G4VAC5_SCHMA Loading...

UBA domain-containing protein

AlphaFold DB , UniProt , Accession G4VAC5, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 123 aa.

						>G4VAC5_SCHMA|G4VAC5
MRGGMNDTKMKANKRGKENPNLQIETKIIEIKLNFQSRLFDECEKLVEYGFTIEKAIEECKRAEYESRLSEELKSIRDQSASEFEGYKIQMERIFENKRGRLKSSANFGDEDASDRCFRLLLA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.5	Very low	56.4	Low	249 Å²	249	160.9 Å²	160.9	100%	1.227	85%	0.851	S	S	*	*				0	92.4	0	-66.5	-178	178.9	0	0	108.7
2	R	51.2	Low	56.4	Low	254 Å²	254	153.6 Å²	153.6	96%	0.958	83%	0.83	S	S	*	*			trans	-156.2	102.4	-175	-172.6	-176.5	-95.8	-132	1	108
3	G	53.9	Low	56.3	Low	90 Å²	90	153.5 Å²	153.5	93%	0.928	83%	0.829	S	S	*	*			trans	162.7	72.8	179	0	0	0	0	0	113.3
4	G	57.4	Low	56.3	Low	75 Å²	75	156.3 Å²	156.3	77%	0.773	83%	0.829	S	S	*	*			trans	-150.7	24.3	-177.8	0	0	0	0	0	115.6
5	M	61.7	Low	56.2	Low	166 Å²	166	161.6 Å²	161.6	82%	0.818	83%	0.834	S	S	*	*			trans	-123.6	16.2	-172.2	-81.5	171.6	80.8	0	0	115.5
6	N	61.5	Low	56.3	Low	137 Å²	137	156.1 Å²	156.1	73%	0.733	83%	0.828	S	S	*	*	S	Bend	trans	-104.7	-14.5	-173.1	-64.9	-7.2	0	0	0	115.1
7	D	57.9	Low	56.7	Low	136 Å²	136	158.9 Å²	158.9	73%	0.727	83%	0.832	S	S	*	*	S	Bend	trans	-85.5	-22	-173.1	-68.8	-28.5	0	0	0	114.3	K9	D7-K9 PolarHBondContact O-N 3.48Å
8	T	58.4	Low	57.1	Low	123 Å²	123	157.8 Å²	157.8	76%	0.755	82%	0.822	S	S	*	*	G	3₁₀ helix	trans	-78.9	-20.1	-175.1	-19.4	0	0	0	0	113.1
9	K	56.2	Low	58	Low	191 Å²	191	154.1 Å²	154.1	83%	0.83	80%	0.803	S	S	*	*	G	3₁₀ helix	trans	-84.5	-13.7	179.2	-79.2	-172.8	176.3	-178.6	0	114.6	D7	D7-K9 PolarHBondContact O-N 3.48Å
10	M	57.3	Low	59.2	Low	156 Å²	156	150.9 Å²	150.9	77%	0.768	79%	0.792	S	S	*	*	G	3₁₀ helix	trans	-82.6	-9.8	177.9	-77	-153.6	-148.8	0	0	114.8
11	K	56.1	Low	60.5	Low	193 Å²	193	147.7 Å²	147.7	84%	0.839	78%	0.776	S	S	*	*	G	3₁₀ helix	trans	-87.7	-3.3	-175.7	-72.2	-169	177.1	-179.8	0	115.5
12	A	55.9	Low	62.4	Low	73 Å²	73	140.3 Å²	140.3	60%	0.603	74%	0.741	S	S	*	*	G	3₁₀ helix	trans	-90.9	-11.5	-176.5	0	0	0	0	0	115.2
13	N	55.1	Low	64.1	Low	153 Å²	153	133 Å²	133	82%	0.818	72%	0.718	S	S	*	*	S	Bend	trans	-102.8	32.1	-166.9	-159.2	19.8	0	0	0	115.8
14	K	56.8	Low	65.9	Low	192 Å²	192	133.5 Å²	133.5	84%	0.835	70%	0.698	S	S	*	*			trans	-121.5	10.7	-178.9	-69.7	-168.3	180	-178.7	0	115.6
