G4VA69_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession G4VA69, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 38 aa.

						>G4VA69_SCHMA|G4VA69
MLLTIGVVYVNGNSLYLVKPYLLILEYIMCISVWKFEL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.3	Low	65.5	Low	204 Å²	204	120.3 Å²	120.3	100%	1.005	65%	0.65	S	S	*	*				0	-28.2	0	-82.7	-174.1	163.5	0	114.1	L3 T4	M1-L3 PolarHBondContact O-N 3.36Å; M1-T4 PolarHBondContact O-N 2.94Å; M1-T4 PolarHBondContact O-OG1 2.9Å
2	L	59.5	Low	65.6	Low	157 Å²	157	113.1 Å²	113.1	82%	0.822	63%	0.625	S	S	*	*	H	α-helix	trans	-60.4	-40.5	179.1	-127.3	98.3	0	0	113.9	T4 I5 G6	L2-T4 VanDerWaalsContact C-N 3.28Å; L2-T4 PolarHBondContact O-N 3.41Å; L2-I5 PolarHBondContact O-N 3.28Å; L2-G6 PolarHBondContact O-N 3.24Å
3	L	62.3	Low	66.1	Low	152 Å²	152	110.8 Å²	110.8	80%	0.796	61%	0.611	S	S	*	*	H	α-helix	trans	-60.5	-38	179.1	-70.4	168.4	0	0	112.3	M1 I5 G6 V7	M1-L3 PolarHBondContact O-N 3.36Å; L3-I5 VanDerWaalsContact C-N 3.32Å; L3-I5 PolarHBondContact O-N 3.41Å; L3-G6 PolarHBondContact O-N 3.28Å; L3-V7 WeakPolarHBondContact O-CG2 3.34Å; L3-V7 PolarHBondContact O-N 3.3Å; L3-V7 VanDerWaalsContact O-N 3.12Å
4	T	60.2	Low	66.1	Low	90 Å²	90	107.4 Å²	107.4	55%	0.552	60%	0.599	S	S	*	*	H	α-helix	trans	-65.1	-38.3	-180	-23	0	0	0	111.4	M1 L2 V7 V8	M1-T4 PolarHBondContact O-N 2.94Å; M1-T4 PolarHBondContact O-OG1 2.9Å; L2-T4 VanDerWaalsContact C-N 3.28Å; L2-T4 PolarHBondContact O-N 3.41Å; T4-V7 PolarHBondContact O-N 3.29Å; T4-V8 VanDerWaalsContact O-CG2 3.31Å; T4-V8 WeakPolarHBondContact O-CG2 3.34Å; T4-V8 PolarHBondContact O-N 3.3Å
5	I	68.9	Low	66	Low	118 Å²	118	106.4 Å²	106.4	61%	0.605	59%	0.592	S	S	*	*	H	α-helix	trans	-64.1	-43.2	176.8	-58.8	169.9	0	0	110.2	L2 L3 V8 Y9	L2-I5 PolarHBondContact O-N 3.28Å; L3-I5 VanDerWaalsContact C-N 3.32Å; L3-I5 PolarHBondContact O-N 3.41Å; I5-V8 PolarHBondContact O-N 3.44Å; I5-Y9 WeakPolarHBondContact O-CB 3.4Å; I5-Y9 PolarHBondContact O-N 3.12Å
6	G	69.1	Low	66.1	Low	38 Å²	38	111.7 Å²	111.7	39%	0.392	60%	0.601	S	S	.	*	H	α-helix	trans	-60.5	-46	177.1	0	0	0	0	112.9	L2 L3 Y9 V10	L2-G6 PolarHBondContact O-N 3.24Å; L3-G6 PolarHBondContact O-N 3.28Å; G6-Y9 PolarHBondContact O-N 3.46Å; G6-V10 WeakPolarHBondContact O-CG2 3.31Å; G6-V10 PolarHBondContact O-N 3.06Å
