobicContact CG1-CD2 4.25Å; V33-L56 HydrophobicContact CG2-CD1 4.24Å; L41-L56 HydrophobicContact CB-CD1 4.43Å; V44-L56 CarbonylContact O-C 3.58Å; V44-L56 WeakPolarHBondContact O-CA 3.49Å; L45-L56 HydrophobicContact CB-CD2 4.1Å; L45-L56 HydrophobicContact CD1-CD2 3.62Å; L45-L56 HydrophobicContact CG-CD2 4.49Å; M54-L56 HydrophobicContact CB-CD2 4.24Å; L56-V59 HydrophobicContact CB-CG2 3.42Å; L56-V59 VanDerWaalsContact CB-CG2 3.42Å; L56-M86 CarbonylContact O-C 3.58Å; L56-M86 WeakPolarHBondContact O-CA 3.3Å; L56-L87 PolarHBondContact N-O 2.84Å; L56-L87 PolarHBondContact O-N 3.49Å; L56-I89 HydrophobicContact CB-CD1 4.47Å; L56-I89 HydrophobicContact CD1-CD1 3.35Å; L56-I89 HydrophobicContact CG-CD1 3.55Å
57	G	98.7	Very high	97.2	Very high	1 Å²	1	48.2 Å²	48.2	1%	0.01	26%	0.263	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.5	156	171.3	0	0	0	0	0	112.4	G43 V44 H46 V59 P85	G43-G57 WeakPolarHBondContact CA-O 3.23Å; V44-G57 PolarHBondContact N-O 3.41Å; V44-G57 PolarHBondContact O-N 2.85Å; H46-G57 PolarHBondContact CD2-N 2.93Å; G57-V59 VanDerWaalsContact C-N 3.29Å; G57-V59 PolarHBondContact O-N 2.84Å; G57-P85 CarbonylContact C-O 3.59Å; G57-P85 WeakPolarHBondContact CA-O 3.18Å
58	N	98.3	Very high	96.8	Very high	118 Å²	118	51.7 Å²	51.7	63%	0.631	28%	0.275	S	S	*	.	E	Extended strand (participates in β ladder)	trans	47.5	49.3	176.4	-61.3	-42.6	0	0	0	113.1	P85	N58-P85 PolarHBondContact N-O 2.93Å
59	V	98.7	Very high	96.3	Very high	0 Å²	0	52.3 Å²	52.3	0%	0	28%	0.28	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.4	124.1	-168.6	-172.7	0	0	0	0	110.9	L41 R42 L56 G57 T83 I84 L87	L41-V59 HydrophobicContact CB-CG1 4.1Å; L41-V59 HydrophobicContact CD2-CG1 3.97Å; R42-V59 CarbonylContact O-C 3.54Å; R42-V59 WeakPolarHBondContact O-CA 3.35Å; L56-V59 HydrophobicContact CB-CG2 3.42Å; L56-V59 VanDerWaalsContact CB-CG2 3.42Å; G57-V59 VanDerWaalsContact C-N 3.29Å; G57-V59 PolarHBondContact O-N 2.84Å; V59-T83 CarbonylContact O-C 3.59Å; V59-T83 VanDerWaalsContact O-CA 3.23Å; V59-T83 WeakPolarHBondContact O-CA 3.46Å; V59-I84 HydrophobicContact CB-CB 4.37Å; V59-I84 PolarHBondContact N-O 2.67Å; V59-I84 PolarHBondContact O-N 2.96Å; V59-L87 HydrophobicContact CG1-CD2 4.19Å; V59-L87 HydrophobicContact CG2-CB 3.96Å
60	E	98.5	Very high	96	Very high	60 Å²	60	57.9 Å²	57.9	28%	0.28	30%	0.304	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.2	115.5	158.6	-173.3	-176.2	167.3	0	0	108.4	L41 R42 K81	L41-E60 WeakPolarHBondContact CA-O 3.12Å; R42-E60 HydrophobicContact CB-CB 4.49Å; R42-E60 PolarHBondContact N-O 3.37Å; R42-E60 PolarHBondContact O-N 2.78Å; E60-K81 IonicContact OE1-NZ 2.8Å; E60-K81 PolarHBondContact OE1-NZ 3.33Å