15	R	54.7	Low	67.6	Low	236 Å²	236	134.1 Å²	134.1	89%	0.891	68%	0.681	S	S	*	*			trans	-96.9	20.2	-175.4	-75.5	-167.9	-77.5	-152.8	-1.7	115.5
16	G	57.1	Low	69.1	Low	73 Å²	73	129.7 Å²	129.7	75%	0.753	66%	0.663	S	S	*	*			trans	-118.2	11	-171.9	0	0	0	0	0	117
17	K	63.5	Low	70.7	Confident	205 Å²	205	129.7 Å²	129.7	89%	0.891	66%	0.657	S	S	*	*			trans	-104.1	98.5	174	-69.1	-170.9	178.5	-173.4	0	108.5	N19	K17-N19 PolarHBondContact O-N 2.79Å
18	E	64.4	Low	72.5	Confident	139 Å²	139	127 Å²	127	65%	0.65	64%	0.642	S	S	*	*			trans	-49	135.5	164.7	-70.8	171.8	173.2	0	0	108.9	Q23	E18-Q23 HydrophobicContact CB-CG 4.21Å; E18-Q23 PolarHBondContact OE2-NE2 2.92Å
19	N	74	Confident	74.2	Confident	87 Å²	87	125.7 Å²	125.7	47%	0.465	63%	0.629	S	S	.	*			trans	-59.3	122.1	178.9	-177	-20.9	0	0	0	107.8	K17 N21 L22 Q23	K17-N19 PolarHBondContact O-N 2.79Å; N19-N21 PolarHBondContact O-N 2.93Å; N19-N21 WeakPolarHBondContact OD1-CB 3.35Å; N19-N21 PolarHBondContact OD1-N 3.09Å; N19-N21 VanDerWaalsContact OD1-N 3.09Å; N19-L22 HydrophobicContact CB-CB 4.33Å; N19-L22 HydrophobicContact CB-CD1 3.87Å; N19-L22 HydrophobicContact CB-CG 3.98Å; N19-L22 WeakPolarHBondContact O-CA 3.31Å; N19-L22 WeakPolarHBondContact O-CB 3.49Å; N19-L22 PolarHBondContact O-N 3.41Å; N19-Q23 PolarHBondContact O-N 3.27Å
20	P	82.3	Confident	76.1	Confident	90 Å²	90	122.2 Å²	122.2	58%	0.584	62%	0.615	S	S	*	*	H	α-helix	trans	-55.3	-27.5	-178.5	21.2	-33.1	0	0	0	112.5	Q23 I24	P20-Q23 PolarHBondContact O-N 3.42Å; P20-I24 VanDerWaalsContact O-CG1 3.31Å; P20-I24 WeakPolarHBondContact O-CG1 3.36Å; P20-I24 PolarHBondContact O-N 2.83Å; P20-I24 VanDerWaalsContact O-N 3.13Å
21	N	86.3	Confident	78	Confident	84 Å²	84	119.8 Å²	119.8	45%	0.449	60%	0.604	S	S	.	*	H	α-helix	trans	-65	-40.4	173.2	-166.6	57	0	0	0	112.7	N19 Q23 I24 E25	N19-N21 PolarHBondContact O-N 2.93Å; N19-N21 WeakPolarHBondContact OD1-CB 3.35Å; N19-N21 PolarHBondContact OD1-N 3.09Å; N19-N21 VanDerWaalsContact OD1-N 3.09Å; N21-Q23 VanDerWaalsContact C-N 3.35Å; N21-Q23 PolarHBondContact O-N 3.29Å; N21-I24 PolarHBondContact O-N 3.48Å; N21-E25 PolarHBondContact ND2-OE1 3.13Å; N21-E25 WeakPolarHBondContact O-CG 3.47Å; N21-E25 PolarHBondContact O-N 3.02Å