7	V	68.4	Low	66.3	Low	96 Å²	96	111.5 Å²	111.5	58%	0.582	60%	0.599	S	S	*	*	H	α-helix	trans	-64	-44	178.4	177.4	0	0	0	111.5	L3 T4 Y9 V10 N11	L3-V7 WeakPolarHBondContact O-CG2 3.34Å; L3-V7 PolarHBondContact O-N 3.3Å; L3-V7 VanDerWaalsContact O-N 3.12Å; T4-V7 PolarHBondContact O-N 3.29Å; V7-Y9 VanDerWaalsContact C-N 3.32Å; V7-Y9 PolarHBondContact O-N 3.47Å; V7-V10 PolarHBondContact O-N 3.48Å; V7-N11 VanDerWaalsContact O-CB 3.23Å; V7-N11 WeakPolarHBondContact O-CB 3.49Å; V7-N11 PolarHBondContact O-N 2.91Å
8	V	69.4	Low	66.8	Low	101 Å²	101	109.1 Å²	109.1	61%	0.612	59%	0.589	S	S	*	*	H	α-helix	trans	-64.7	-37.9	177.1	175.5	0	0	0	111.1	T4 I5 G12	T4-V8 VanDerWaalsContact O-CG2 3.31Å; T4-V8 WeakPolarHBondContact O-CG2 3.34Å; T4-V8 PolarHBondContact O-N 3.3Å; I5-V8 PolarHBondContact O-N 3.44Å; V8-G12 WeakPolarHBondContact O-CA 3.21Å; V8-G12 PolarHBondContact O-N 2.87Å
9	Y	71.9	Confident	67.4	Low	174 Å²	174	110.8 Å²	110.8	68%	0.682	59%	0.591	S	S	*	*	H	α-helix	trans	-65.9	-45.9	176.8	-171.5	-96.4	0	0	112	I5 G6 V7 N13	I5-Y9 WeakPolarHBondContact O-CB 3.4Å; I5-Y9 PolarHBondContact O-N 3.12Å; G6-Y9 PolarHBondContact O-N 3.46Å; V7-Y9 VanDerWaalsContact C-N 3.32Å; V7-Y9 PolarHBondContact O-N 3.47Å; Y9-N13 WeakPolarHBondContact O-CB 3.43Å; Y9-N13 PolarHBondContact O-N 3.42Å
10	V	68.4	Low	67.9	Low	101 Å²	101	108.3 Å²	108.3	61%	0.612	58%	0.58	S	S	*	*	H	α-helix	trans	-64	-43.9	177.1	173.8	0	0	0	111	G6 V7 N13 S14	G6-V10 WeakPolarHBondContact O-CG2 3.31Å; G6-V10 PolarHBondContact O-N 3.06Å; V7-V10 PolarHBondContact O-N 3.48Å; V10-N13 PolarHBondContact O-N 3.47Å; V10-S14 WeakPolarHBondContact O-CB 3.23Å; V10-S14 PolarHBondContact O-N 3.49Å
11	N	69.7	Low	68.6	Low	92 Å²	92	110 Å²	110	49%	0.492	58%	0.58	S	S	.	*	H	α-helix	trans	-70.3	-42.8	-179.1	-153.8	-13.9	0	0	111.4	V7 N13 S14 L15	V7-N11 VanDerWaalsContact O-CB 3.23Å; V7-N11 WeakPolarHBondContact O-CB 3.49Å; V7-N11 PolarHBondContact O-N 2.91Å; N11-N13 PolarHBondContact O-N 2.76Å; N11-S14 PolarHBondContact O-N 3.22Å; N11-L15 WeakPolarHBondContact O-CB 2.89Å; N11-L15 WeakPolarHBondContact O-CD1 3.16Å; N11-L15 PolarHBondContact O-N 3.37Å
12	G	67.5	Low	70.1	Confident	34 Å²	34	104.8 Å²	104.8	35%	0.351	56%	0.555	S	S	.	*	H	α-helix	trans	-59	-44.8	173.2	0	0	0	0	112.1	V8 L15 Y16	V8-G12 WeakPolarHBondContact O-CA 3.21Å; V8-G12 PolarHBondContact O-N 2.87Å; G12-L15 PolarHBondContact O-N 3.25Å; G12-Y16 VanDerWaalsContact O-CB 3.31Å; G12-Y16 WeakPolarHBondContact O-CB 3.4Å; G12-Y16 PolarHBondContact O-N 2.84Å
13	N	71.2	Confident	71.4	Confident	83 Å²	83	102.8 Å²	102.8	44%	0.444	55%	0.545	S	S	.	.	H	α-helix	trans	-65.3	-42.4	176.6	-168.5	47	0	0	112.2	Y9 V10 N11 Y16 L17	Y9-N13 WeakPolarHBondContact O-CB 3.43Å; Y9-N13 PolarHBondContact O-N 3.42Å; V10-N13 PolarHBondContact O-N 3.47Å; N11-N13 PolarHBondContact O-N 2.76Å; N13-Y16 PolarHBondContact O-N 3.41Å; N13-L17 WeakPolarHBondContact O-CG 3.46Å; N13-L17 PolarHBondContact O-N 2.9Å