61	E	98.6	Very high	95.8	Very high	9 Å²	9	62.2 Å²	62.2	4%	0.042	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.5	135.5	173.5	172.9	177	-156.1	0	0	110.1	R39 E40 L41 V63 K81 R82 I84	R39-E61 IonicContact CZ-OE1 2.67Å; R39-E61 IonicContact NE-OE1 2.93Å; R39-E61 PolarHBondContact NE-OE1 2.88Å; R39-E61 VanDerWaalsContact NH2-CD 3.25Å; R39-E61 IonicContact NH2-OE1 3.33Å; R39-E61 PolarHBondContact NH2-OE1 2.85Å; R39-E61 IonicContact NH2-OE2 2.76Å; R39-E61 PolarHBondContact NH2-OE2 2.83Å; E40-E61 WeakPolarHBondContact O-CA 3.32Å; L41-E61 HydrophobicContact CD2-CB 3.64Å; L41-E61 HydrophobicContact CD2-CG 3.69Å; E61-V63 HydrophobicContact CG-CG2 3.97Å; E61-V63 WeakPolarHBondContact OE1-CG2 3.47Å; E61-K81 VanDerWaalsContact O-CA 3.25Å; E61-K81 WeakPolarHBondContact O-CA 3.47Å; E61-R82 HydrophobicContact CB-CG 4.17Å; E61-R82 PolarHBondContact N-O 2.88Å; E61-R82 PolarHBondContact O-N 2.92Å; E61-R82 IonicContact OE1-NH2 3.71Å; E61-R82 IonicContact OE2-CZ 3.15Å; E61-R82 IonicContact OE2-NE 2.69Å; E61-R82 PolarHBondContact OE2-NE 2.8Å; E61-R82 IonicContact OE2-NH2 2.75Å; E61-R82 PolarHBondContact OE2-NH2 3.33Å; E61-I84 HydrophobicContact CB-CD1 4.33Å; E61-I84 VanDerWaalsContact OE2-CD1 3.26Å; E61-I84 WeakPolarHBondContact OE2-CD1 3.17Å
62	T	98.5	Very high	95.6	Very high	24 Å²	24	59.6 Å²	59.6	15%	0.147	31%	0.308	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.5	126	171.6	-60	0	0	0	0	109	R39 E40 T79 T80 K81	R39-T62 CarbonylContact C-O 3.55Å; R39-T62 WeakPolarHBondContact CA-O 3.38Å; E40-T62 PolarHBondContact N-O 3.36Å; E40-T62 PolarHBondContact O-N 3.08Å; T62-T79 HydrophobicContact CG2-CG2 3.21Å; T62-T80 WeakPolarHBondContact CA-O 3.48Å; T62-K81 HydrophobicContact CG2-CG 4.27Å
63	V	97.8	Very high	95.2	Very high	34 Å²	34	66.3 Å²	66.3	21%	0.206	33%	0.331	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.4	124.9	174.6	-177.1	0	0	0	0	109	N38 R39 E61 T65 T79 T80	N38-V63 WeakPolarHBondContact O-CA 3.41Å; R39-V63 HydrophobicContact CB-CG2 4.31Å; R39-V63 HydrophobicContact CG-CG2 4.1Å; E61-V63 HydrophobicContact CG-CG2 3.97Å; E61-V63 WeakPolarHBondContact OE1-CG2 3.47Å; V63-T65 HydrophobicContact CG1-CG2 4.4Å; V63-T79 WeakPolarHBondContact O-CA 3.45Å; V63-T80 PolarHBondContact N-O 3.43Å; V63-T80 PolarHBondContact O-N 2.84Å; V63-T80 PolarHBondContact O-OG1 2.67Å
64	T	96.2	Very high	94.9	Very high	30 Å²	30	70.9 Å²	70.9	18%	0.184	35%	0.352	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.8	120.3	177.7	-53.9	0	0	0	0	110.3	N38 Y77 K78 T79	N38-T64 WeakPolarHBondContact CB-O 3.25Å; N38-T64 PolarHBondContact O-N 2.78Å; T64-Y77 HydrophobicContact CG2-CD1 4Å; T64-Y77 HydrophobicContact CG2-CG 4.5Å; T64-K78 CarbonylContact C-O 3.52Å; T64-K78 VanDerWaalsContact CA-O 3.3Å; T64-K78 WeakPolarHBondContact CA-O 3.48Å; T64-T79 PolarHBondContact OG1-OG1 3.01Å