22	L	87.9	Confident	79.9	Confident	93 Å²	93	116.9 Å²	116.9	49%	0.487	59%	0.592	S	S	.	*	H	α-helix	trans	-64.4	-39.5	175.7	-70.8	172.4	0	0	0	111.5	N19 I24 E25 T26	N19-L22 HydrophobicContact CB-CB 4.33Å; N19-L22 HydrophobicContact CB-CD1 3.87Å; N19-L22 HydrophobicContact CB-CG 3.98Å; N19-L22 WeakPolarHBondContact O-CA 3.31Å; N19-L22 WeakPolarHBondContact O-CB 3.49Å; N19-L22 PolarHBondContact O-N 3.41Å; L22-I24 VanDerWaalsContact C-N 3.33Å; L22-I24 PolarHBondContact O-N 3.41Å; L22-E25 PolarHBondContact O-N 3.33Å; L22-T26 WeakPolarHBondContact O-CB 3.37Å; L22-T26 PolarHBondContact O-N 2.99Å; L22-T26 PolarHBondContact O-OG1 2.89Å
23	Q	87.8	Confident	81.9	Confident	102 Å²	102	118.1 Å²	118.1	48%	0.477	59%	0.588	S	S	.	*	H	α-helix	trans	-63.9	-39.7	176.6	-68.2	-173.5	-2.3	0	0	112	E18 N19 P20 N21 K27	E18-Q23 HydrophobicContact CB-CG 4.21Å; E18-Q23 PolarHBondContact OE2-NE2 2.92Å; N19-Q23 PolarHBondContact O-N 3.27Å; P20-Q23 PolarHBondContact O-N 3.42Å; N21-Q23 VanDerWaalsContact C-N 3.35Å; N21-Q23 PolarHBondContact O-N 3.29Å; Q23-K27 WeakPolarHBondContact O-CB 3.31Å; Q23-K27 PolarHBondContact O-N 2.94Å
24	I	92.1	Very high	83.9	Confident	99 Å²	99	115.5 Å²	115.5	51%	0.508	57%	0.574	S	S	.	*	H	α-helix	trans	-64.7	-46.7	175.2	-67.6	165.2	0	0	0	110.3	P20 N21 L22 K27 I28	P20-I24 VanDerWaalsContact O-CG1 3.31Å; P20-I24 WeakPolarHBondContact O-CG1 3.36Å; P20-I24 PolarHBondContact O-N 2.83Å; P20-I24 VanDerWaalsContact O-N 3.13Å; N21-I24 PolarHBondContact O-N 3.48Å; L22-I24 VanDerWaalsContact C-N 3.33Å; L22-I24 PolarHBondContact O-N 3.41Å; I24-K27 PolarHBondContact O-N 3.23Å; I24-I28 HydrophobicContact CG2-CD1 3.78Å; I24-I28 HydrophobicContact CG2-CG1 4.42Å; I24-I28 VanDerWaalsContact O-CG1 3.3Å; I24-I28 WeakPolarHBondContact O-CG1 3.48Å; I24-I28 PolarHBondContact O-N 3.05Å
25	E	92.8	Very high	85.8	Confident	88 Å²	88	112.3 Å²	112.3	41%	0.411	56%	0.56	S	S	.	*	H	α-helix	trans	-59.4	-46.8	177.6	-74.9	172	-170.2	0	0	111.9	N21 L22 K27 I28 I29	N21-E25 PolarHBondContact ND2-OE1 3.13Å; N21-E25 WeakPolarHBondContact O-CG 3.47Å; N21-E25 PolarHBondContact O-N 3.02Å; L22-E25 PolarHBondContact O-N 3.33Å; E25-K27 VanDerWaalsContact C-N 3.35Å; E25-K27 PolarHBondContact O-N 3.27Å; E25-I28 PolarHBondContact O-N 2.89Å; E25-I29 VanDerWaalsContact O-CG1 3.31Å; E25-I29 WeakPolarHBondContact O-CG1 3.39Å; E25-I29 PolarHBondContact O-N 3.18Å