14	S	66.3	Low	72.7	Confident	63 Å²	63	100.1 Å²	100.1	44%	0.441	53%	0.531	S	S	.	.	H	α-helix	trans	-59.1	-49.4	174.2	-172.1	0	0	0	111.1	V10 N11 Y16 L17 V18	V10-S14 WeakPolarHBondContact O-CB 3.23Å; V10-S14 PolarHBondContact O-N 3.49Å; N11-S14 PolarHBondContact O-N 3.22Å; S14-Y16 VanDerWaalsContact C-N 3.31Å; S14-Y16 PolarHBondContact O-N 2.89Å; S14-L17 PolarHBondContact O-N 2.94Å; S14-V18 WeakPolarHBondContact O-CB 3.31Å; S14-V18 WeakPolarHBondContact O-CG2 3.37Å; S14-V18 PolarHBondContact O-N 3.01Å
15	L	65.4	Low	74	Confident	93 Å²	93	98.6 Å²	98.6	49%	0.487	52%	0.519	S	S	.	.	H	α-helix	trans	-60.6	-38.3	175.5	-82.4	153.6	0	0	112.8	N11 G12 L17 V18 K19	N11-L15 WeakPolarHBondContact O-CB 2.89Å; N11-L15 WeakPolarHBondContact O-CD1 3.16Å; N11-L15 PolarHBondContact O-N 3.37Å; G12-L15 PolarHBondContact O-N 3.25Å; L15-L17 VanDerWaalsContact C-N 3.31Å; L15-L17 PolarHBondContact O-N 3.31Å; L15-V18 PolarHBondContact O-N 3.41Å; L15-K19 WeakPolarHBondContact O-CG 3.22Å; L15-K19 PolarHBondContact O-N 3.31Å; L15-K19 VanDerWaalsContact O-N 3.17Å
16	Y	67.7	Low	75	Confident	191 Å²	191	99 Å²	99	75%	0.749	52%	0.518	S	S	*	.	H	α-helix	trans	-70.2	-27.5	179.8	-143.3	-88.9	0	0	112.7	G12 N13 S14 P20	G12-Y16 VanDerWaalsContact O-CB 3.31Å; G12-Y16 WeakPolarHBondContact O-CB 3.4Å; G12-Y16 PolarHBondContact O-N 2.84Å; N13-Y16 PolarHBondContact O-N 3.41Å; S14-Y16 VanDerWaalsContact C-N 3.31Å; S14-Y16 PolarHBondContact O-N 2.89Å; Y16-P20 WeakPolarHBondContact O-CD 3.16Å; Y16-P20 WeakPolarHBondContact O-CG 3.43Å
17	L	68.6	Low	76.1	Confident	108 Å²	108	104.8 Å²	104.8	57%	0.565	53%	0.529	S	S	*	.	H	α-helix	trans	-84.6	-35.8	174.1	-69.4	168.9	0	0	111.9	N13 S14 L15 P20 Y21	N13-L17 WeakPolarHBondContact O-CG 3.46Å; N13-L17 PolarHBondContact O-N 2.9Å; S14-L17 PolarHBondContact O-N 2.94Å; L15-L17 VanDerWaalsContact C-N 3.31Å; L15-L17 PolarHBondContact O-N 3.31Å; L17-P20 WeakPolarHBondContact O-CD 3.38Å; L17-P20 WeakPolarHBondContact O-CG 3.4Å; L17-Y21 WeakPolarHBondContact O-CB 3.45Å; L17-Y21 PolarHBondContact O-N 3.17Å
18	V	75	Confident	77.2	Confident	68 Å²	68	104.3 Å²	104.3	41%	0.412	52%	0.523	S	S	.	.	H	α-helix	trans	-68.5	-42.1	-178.2	170.1	0	0	0	112	S14 L15 Y21 L22	S14-V18 WeakPolarHBondContact O-CB 3.31Å; S14-V18 WeakPolarHBondContact O-CG2 3.37Å; S14-V18 PolarHBondContact O-N 3.01Å; L15-V18 PolarHBondContact O-N 3.41Å; V18-Y21 PolarHBondContact O-N 2.93Å; V18-L22 HydrophobicContact CG1-CD1 3.77Å; V18-L22 HydrophobicContact CG1-CG 4.23Å; V18-L22 WeakPolarHBondContact O-CG 3.43Å; V18-L22 PolarHBondContact O-N 3.31Å