65	T	93.6	Very high	94.6	Very high	54 Å²	54	77 Å²	77	33%	0.331	38%	0.38	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110	148.9	176.1	52.8	0	0	0	0	110.1	V63 Y77 K78	V63-T65 HydrophobicContact CG1-CG2 4.4Å; T65-Y77 CarbonylContact O-C 3.59Å; T65-Y77 WeakPolarHBondContact O-CA 3.35Å; T65-K78 PolarHBondContact N-O 2.69Å; T65-K78 PolarHBondContact O-N 2.83Å; T65-K78 PolarHBondContact OG1-O 2.75Å
66	L	92.2	Very high	94.2	Very high	86 Å²	86	77 Å²	77	45%	0.45	38%	0.383	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92	117.2	169.1	-170.2	73.4	0	0	0	107.1	E75 Y77	L66-E75 HydrophobicContact CD1-CB 3.93Å; L66-E75 HydrophobicContact CD1-CG 4.3Å; L66-E75 HydrophobicContact CD2-CG 4.32Å; L66-E75 HydrophobicContact CG-CG 4.47Å; L66-Y77 HydrophobicContact CD1-CD1 3.89Å; L66-Y77 HydrophobicContact CD1-CD2 4.34Å; L66-Y77 HydrophobicContact CD1-CE1 3.57Å; L66-Y77 HydrophobicContact CD1-CE2 4.06Å; L66-Y77 HydrophobicContact CD1-CG 4.27Å
67	E	90.6	Very high	93.9	Very high	84 Å²	84	84.6 Å²	84.6	39%	0.393	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.7	149.5	172.4	-65.3	-176.1	-178.6	0	0	108	V76 K78	E67-V76 PolarHBondContact N-O 3.33Å; E67-V76 PolarHBondContact O-N 3.36Å; E67-K78 WeakPolarHBondContact OE1-CD 3.28Å; E67-K78 IonicContact OE1-NZ 2.74Å; E67-K78 PolarHBondContact OE1-NZ 2.8Å; E67-K78 WeakPolarHBondContact OE2-CD 3.37Å; E67-K78 IonicContact OE2-NZ 3.18Å; E67-K78 PolarHBondContact OE2-NZ 2.83Å
68	I	90.9	Very high	93.6	Very high	113 Å²	113	89.3 Å²	89.3	58%	0.579	43%	0.433	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-99.9	126.3	171.9	-59.1	175.8	0	0	0	106.4	E70 E74	I68-E70 PolarHBondContact O-N 2.8Å; I68-E74 WeakPolarHBondContact CA-O 3.49Å
69	D	88	Confident	93.4	Very high	60 Å²	60	87.2 Å²	87.2	32%	0.321	43%	0.425	S	S	.	.			trans	-66.6	125.8	174	-171.9	-68.4	0	0	0	109.8	E71 T72 Y73 E74 V76	D69-E71 VanDerWaalsContact C-N 3.29Å; D69-E71 PolarHBondContact O-N 2.92Å; D69-E71 WeakPolarHBondContact OD1-CA 3.31Å; D69-E71 WeakPolarHBondContact OD1-CB 3.35Å; D69-E71 PolarHBondContact OD1-N 3.01Å; D69-T72 WeakPolarHBondContact CB-OG1 3.45Å; D69-T72 PolarHBondContact OD1-N 2.82Å; D69-T72 PolarHBondContact OD1-OG1 2.6Å; D69-Y73 WeakPolarHBondContact O-CA 3.46Å; D69-Y73 PolarHBondContact O-N 2.76Å; D69-E74 PolarHBondContact N-O 2.74Å; D69-V76 HydrophobicContact CB-CG2 4.15Å
70	E	89.9	Confident	93.3	Very high	176 Å²	176	90.6 Å²	90.6	82%	0.822	45%	0.446	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.9	-19.7	-174.4	-64.2	-173.1	167.2	0	0	113.3	I68	I68-E70 PolarHBondContact O-N 2.8Å
71	E	92.5	Very high	93.2	Very high	181 Å²	181	94.2 Å²	94.2	85%	0.846	46%	0.461	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.2	-43.1	-179.4	-60.7	-173.2	175.5	0	0	111.6	D69	D69-E71 VanDerWaalsContact C-N 3.29Å; D69-E71 PolarHBondContact O-N 2.92Å; D69-E71 WeakPolarHBondContact OD1-CA 3.31Å; D69-E71 WeakPolarHBondContact OD1-CB 3.35Å; D69-E71 PolarHBondContact OD1-N 3.01Å