26	T	92.3	Very high	87.8	Confident	74 Å²	74	106 Å²	106	45%	0.454	54%	0.541	S	S	.	.	H	α-helix	trans	-57.8	-46.7	175.4	-59.4	0	0	0	0	111.3	L22 I28 I29 E30	L22-T26 WeakPolarHBondContact O-CB 3.37Å; L22-T26 PolarHBondContact O-N 2.99Å; L22-T26 PolarHBondContact O-OG1 2.89Å; T26-I28 VanDerWaalsContact C-N 3.34Å; T26-I28 PolarHBondContact O-N 2.85Å; T26-I29 WeakPolarHBondContact O-CB 3.42Å; T26-I29 PolarHBondContact O-N 3.43Å; T26-I29 VanDerWaalsContact O-N 3.15Å; T26-E30 WeakPolarHBondContact O-CG 3.3Å; T26-E30 PolarHBondContact O-N 3.47Å
27	K	94.7	Very high	89.7	Confident	136 Å²	136	105 Å²	105	59%	0.591	52%	0.522	S	S	*	.	H	α-helix	trans	-64.1	-37.4	178.8	-170.2	171.4	-175.5	174.7	0	112.7	Q23 I24 E25 I29 E30 I31	Q23-K27 WeakPolarHBondContact O-CB 3.31Å; Q23-K27 PolarHBondContact O-N 2.94Å; I24-K27 PolarHBondContact O-N 3.23Å; E25-K27 VanDerWaalsContact C-N 3.35Å; E25-K27 PolarHBondContact O-N 3.27Å; K27-I29 VanDerWaalsContact C-N 3.34Å; K27-E30 PolarHBondContact O-N 3.15Å; K27-I31 HydrophobicContact CG-CD1 4.29Å; K27-I31 WeakPolarHBondContact O-CD1 3.42Å; K27-I31 VanDerWaalsContact O-CG1 3.27Å; K27-I31 WeakPolarHBondContact O-CG1 3.5Å; K27-I31 PolarHBondContact O-N 3.43Å; K27-I31 VanDerWaalsContact O-N 3.07Å
28	I	95.8	Very high	91.3	Very high	81 Å²	81	102 Å²	102	42%	0.415	51%	0.506	S	S	.	.	H	α-helix	trans	-64.1	-42.4	174.1	-70.5	167.6	0	0	0	110.3	I24 E25 T26 I31 K32	I24-I28 HydrophobicContact CG2-CD1 3.78Å; I24-I28 HydrophobicContact CG2-CG1 4.42Å; I24-I28 VanDerWaalsContact O-CG1 3.3Å; I24-I28 WeakPolarHBondContact O-CG1 3.48Å; I24-I28 PolarHBondContact O-N 3.05Å; E25-I28 PolarHBondContact O-N 2.89Å; T26-I28 VanDerWaalsContact C-N 3.34Å; T26-I28 PolarHBondContact O-N 2.85Å; I28-I31 PolarHBondContact O-N 3.02Å; I28-K32 HydrophobicContact CG2-CD 4.31Å; I28-K32 WeakPolarHBondContact O-CG 3.37Å; I28-K32 PolarHBondContact O-N 2.88Å