19	K	78.7	Confident	78.1	Confident	143 Å²	143	105.3 Å²	105.3	62%	0.622	52%	0.522	S	S	*	.	H	α-helix	trans	-57.9	-55	179.7	-75	-179.7	179.4	-176.5	114.2	L15 Y21 L22 L23	L15-K19 WeakPolarHBondContact O-CG 3.22Å; L15-K19 PolarHBondContact O-N 3.31Å; L15-K19 VanDerWaalsContact O-N 3.17Å; K19-Y21 VanDerWaalsContact C-N 3.27Å; K19-Y21 PolarHBondContact O-N 3.46Å; K19-L22 PolarHBondContact O-N 2.99Å; K19-L23 PolarHBondContact O-N 3.4Å
20	P	76.5	Confident	78.9	Confident	59 Å²	59	101.1 Å²	101.1	38%	0.383	52%	0.517	S	S	.	.	H	α-helix	trans	-65.1	-33.1	177.9	25.5	-33.4	0	0	111.7	Y16 L17 L23 I24	Y16-P20 WeakPolarHBondContact O-CD 3.16Å; Y16-P20 WeakPolarHBondContact O-CG 3.43Å; L17-P20 WeakPolarHBondContact O-CD 3.38Å; L17-P20 WeakPolarHBondContact O-CG 3.4Å; P20-L23 PolarHBondContact O-N 3.36Å; P20-I24 WeakPolarHBondContact O-CD1 3.36Å; P20-I24 VanDerWaalsContact O-CG1 3.22Å; P20-I24 WeakPolarHBondContact O-CG1 3.32Å; P20-I24 PolarHBondContact O-N 3.19Å
21	Y	83.6	Confident	79.9	Confident	145 Å²	145	99.6 Å²	99.6	57%	0.569	51%	0.505	S	S	*	.	H	α-helix	trans	-63.5	-42.8	176.4	-173.3	-102.1	0	0	112.6	L17 V18 K19 I24 L25	L17-Y21 WeakPolarHBondContact O-CB 3.45Å; L17-Y21 PolarHBondContact O-N 3.17Å; V18-Y21 PolarHBondContact O-N 2.93Å; K19-Y21 VanDerWaalsContact C-N 3.27Å; K19-Y21 PolarHBondContact O-N 3.46Å; Y21-I24 PolarHBondContact O-N 3.01Å; Y21-L25 HydrophobicContact CD1-CD1 3.81Å; Y21-L25 HydrophobicContact CD1-CG 4.44Å; Y21-L25 HydrophobicContact CE1-CD1 3.36Å; Y21-L25 HydrophobicContact CE1-CG 4.08Å; Y21-L25 PolarHBondContact O-N 3Å
22	L	83.4	Confident	80.6	Confident	94 Å²	94	97.8 Å²	97.8	49%	0.492	50%	0.499	S	S	.	.	H	α-helix	trans	-62.5	-44.7	175.3	-75.3	169.2	0	0	112.1	V18 K19 I24 L25 E26	V18-L22 HydrophobicContact CG1-CD1 3.77Å; V18-L22 HydrophobicContact CG1-CG 4.23Å; V18-L22 WeakPolarHBondContact O-CG 3.43Å; V18-L22 PolarHBondContact O-N 3.31Å; K19-L22 PolarHBondContact O-N 2.99Å; L22-I24 VanDerWaalsContact C-N 3.31Å; L22-I24 PolarHBondContact O-N 3.41Å; L22-L25 PolarHBondContact O-N 2.95Å; L22-E26 PolarHBondContact O-N 3Å
23	L	86.3	Confident	81.1	Confident	116 Å²	116	100.5 Å²	100.5	61%	0.607	51%	0.509	S	S	*	.	H	α-helix	trans	-60.6	-40.8	176.3	-74	169.5	0	0	112.1	K19 P20 L25 E26 Y27	K19-L23 PolarHBondContact O-N 3.4Å; P20-L23 PolarHBondContact O-N 3.36Å; L23-L25 VanDerWaalsContact C-N 3.35Å; L23-E26 PolarHBondContact O-N 3.4Å; L23-Y27 WeakPolarHBondContact O-CB 3.4Å; L23-Y27 PolarHBondContact O-N 3.17Å