72	T	92.2	Very high	93.2	Very high	76 Å²	76	100.9 Å²	100.9	47%	0.466	49%	0.485	S	S	.	.	T	Hydrogen-bonded Turn	trans	-97.6	-15.7	-177	71	0	0	0	0	113.7	D69 E74	D69-T72 WeakPolarHBondContact CB-OG1 3.45Å; D69-T72 PolarHBondContact OD1-N 2.82Å; D69-T72 PolarHBondContact OD1-OG1 2.6Å; T72-E74 PolarHBondContact O-N 2.83Å; T72-E74 PolarHBondContact OG1-N 3.25Å
73	Y	88.7	Confident	93.2	Very high	189 Å²	189	105.1 Å²	105.1	74%	0.741	51%	0.511	S	S	*	.			trans	58.4	20.3	-171.8	-61.7	-81.5	0	0	0	114.4	D69	D69-Y73 WeakPolarHBondContact O-CA 3.46Å; D69-Y73 PolarHBondContact O-N 2.76Å
74	E	93.9	Very high	93.3	Very high	129 Å²	129	104.8 Å²	104.8	60%	0.603	51%	0.508	S	S	*	.			trans	-85.8	149.9	176.9	-64.8	-175.7	158.1	0	0	111.6	I68 D69 T72 V76	I68-E74 WeakPolarHBondContact CA-O 3.49Å; D69-E74 PolarHBondContact N-O 2.74Å; T72-E74 PolarHBondContact O-N 2.83Å; T72-E74 PolarHBondContact OG1-N 3.25Å; E74-V76 PolarHBondContact O-N 2.98Å
75	E	91.2	Very high	93.4	Very high	127 Å²	127	108 Å²	108	59%	0.593	53%	0.53	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-76.6	118.4	172.6	-77.9	-174.3	-172.8	0	0	110.6	L66	L66-E75 HydrophobicContact CD1-CB 3.93Å; L66-E75 HydrophobicContact CD1-CG 4.3Å; L66-E75 HydrophobicContact CD2-CG 4.32Å; L66-E75 HydrophobicContact CG-CG 4.47Å
76	V	91	Very high	93.6	Very high	66 Å²	66	110.7 Å²	110.7	40%	0.4	54%	0.54	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.9	127.1	-179.6	-176.4	0	0	0	0	110.2	E67 D69 E74 K78	E67-V76 PolarHBondContact N-O 3.33Å; E67-V76 PolarHBondContact O-N 3.36Å; D69-V76 HydrophobicContact CB-CG2 4.15Å; E74-V76 PolarHBondContact O-N 2.98Å; V76-K78 PolarHBondContact O-N 2.9Å
77	Y	91.5	Very high	93.9	Very high	160 Å²	160	108 Å²	108	63%	0.627	53%	0.525	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.2	112.7	172.9	-68.5	-82.8	0	0	0	110.6	T64 T65 L66	T64-Y77 HydrophobicContact CG2-CD1 4Å; T64-Y77 HydrophobicContact CG2-CG 4.5Å; T65-Y77 CarbonylContact O-C 3.59Å; T65-Y77 WeakPolarHBondContact O-CA 3.35Å; L66-Y77 HydrophobicContact CD1-CD1 3.89Å; L66-Y77 HydrophobicContact CD1-CD2 4.34Å; L66-Y77 HydrophobicContact CD1-CE1 3.57Å; L66-Y77 HydrophobicContact CD1-CE2 4.06Å; L66-Y77 HydrophobicContact CD1-CG 4.27Å
78	K	92.6	Very high	94.3	Very high	99 Å²	99	110.5 Å²	110.5	43%	0.43	54%	0.535	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.3	134.2	175.4	-171.4	178.9	-176.7	177	0	110.6	T64 T65 E67 V76	T64-K78 CarbonylContact C-O 3.52Å; T64-K78 VanDerWaalsContact CA-O 3.3Å; T64-K78 WeakPolarHBondContact CA-O 3.48Å; T65-K78 PolarHBondContact N-O 2.69Å; T65-K78 PolarHBondContact O-N 2.83Å; T65-K78 PolarHBondContact OG1-O 2.75Å; E67-K78 WeakPolarHBondContact OE1-CD 3.28Å; E67-K78 IonicContact OE1-NZ 2.74Å; E67-K78 PolarHBondContact OE1-NZ 2.8Å; E67-K78 WeakPolarHBondContact OE2-CD 3.37Å; E67-K78 IonicContact OE2-NZ 3.18Å; E67-K78 PolarHBondContact OE2-NZ 2.83Å; V76-K78 PolarHBondContact O-N 2.9Å