29	I	96	Very high	92.9	Very high	95 Å²	95	98.8 Å²	98.8	49%	0.487	49%	0.493	S	S	.	.	H	α-helix	trans	-63	-46.4	177.2	-68.5	165.1	0	0	0	110.5	E25 T26 K27 I31 K32 L33	E25-I29 VanDerWaalsContact O-CG1 3.31Å; E25-I29 WeakPolarHBondContact O-CG1 3.39Å; E25-I29 PolarHBondContact O-N 3.18Å; T26-I29 WeakPolarHBondContact O-CB 3.42Å; T26-I29 PolarHBondContact O-N 3.43Å; T26-I29 VanDerWaalsContact O-N 3.15Å; K27-I29 VanDerWaalsContact C-N 3.34Å; I29-I31 VanDerWaalsContact C-N 3.34Å; I29-I31 PolarHBondContact O-N 3.48Å; I29-K32 PolarHBondContact O-N 3.35Å; I29-L33 HydrophobicContact CG2-CD1 3.83Å; I29-L33 HydrophobicContact CG2-CG 4.24Å; I29-L33 WeakPolarHBondContact O-CG 3.44Å; I29-L33 PolarHBondContact O-N 2.93Å
30	E	95.9	Very high	94	Very high	117 Å²	117	101.8 Å²	101.8	55%	0.547	50%	0.502	S	S	.	.	H	α-helix	trans	-56.7	-45.2	176.5	-73.8	173.4	178.3	0	0	112.3	T26 K27 L33 N34	T26-E30 WeakPolarHBondContact O-CG 3.3Å; T26-E30 PolarHBondContact O-N 3.47Å; K27-E30 PolarHBondContact O-N 3.15Å; E30-L33 PolarHBondContact O-N 3.44Å; E30-N34 WeakPolarHBondContact O-CB 3.27Å; E30-N34 PolarHBondContact O-N 3.07Å
31	I	96.5	Very high	94.8	Very high	105 Å²	105	101.3 Å²	101.3	54%	0.538	49%	0.494	S	S	.	.	H	α-helix	trans	-63	-44	177.4	-68.3	165.6	0	0	0	110.8	K27 I28 I29 N34 F35	K27-I31 HydrophobicContact CG-CD1 4.29Å; K27-I31 WeakPolarHBondContact O-CD1 3.42Å; K27-I31 VanDerWaalsContact O-CG1 3.27Å; K27-I31 WeakPolarHBondContact O-CG1 3.5Å; K27-I31 PolarHBondContact O-N 3.43Å; K27-I31 VanDerWaalsContact O-N 3.07Å; I28-I31 PolarHBondContact O-N 3.02Å; I29-I31 VanDerWaalsContact C-N 3.34Å; I29-I31 PolarHBondContact O-N 3.48Å; I31-N34 PolarHBondContact O-N 3.41Å; I31-F35 WeakPolarHBondContact O-CB 3.32Å; I31-F35 PolarHBondContact O-N 2.88Å
32	K	96.8	Very high	95.3	Very high	132 Å²	132	102.3 Å²	102.3	57%	0.574	50%	0.496	S	S	*	.	H	α-helix	trans	-63.4	-43.5	178.3	-75.6	-178.9	179.2	-176.8	0	111.9	I28 I29 F35 Q36	I28-K32 HydrophobicContact CG2-CD 4.31Å; I28-K32 WeakPolarHBondContact O-CG 3.37Å; I28-K32 PolarHBondContact O-N 2.88Å; I29-K32 PolarHBondContact O-N 3.35Å; K32-F35 PolarHBondContact O-N 3.39Å; K32-Q36 WeakPolarHBondContact O-CB 3.35Å; K32-Q36 WeakPolarHBondContact O-CG 3.49Å; K32-Q36 PolarHBondContact O-N 2.96Å
33	L	96.9	Very high	95.8	Very high	100 Å²	100	101.3 Å²	101.3	52%	0.524	50%	0.496	S	S	.	.	H	α-helix	trans	-64.7	-42.4	178.4	-71.7	174.7	0	0	0	111.5	I29 E30 Q36 S37	I29-L33 HydrophobicContact CG2-CD1 3.83Å; I29-L33 HydrophobicContact CG2-CG 4.24Å; I29-L33 WeakPolarHBondContact O-CG 3.44Å; I29-L33 PolarHBondContact O-N 2.93Å; E30-L33 PolarHBondContact O-N 3.44Å; L33-Q36 PolarHBondContact O-N 3.44Å; L33-S37 PolarHBondContact O-N 3.36Å; L33-S37 PolarHBondContact O-OG 2.91Å