24	I	91.2	Very high	80.8	Confident	96 Å²	96	105 Å²	105	49%	0.492	52%	0.52	S	S	.	.	H	α-helix	trans	-63.2	-42.6	176.1	-70.1	163.8	0	0	110.6	P20 Y21 L22 Y27 I28	P20-I24 WeakPolarHBondContact O-CD1 3.36Å; P20-I24 VanDerWaalsContact O-CG1 3.22Å; P20-I24 WeakPolarHBondContact O-CG1 3.32Å; P20-I24 PolarHBondContact O-N 3.19Å; Y21-I24 PolarHBondContact O-N 3.01Å; L22-I24 VanDerWaalsContact C-N 3.31Å; L22-I24 PolarHBondContact O-N 3.41Å; I24-Y27 PolarHBondContact O-N 3.34Å; I24-I28 HydrophobicContact CG2-CD1 3.83Å; I24-I28 VanDerWaalsContact O-CG1 3.28Å; I24-I28 WeakPolarHBondContact O-CG1 3.42Å; I24-I28 PolarHBondContact O-N 3.48Å
25	L	87.2	Confident	81	Confident	58 Å²	58	109.8 Å²	109.8	30%	0.304	53%	0.533	S	S	.	.	H	α-helix	trans	-64.1	-45.4	177.5	-78.8	173.7	0	0	112.7	Y21 L22 L23 Y27 I28 M29	Y21-L25 HydrophobicContact CD1-CD1 3.81Å; Y21-L25 HydrophobicContact CD1-CG 4.44Å; Y21-L25 HydrophobicContact CE1-CD1 3.36Å; Y21-L25 HydrophobicContact CE1-CG 4.08Å; Y21-L25 PolarHBondContact O-N 3Å; L22-L25 PolarHBondContact O-N 2.95Å; L23-L25 VanDerWaalsContact C-N 3.35Å; L25-Y27 VanDerWaalsContact C-N 3.3Å; L25-Y27 PolarHBondContact O-N 3.49Å; L25-I28 PolarHBondContact O-N 3.25Å; L25-M29 WeakPolarHBondContact O-CG 3.47Å; L25-M29 PolarHBondContact O-N 3.45Å
26	E	89	Confident	80.7	Confident	127 Å²	127	114 Å²	114	59%	0.593	55%	0.547	S	S	*	.	H	α-helix	trans	-59.9	-42.6	176	-74.2	-177.5	158.8	0	111.3	L22 L23 I28 M29 C30	L22-E26 PolarHBondContact O-N 3Å; L23-E26 PolarHBondContact O-N 3.4Å; E26-I28 PolarHBondContact O-N 3.36Å; E26-M29 PolarHBondContact O-N 2.99Å; E26-C30 VanDerWaalsContact O-CB 3.26Å; E26-C30 WeakPolarHBondContact O-CB 3.28Å; E26-C30 PolarHBondContact O-N 3.48Å
27	Y	91.8	Very high	80.3	Confident	159 Å²	159	112.9 Å²	112.9	62%	0.624	55%	0.549	S	S	*	.	H	α-helix	trans	-60.3	-44.5	175.6	179.8	-108.5	0	0	112.3	L23 I24 L25 C30 I31	L23-Y27 WeakPolarHBondContact O-CB 3.4Å; L23-Y27 PolarHBondContact O-N 3.17Å; I24-Y27 PolarHBondContact O-N 3.34Å; L25-Y27 VanDerWaalsContact C-N 3.3Å; L25-Y27 PolarHBondContact O-N 3.49Å; Y27-C30 PolarHBondContact O-N 3.48Å; Y27-I31 HydrophobicContact CD1-CD1 3.69Å; Y27-I31 HydrophobicContact CD2-CD1 4.27Å; Y27-I31 HydrophobicContact CE1-CD1 3.21Å; Y27-I31 HydrophobicContact CE1-CG1 4.44Å; Y27-I31 HydrophobicContact CE2-CD1 3.84Å; Y27-I31 HydrophobicContact CE2-CG1 4.33Å; Y27-I31 HydrophobicContact CG-CD1 4.2Å; Y27-I31 WeakPolarHBondContact O-CG1 3.35Å; Y27-I31 PolarHBondContact O-N 2.75Å