79	T	94.6	Very high	94.6	Very high	74 Å²	74	105.2 Å²	105.2	45%	0.454	51%	0.508	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	123.8	179	-63.2	0	0	0	0	109.8	T62 V63 T64 K81	T62-T79 HydrophobicContact CG2-CG2 3.21Å; V63-T79 WeakPolarHBondContact O-CA 3.45Å; T64-T79 PolarHBondContact OG1-OG1 3.01Å; T79-K81 HydrophobicContact CG2-CG 4.43Å
80	T	96	Very high	95.1	Very high	72 Å²	72	110.3 Å²	110.3	44%	0.442	52%	0.523	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.4	137.3	172.7	59.5	0	0	0	0	109.5	T62 V63	T62-T80 WeakPolarHBondContact CA-O 3.48Å; V63-T80 PolarHBondContact N-O 3.43Å; V63-T80 PolarHBondContact O-N 2.84Å; V63-T80 PolarHBondContact O-OG1 2.67Å
81	K	97.8	Very high	95.5	Very high	136 Å²	136	102.3 Å²	102.3	59%	0.591	49%	0.487	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-123.3	142.7	179	-68.7	-169.3	166.5	-154.1	0	111	E60 E61 T62 T79	E60-K81 IonicContact OE1-NZ 2.8Å; E60-K81 PolarHBondContact OE1-NZ 3.33Å; E61-K81 VanDerWaalsContact O-CA 3.25Å; E61-K81 WeakPolarHBondContact O-CA 3.47Å; T62-K81 HydrophobicContact CG2-CG 4.27Å; T79-K81 HydrophobicContact CG2-CG 4.43Å
82	R	98	Very high	95.8	Very high	148 Å²	148	98.1 Å²	98.1	56%	0.558	47%	0.471	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-151.1	157.3	169.8	63.6	179.5	-178.9	-180	-1	111.5	E61 I84	E61-R82 HydrophobicContact CB-CG 4.17Å; E61-R82 PolarHBondContact N-O 2.88Å; E61-R82 PolarHBondContact O-N 2.92Å; E61-R82 IonicContact OE1-NH2 3.71Å; E61-R82 IonicContact OE2-CZ 3.15Å; E61-R82 IonicContact OE2-NE 2.69Å; E61-R82 PolarHBondContact OE2-NE 2.8Å; E61-R82 IonicContact OE2-NH2 2.75Å; E61-R82 PolarHBondContact OE2-NH2 3.33Å; R82-I84 HydrophobicContact CG-CD1 4.47Å; R82-I84 HydrophobicContact CG-CG1 4.37Å
83	T	98.5	Very high	96	Very high	113 Å²	113	95.4 Å²	95.4	69%	0.693	46%	0.458	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-103.7	134.8	173.9	-52.4	0	0	0	0	110	V59	V59-T83 CarbonylContact O-C 3.59Å; V59-T83 VanDerWaalsContact O-CA 3.23Å; V59-T83 WeakPolarHBondContact O-CA 3.46Å
84	I	98.6	Very high	96.4	Very high	28 Å²	28	87.4 Å²	87.4	14%	0.144	43%	0.429	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.8	120.5	-179.7	-58	164.6	0	0	0	107.9	V59 E61 R82 M86 L87	V59-I84 HydrophobicContact CB-CB 4.37Å; V59-I84 PolarHBondContact N-O 2.67Å; V59-I84 PolarHBondContact O-N 2.96Å; E61-I84 HydrophobicContact CB-CD1 4.33Å; E61-I84 VanDerWaalsContact OE2-CD1 3.26Å; E61-I84 WeakPolarHBondContact OE2-CD1 3.17Å; R82-I84 HydrophobicContact CG-CD1 4.47Å; R82-I84 HydrophobicContact CG-CG1 4.37Å; I84-M86 VanDerWaalsContact C-N 3.34Å; I84-M86 VanDerWaalsContact CG2-O 3.26Å; I84-M86 WeakPolarHBondContact CG2-O 3.09Å; I84-M86 PolarHBondContact O-N 3.05Å; I84-L87 HydrophobicContact CD1-CD1 4.37Å; I84-L87 HydrophobicContact CD1-CD2 4.27Å; I84-L87 HydrophobicContact CG2-CB 4.2Å