34	N	97	Very high	96.2	Very high	97 Å²	97	102.2 Å²	102.2	52%	0.519	50%	0.5	S	S	.	.	H	α-helix	trans	-64.2	-40.6	175.2	-175.8	9.7	0	0	0	112.1	E30 I31 S37 R38	E30-N34 WeakPolarHBondContact O-CB 3.27Å; E30-N34 PolarHBondContact O-N 3.07Å; I31-N34 PolarHBondContact O-N 3.41Å; N34-S37 WeakPolarHBondContact CA-OG 3.38Å; N34-S37 PolarHBondContact O-OG 3.2Å; N34-R38 WeakPolarHBondContact O-CB 3.43Å; N34-R38 WeakPolarHBondContact O-CG 3.11Å; N34-R38 PolarHBondContact O-N 3.43Å; N34-R38 VanDerWaalsContact O-N 3.09Å
35	F	96.8	Very high	96.5	Very high	126 Å²	126	103.9 Å²	103.9	55%	0.553	50%	0.504	S	S	*	.	H	α-helix	trans	-63.8	-43.8	174.2	-179.7	-104.7	0	0	0	111.7	I31 K32 R38 L39	I31-F35 WeakPolarHBondContact O-CB 3.32Å; I31-F35 PolarHBondContact O-N 2.88Å; K32-F35 PolarHBondContact O-N 3.39Å; F35-R38 PolarHBondContact O-N 2.85Å; F35-L39 HydrophobicContact CD1-CD1 3.82Å; F35-L39 HydrophobicContact CD1-CG 4.39Å; F35-L39 HydrophobicContact CE1-CD1 3.23Å; F35-L39 HydrophobicContact CE1-CG 3.99Å; F35-L39 HydrophobicContact CE2-CD1 4.44Å; F35-L39 HydrophobicContact CE2-CG 4.37Å; F35-L39 HydrophobicContact CZ-CD1 3.6Å; F35-L39 HydrophobicContact CZ-CD2 4.23Å; F35-L39 HydrophobicContact CZ-CG 3.97Å; F35-L39 WeakPolarHBondContact O-CG 3.47Å; F35-L39 PolarHBondContact O-N 3.31Å
36	Q	97	Very high	96.7	Very high	102 Å²	102	105.4 Å²	105.4	48%	0.477	51%	0.514	S	S	.	.	H	α-helix	trans	-62.6	-45.7	176.6	-77.5	-179.9	-19.1	0	0	112.1	K32 L33 R38 L39 F40	K32-Q36 WeakPolarHBondContact O-CB 3.35Å; K32-Q36 WeakPolarHBondContact O-CG 3.49Å; K32-Q36 PolarHBondContact O-N 2.96Å; L33-Q36 PolarHBondContact O-N 3.44Å; Q36-R38 VanDerWaalsContact C-N 3.33Å; Q36-R38 PolarHBondContact O-N 2.99Å; Q36-L39 PolarHBondContact O-N 3.09Å; Q36-F40 WeakPolarHBondContact O-CD2 3.45Å; Q36-F40 PolarHBondContact O-N 2.93Å