28	I	92.5	Very high	79.5	Confident	86 Å²	86	116.6 Å²	116.6	44%	0.441	57%	0.568	S	S	.	*	H	α-helix	trans	-64.3	-43.5	177.4	-68.8	165.6	0	0	111.2	I24 L25 E26 I31 S32	I24-I28 HydrophobicContact CG2-CD1 3.83Å; I24-I28 VanDerWaalsContact O-CG1 3.28Å; I24-I28 WeakPolarHBondContact O-CG1 3.42Å; I24-I28 PolarHBondContact O-N 3.48Å; L25-I28 PolarHBondContact O-N 3.25Å; E26-I28 PolarHBondContact O-N 3.36Å; I28-I31 PolarHBondContact O-N 2.94Å; I28-S32 WeakPolarHBondContact O-CB 3.26Å; I28-S32 PolarHBondContact O-N 3.3Å; I28-S32 PolarHBondContact O-OG 2.93Å
29	M	87.3	Confident	79.7	Confident	122 Å²	122	119.1 Å²	119.1	60%	0.601	58%	0.576	S	S	*	*	H	α-helix	trans	-63.4	-43.7	176.1	-71.2	-166	-135.3	0	111.3	L25 E26 I31 S32 V33	L25-M29 WeakPolarHBondContact O-CG 3.47Å; L25-M29 PolarHBondContact O-N 3.45Å; E26-M29 PolarHBondContact O-N 2.99Å; M29-I31 PolarHBondContact O-N 2.89Å; M29-S32 PolarHBondContact O-N 3.28Å; M29-S32 VanDerWaalsContact O-N 3.17Å; M29-V33 WeakPolarHBondContact O-CG2 3.37Å; M29-V33 PolarHBondContact O-N 2.85Å
30	C	89.6	Confident	79.8	Confident	85 Å²	85	117.8 Å²	117.8	57%	0.574	57%	0.574	S	S	*	*	H	α-helix	trans	-57.8	-49.1	177.3	-175.7	0	0	0	111.6	E26 Y27 S32 V33 W34	E26-C30 VanDerWaalsContact O-CB 3.26Å; E26-C30 WeakPolarHBondContact O-CB 3.28Å; E26-C30 PolarHBondContact O-N 3.48Å; Y27-C30 PolarHBondContact O-N 3.48Å; C30-S32 VanDerWaalsContact C-N 3.31Å; C30-S32 PolarHBondContact O-N 3.36Å; C30-V33 PolarHBondContact O-N 3.34Å; C30-W34 WeakPolarHBondContact O-CB 3.4Å; C30-W34 PolarHBondContact O-N 3.43Å
31	I	88.8	Confident	80	Confident	69 Å²	69	121.1 Å²	121.1	35%	0.354	58%	0.584	S	S	.	*	H	α-helix	trans	-62.4	-40.7	176.1	-67.6	163	0	0	111.4	Y27 I28 M29 W34 K35	Y27-I31 HydrophobicContact CD1-CD1 3.69Å; Y27-I31 HydrophobicContact CD2-CD1 4.27Å; Y27-I31 HydrophobicContact CE1-CD1 3.21Å; Y27-I31 HydrophobicContact CE1-CG1 4.44Å; Y27-I31 HydrophobicContact CE2-CD1 3.84Å; Y27-I31 HydrophobicContact CE2-CG1 4.33Å; Y27-I31 HydrophobicContact CG-CD1 4.2Å; Y27-I31 WeakPolarHBondContact O-CG1 3.35Å; Y27-I31 PolarHBondContact O-N 2.75Å; I28-I31 PolarHBondContact O-N 2.94Å; M29-I31 PolarHBondContact O-N 2.89Å; I31-W34 PolarHBondContact O-N 3.17Å; I31-K35 WeakPolarHBondContact O-CB 3.34Å; I31-K35 PolarHBondContact O-N 2.9Å