85	P	98.4	Very high	96.6	Very high	98 Å²	98	86 Å²	86	64%	0.636	42%	0.424	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-59.3	-41.9	-177.2	-26.8	34.9	0	0	0	113.8	G57 N58	G57-P85 CarbonylContact C-O 3.59Å; G57-P85 WeakPolarHBondContact CA-O 3.18Å; N58-P85 PolarHBondContact N-O 2.93Å
86	M	98.4	Very high	96.9	Very high	110 Å²	110	84 Å²	84	54%	0.542	42%	0.417	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.8	134.1	179.2	-72.3	-64.1	-70.4	0	0	109.9	I55 L56 I84	I55-M86 HydrophobicContact CG2-CE 3.42Å; I55-M86 VanDerWaalsContact CG2-CE 3.42Å; L56-M86 CarbonylContact O-C 3.58Å; L56-M86 WeakPolarHBondContact O-CA 3.3Å; I84-M86 VanDerWaalsContact C-N 3.34Å; I84-M86 VanDerWaalsContact CG2-O 3.26Å; I84-M86 WeakPolarHBondContact CG2-O 3.09Å; I84-M86 PolarHBondContact O-N 3.05Å
87	L	98.5	Very high	97.2	Very high	29 Å²	29	82.3 Å²	82.3	15%	0.152	41%	0.407	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139	124.4	-178.1	-176	64.5	0	0	0	110.8	L41 L56 V59 I84 I89	L41-L87 HydrophobicContact CD1-CD2 4.01Å; L41-L87 HydrophobicContact CD2-CD2 4.05Å; L56-L87 PolarHBondContact N-O 2.84Å; L56-L87 PolarHBondContact O-N 3.49Å; V59-L87 HydrophobicContact CG1-CD2 4.19Å; V59-L87 HydrophobicContact CG2-CB 3.96Å; I84-L87 HydrophobicContact CD1-CD1 4.37Å; I84-L87 HydrophobicContact CD1-CD2 4.27Å; I84-L87 HydrophobicContact CG2-CB 4.2Å; L87-I89 HydrophobicContact CD2-CG1 4.15Å; L87-I89 HydrophobicContact CG-CG1 4.13Å
88	F	98.5	Very high	97.4	Very high	137 Å²	137	76.6 Å²	76.6	60%	0.601	39%	0.39	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.1	131.5	164.8	178	-95.2	0	0	0	109.9	N53 M54 I55	N53-F88 HydrophobicContact CB-CE2 4.11Å; N53-F88 HydrophobicContact CB-CZ 3.93Å; M54-F88 CarbonylContact O-C 3.52Å; M54-F88 WeakPolarHBondContact O-CA 3.21Å; I55-F88 HydrophobicContact CG1-CD2 4.19Å
89	I	98.4	Very high	97	Very high	2 Å²	2	75.3 Å²	75.3	1%	0.01	39%	0.392	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.3	131.7	-178.5	-59.6	171.7	0	0	0	108.4	M35 L41 N53 M54 L56 L87 V94	M35-I89 HydrophobicContact CE-CG2 3.45Å; M35-I89 VanDerWaalsContact CE-CG2 3.45Å; M35-I89 HydrophobicContact SD-CG2 3.75Å; L41-I89 HydrophobicContact CD1-CD1 3.37Å; L41-I89 HydrophobicContact CD1-CG1 3.96Å; N53-I89 CarbonylContact C-O 3.57Å; N53-I89 WeakPolarHBondContact CA-O 3.43Å; M54-I89 HydrophobicContact CB-CB 4.28Å; M54-I89 HydrophobicContact CB-CD1 4.47Å; M54-I89 PolarHBondContact N-O 3.11Å; M54-I89 PolarHBondContact O-N 2.78Å; L56-I89 HydrophobicContact CB-CD1 4.47Å; L56-I89 HydrophobicContact CD1-CD1 3.35Å; L56-I89 HydrophobicContact CG-CD1 3.55Å; L87-I89 HydrophobicContact CD2-CG1 4.15Å; L87-I89 HydrophobicContact CG-CG1 4.13Å; I89-V94 HydrophobicContact CG2-CG2 4.24Å