37	S	96.9	Very high	97	Very high	53 Å²	53	105.9 Å²	105.9	37%	0.371	52%	0.517	S	S	.	.	H	α-helix	trans	-60.6	-43.7	178.5	63.4	0	0	0	0	111.5	L33 N34 L39 F40 D41	L33-S37 PolarHBondContact O-N 3.36Å; L33-S37 PolarHBondContact O-OG 2.91Å; N34-S37 WeakPolarHBondContact CA-OG 3.38Å; N34-S37 PolarHBondContact O-OG 3.2Å; S37-L39 VanDerWaalsContact C-N 3.35Å; S37-L39 PolarHBondContact O-N 3.26Å; S37-F40 PolarHBondContact O-N 2.88Å; S37-F40 VanDerWaalsContact O-N 3.17Å; S37-D41 VanDerWaalsContact O-CG 3.29Å; S37-D41 PolarHBondContact O-N 3.42Å
38	R	97.5	Very high	97.2	Very high	142 Å²	142	104.8 Å²	104.8	54%	0.536	51%	0.514	S	S	.	.	H	α-helix	trans	-61.9	-40.8	175.5	-73.8	179.3	60.3	-171.6	-4.5	112.9	N34 F35 Q36 F40 D41 E42	N34-R38 WeakPolarHBondContact O-CB 3.43Å; N34-R38 WeakPolarHBondContact O-CG 3.11Å; N34-R38 PolarHBondContact O-N 3.43Å; N34-R38 VanDerWaalsContact O-N 3.09Å; F35-R38 PolarHBondContact O-N 2.85Å; Q36-R38 VanDerWaalsContact C-N 3.33Å; Q36-R38 PolarHBondContact O-N 2.99Å; R38-F40 VanDerWaalsContact C-N 3.34Å; R38-D41 PolarHBondContact O-N 2.94Å; R38-E42 WeakPolarHBondContact O-CG 3.49Å; R38-E42 PolarHBondContact O-N 2.86Å
39	L	97.6	Very high	97.3	Very high	72 Å²	72	107.9 Å²	107.9	38%	0.377	52%	0.521	S	S	.	.	H	α-helix	trans	-63.5	-40.5	174.4	-78.1	179.4	0	0	0	111.7	F35 Q36 S37 E42 C43	F35-L39 HydrophobicContact CD1-CD1 3.82Å; F35-L39 HydrophobicContact CD1-CG 4.39Å; F35-L39 HydrophobicContact CE1-CD1 3.23Å; F35-L39 HydrophobicContact CE1-CG 3.99Å; F35-L39 HydrophobicContact CE2-CD1 4.44Å; F35-L39 HydrophobicContact CE2-CG 4.37Å; F35-L39 HydrophobicContact CZ-CD1 3.6Å; F35-L39 HydrophobicContact CZ-CD2 4.23Å; F35-L39 HydrophobicContact CZ-CG 3.97Å; F35-L39 WeakPolarHBondContact O-CG 3.47Å; F35-L39 PolarHBondContact O-N 3.31Å; Q36-L39 PolarHBondContact O-N 3.09Å; S37-L39 VanDerWaalsContact C-N 3.35Å; S37-L39 PolarHBondContact O-N 3.26Å; L39-E42 PolarHBondContact O-N 3.19Å; L39-C43 WeakPolarHBondContact O-CB 3.37Å; L39-C43 PolarHBondContact O-N 3.34Å; L39-C43 PolarHBondContact O-SG 2.99Å
40	F	97.5	Very high	97.4	Very high	149 Å²	149	105 Å²	105	65%	0.654	52%	0.515	S	S	*	.	H	α-helix	trans	-62.4	-45.4	175.4	-81.2	-66	0	0	0	111.7	Q36 S37 R38 E42 C43 E44	Q36-F40 WeakPolarHBondContact O-CD2 3.45Å; Q36-F40 PolarHBondContact O-N 2.93Å; S37-F40 PolarHBondContact O-N 2.88Å; S37-F40 VanDerWaalsContact O-N 3.17Å; R38-F40 VanDerWaalsContact C-N 3.34Å; F40-E42 VanDerWaalsContact C-N 3.3Å; F40-E42 PolarHBondContact O-N 3.39Å; F40-C43 PolarHBondContact O-N 3.44Å; F40-E44 PolarHBondContact O-N 3.14Å