32	S	84	Confident	79.7	Confident	54 Å²	54	119.6 Å²	119.6	38%	0.378	59%	0.585	S	S	.	*	H	α-helix	trans	-62.9	-48.6	-179.1	-59.7	0	0	0	110.7	I28 M29 C30 W34 K35 F36	I28-S32 WeakPolarHBondContact O-CB 3.26Å; I28-S32 PolarHBondContact O-N 3.3Å; I28-S32 PolarHBondContact O-OG 2.93Å; M29-S32 PolarHBondContact O-N 3.28Å; M29-S32 VanDerWaalsContact O-N 3.17Å; C30-S32 VanDerWaalsContact C-N 3.31Å; C30-S32 PolarHBondContact O-N 3.36Å; S32-W34 VanDerWaalsContact C-N 3.35Å; S32-W34 PolarHBondContact O-N 3.44Å; S32-K35 PolarHBondContact O-N 3.18Å; S32-F36 WeakPolarHBondContact O-CD2 3.05Å; S32-F36 PolarHBondContact O-N 3.48Å
33	V	78.1	Confident	79.5	Confident	91 Å²	91	121.3 Å²	121.3	55%	0.552	59%	0.591	S	S	*	*	H	α-helix	trans	-60.4	-45.9	175.7	174.5	0	0	0	110.6	M29 C30 K35 F36 E37	M29-V33 WeakPolarHBondContact O-CG2 3.37Å; M29-V33 PolarHBondContact O-N 2.85Å; C30-V33 PolarHBondContact O-N 3.34Å; V33-K35 VanDerWaalsContact C-N 3.26Å; V33-K35 PolarHBondContact O-N 3.03Å; V33-F36 PolarHBondContact O-N 2.95Å; V33-E37 PolarHBondContact O-N 3.01Å
34	W	66.8	Low	79.1	Confident	178 Å²	178	121.6 Å²	121.6	67%	0.674	59%	0.59	S	S	*	*	H	α-helix	trans	-62.5	-34.3	-179.7	-168.2	51.1	0	0	112.8	C30 I31 S32 F36	C30-W34 WeakPolarHBondContact O-CB 3.4Å; C30-W34 PolarHBondContact O-N 3.43Å; I31-W34 PolarHBondContact O-N 3.17Å; S32-W34 VanDerWaalsContact C-N 3.35Å; S32-W34 PolarHBondContact O-N 3.44Å; W34-F36 VanDerWaalsContact C-N 3.33Å
35	K	68.5	Low	78.2	Confident	164 Å²	164	123.4 Å²	123.4	71%	0.713	60%	0.597	S	S	*	*	H	α-helix	trans	-71	-25.3	174.4	-174.7	175.9	176.3	-177.3	113.3	I31 S32 V33	I31-K35 WeakPolarHBondContact O-CB 3.34Å; I31-K35 PolarHBondContact O-N 2.9Å; S32-K35 PolarHBondContact O-N 3.18Å; V33-K35 VanDerWaalsContact C-N 3.26Å; V33-K35 PolarHBondContact O-N 3.03Å
36	F	59	Low	77.5	Confident	182 Å²	182	128.5 Å²	128.5	80%	0.798	62%	0.62	S	S	*	*	H	α-helix	trans	-88.6	-20.1	176.9	-77.6	-69.3	0	0	113.4	S32 V33 W34 L38	S32-F36 WeakPolarHBondContact O-CD2 3.05Å; S32-F36 PolarHBondContact O-N 3.48Å; V33-F36 PolarHBondContact O-N 2.95Å; W34-F36 VanDerWaalsContact C-N 3.33Å; F36-L38 VanDerWaalsContact C-N 3.32Å
37	E	59.7	Low	76.5	Confident	167 Å²	167	128.6 Å²	128.6	78%	0.78	62%	0.622	S	S	*	*	H	α-helix	trans	-79.9	-15.7	175.6	-162.9	167.8	118.5	0	112.9	V33	V33-E37 PolarHBondContact O-N 3.01Å
38	L	52.4	Low	75.2	Confident	186 Å²	186	125.8 Å²	125.8	97%	0.974	62%	0.622	S	S	*	*			trans	-104.5	0	-177.3	-150.6	143	0	0	111.8	F36	F36-L38 VanDerWaalsContact C-N 3.32Å

Retrieved 38 of 38 residues in 12.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).