90	R	98.3	Very high	96.4	Very high	167 Å²	167	73.7 Å²	73.7	63%	0.63	38%	0.383	S	S	*	.			trans	-84.1	129.9	170.5	-172.3	-179.3	173.1	106.6	4.6	110.5	N53 D92 G93	N53-R90 WeakPolarHBondContact OD1-CA 3.48Å; R90-D92 HydrophobicContact CG-CB 4.47Å; R90-D92 IonicContact CZ-OD2 3.05Å; R90-D92 IonicContact NE-OD2 2.83Å; R90-D92 PolarHBondContact NE-OD2 3.42Å; R90-D92 IonicContact NH2-OD2 2.6Å; R90-D92 PolarHBondContact NH2-OD2 2.9Å; R90-D92 PolarHBondContact O-N 3.48Å; R90-G93 PolarHBondContact O-N 2.85Å
91	G	98.1	Very high	95.2	Very high	7 Å²	7	77.1 Å²	77.1	7%	0.072	39%	0.394	C	S	.	.	G	3₁₀ helix	trans	-65.8	-29.5	-173.8	0	0	0	0	0	115.6	H51 L52 N53 G93 V94	H51-G91 VanDerWaalsContact O-CA 3.32Å; H51-G91 WeakPolarHBondContact O-CA 3.45Å; L52-G91 VanDerWaalsContact C-CA 3.45Å; L52-G91 WeakPolarHBondContact O-CA 3.48Å; N53-G91 PolarHBondContact OD1-N 3.24Å; G91-G93 PolarHBondContact O-N 2.85Å; G91-V94 WeakPolarHBondContact O-CB 3.35Å; G91-V94 PolarHBondContact O-N 3.43Å
92	D	97.9	Very high	93.6	Very high	94 Å²	94	80.5 Å²	80.5	50%	0.503	41%	0.408	S	S	.	.	G	3₁₀ helix	trans	-56.7	-23.3	175.6	-65.6	-26.6	0	0	0	114	K36 R90	K36-D92 PolarHBondContact NZ-O 2.86Å; R90-D92 HydrophobicContact CG-CB 4.47Å; R90-D92 IonicContact CZ-OD2 3.05Å; R90-D92 IonicContact NE-OD2 2.83Å; R90-D92 PolarHBondContact NE-OD2 3.42Å; R90-D92 IonicContact NH2-OD2 2.6Å; R90-D92 PolarHBondContact NH2-OD2 2.9Å; R90-D92 PolarHBondContact O-N 3.48Å
93	G	97.2	Very high	91.5	Very high	18 Å²	18	84.3 Å²	84.3	19%	0.186	44%	0.44	C	S	.	.	G	3₁₀ helix	trans	-86.8	-15.2	178.9	0	0	0	0	0	114.2	M35 K36 R90 G91	M35-G93 CarbonylContact C-O 3.46Å; M35-G93 VanDerWaalsContact CA-O 3.31Å; M35-G93 WeakPolarHBondContact CA-O 3.11Å; K36-G93 PolarHBondContact N-O 2.92Å; R90-G93 PolarHBondContact O-N 2.85Å; G91-G93 PolarHBondContact O-N 2.85Å
94	V	98.2	Very high	91.2	Very high	22 Å²	22	82.9 Å²	82.9	13%	0.133	43%	0.427	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-73	131.8	-176.5	179	0	0	0	0	109.3	V33 M35 I89 G91 V97	V33-V94 HydrophobicContact CG1-CG1 4.05Å; V33-V94 HydrophobicContact CG1-CG2 4.17Å; M35-V94 HydrophobicContact CE-CG2 4.43Å; M35-V94 HydrophobicContact SD-CB 4.28Å; M35-V94 HydrophobicContact SD-CG2 3.66Å; I89-V94 HydrophobicContact CG2-CG2 4.24Å; G91-V94 WeakPolarHBondContact O-CB 3.35Å; G91-V94 PolarHBondContact O-N 3.43Å; V94-V97 HydrophobicContact CG1-CG2 3.73Å
95	I	98.1	Very high	90.8	Very high	99 Å²	99	85.8 Å²	85.8	51%	0.508	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.2	-48.6	173.1	-63.7	178.7	0	0	0	109.6	K34 K36	K34-I95 HydrophobicContact CB-CB 4.45Å; K34-I95 HydrophobicContact CG-CB 4.29Å; K34-I95 HydrophobicContact CG-CD1 4.34Å; K34-I95 PolarHBondContact O-N 3.48Å; K36-I95 HydrophobicContact CB-CD1 4.45Å; K36-I95 HydrophobicContact CG-CD1 3.93Å; K36-I95 HydrophobicContact CG-CG1 3.79Å
96	L	96.6	Very high	90.4	Very high	85 Å²	85	85.1 Å²	85.1	45%	0.445	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-151.4	158.1	173.9	68.2	84.3	0	0	0	110.3	Y32 K34	Y32-L96 HydrophobicContact CD1-CD1 4.13Å; Y32-L96 HydrophobicContact CE1-CD1 4Å; K34-L96 HydrophobicContact CB-CD1 4.23Å; K34-L96 HydrophobicContact CB-CD2 4.48Å; K34-L96 HydrophobicContact CB-CG 3.87Å; K34-L96 PolarHBondContact N-O 2.92Å; K34-L96 PolarHBondContact O-N 2.81Å
97	V	97	Very high	89.9	Confident	31 Å²	31	83.6 Å²	83.6	19%	0.188	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.7	127.4	171.6	-176.6	0	0	0	0	106.5	I23 I31 Y32 V33 M54 V94	I23-V97 HydrophobicContact CD1-CB 3.78Å; I23-V97 HydrophobicContact CD1-CG1 3.7Å; I23-V97 HydrophobicContact CD1-CG2 4.24Å; I31-V97 HydrophobicContact CD1-CG1 3.87Å; Y32-V97 CarbonylContact O-C 3.57Å; Y32-V97 WeakPolarHBondContact O-CA 3.35Å; V33-V97 HydrophobicContact CG1-CG2 4.43Å; V33-V97 HydrophobicContact CG2-CG1 4.4Å; V33-V97 HydrophobicContact CG2-CG2 4.45Å; M54-V97 HydrophobicContact CE-CG1 4.49Å; M54-V97 HydrophobicContact CE-CG2 3.62Å; M54-V97 HydrophobicContact SD-CG2 4.44Å; V94-V97 HydrophobicContact CG1-CG2 3.73Å
98	S	95.3	Very high	89.4	Confident	40 Å²	40	87.1 Å²	87.1	28%	0.28	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	127.2	173.9	-176.3	0	0	0	0	108.2	Y32	Y32-S98 PolarHBondContact N-O 3.41Å; Y32-S98 VanDerWaalsContact N-O 3.08Å; Y32-S98 PolarHBondContact O-N 2.79Å
99	P	85.7	Confident	88.8	Confident	72 Å²	72	83.7 Å²	83.7	47%	0.468	43%	0.432	S	S	.	.			trans	-62.6	173	177.2	28.2	-34.9	0	0	0	110.7	Q101	P99-Q101 PolarHBondContact O-N 2.86Å
100	P	81.6	Confident	88.1	Confident	40 Å²	40	89.6 Å²	89.6	26%	0.26	46%	0.462	S	S	.	.			trans	-53.4	129.5	179.4	-24.1	35.3	0	0	0	110.5	E29 K30 K102	E29-P100 HydrophobicContact CB-CB 4.36Å; E29-P100 HydrophobicContact CB-CG 3.32Å; E29-P100 HydrophobicContact CG-CG 3.92Å; K30-P100 VanDerWaalsContact O-CA 3.32Å; K30-P100 WeakPolarHBondContact O-CA 3.42Å; P100-K102 PolarHBondContact O-N 3.26Å; P100-K102 VanDerWaalsContact O-N 3.1Å
101	Q	71.2	Confident	87.3	Confident	144 Å²	144	83.6 Å²	83.6	67%	0.673	45%	0.449	S	S	*	.			trans	-66.7	113.7	169.4	-65.8	-172.7	-43.5	0	0	106	P99 D103	P99-Q101 PolarHBondContact O-N 2.86Å; Q101-D103 PolarHBondContact O-N 3.39Å; Q101-D103 VanDerWaalsContact O-N 3.15Å
102	K	63.3	Low	86.4	Confident	206 Å²	206	90 Å²	90	90%	0.896	48%	0.48	S	S	*	.			trans	-64.9	112.3	162.7	-68.8	-177	-179.8	-177.4	0	105.5	P100	P100-K102 PolarHBondContact O-N 3.26Å; P100-K102 VanDerWaalsContact O-N 3.1Å
103	D	55	Low	85.4	Confident	229 Å²	229	89.6 Å²	89.6	100%	1.225	48%	0.478	S	S	*	.			trans	-58	0	163.2	-72.5	-33.2	0	0	0	110.2	Q101	Q101-D103 PolarHBondContact O-N 3.39Å; Q101-D103 VanDerWaalsContact O-N 3.15Å

Retrieved 103 of 103 residues in 177.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).