41	D	97.7	Very high	97.5	Very high	80 Å²	80	105.6 Å²	105.6	43%	0.428	52%	0.516	S	S	.	.	H	α-helix	trans	-60.8	-39.2	176.1	-62.3	-17.8	0	0	0	111.9	S37 R38 K45	S37-D41 VanDerWaalsContact O-CG 3.29Å; S37-D41 PolarHBondContact O-N 3.42Å; R38-D41 PolarHBondContact O-N 2.94Å; D41-K45 VanDerWaalsContact O-CG 3.3Å; D41-K45 WeakPolarHBondContact O-CG 3.39Å; D41-K45 PolarHBondContact O-N 3.17Å; D41-K45 VanDerWaalsContact O-N 3.13Å
42	E	97.5	Very high	97.5	Very high	106 Å²	106	105 Å²	105	50%	0.495	52%	0.517	S	S	.	.	H	α-helix	trans	-67.6	-40.1	175.6	-75.3	174.7	-165.1	0	0	111.8	R38 L39 F40 L46	R38-E42 WeakPolarHBondContact O-CG 3.49Å; R38-E42 PolarHBondContact O-N 2.86Å; L39-E42 PolarHBondContact O-N 3.19Å; F40-E42 VanDerWaalsContact C-N 3.3Å; F40-E42 PolarHBondContact O-N 3.39Å; E42-L46 WeakPolarHBondContact O-CB 3.5Å; E42-L46 PolarHBondContact O-N 2.9Å
43	C	97.6	Very high	97.6	Very high	72 Å²	72	102 Å²	102	49%	0.486	51%	0.507	S	S	.	.	H	α-helix	trans	-64.6	-42.5	174.2	-72.1	0	0	0	0	112.1	L39 F40 L46 V47	L39-C43 WeakPolarHBondContact O-CB 3.37Å; L39-C43 PolarHBondContact O-N 3.34Å; L39-C43 PolarHBondContact O-SG 2.99Å; F40-C43 PolarHBondContact O-N 3.44Å; C43-L46 PolarHBondContact O-N 3.48Å; C43-V47 WeakPolarHBondContact O-CG2 3.3Å; C43-V47 PolarHBondContact O-N 3.13Å
44	E	97.6	Very high	97.7	Very high	120 Å²	120	102.2 Å²	102.2	56%	0.561	51%	0.505	S	S	*	.	H	α-helix	trans	-59.7	-47.9	177	-173.9	172.7	-150	0	0	110.8	F40 L46 V47 E48	F40-E44 PolarHBondContact O-N 3.14Å; E44-L46 VanDerWaalsContact C-N 3.3Å; E44-L46 PolarHBondContact O-N 3.21Å; E44-V47 PolarHBondContact O-N 2.94Å; E44-V47 VanDerWaalsContact O-N 3.14Å; E44-E48 WeakPolarHBondContact O-CG 3.28Å; E44-E48 PolarHBondContact O-N 2.91Å
45	K	97.8	Very high	97.7	Very high	135 Å²	135	103.7 Å²	103.7	59%	0.587	51%	0.507	S	S	*	.	H	α-helix	trans	-59.3	-39.1	174.7	-71.8	170.5	-172.9	172.1	0	113	D41 V47 E48 Y49	D41-K45 VanDerWaalsContact O-CG 3.3Å; D41-K45 WeakPolarHBondContact O-CG 3.39Å; D41-K45 PolarHBondContact O-N 3.17Å; D41-K45 VanDerWaalsContact O-N 3.13Å; K45-V47 VanDerWaalsContact C-N 3.34Å; K45-E48 PolarHBondContact O-N 3Å; K45-Y49 VanDerWaalsContact O-CB 3.32Å; K45-Y49 WeakPolarHBondContact O-CB 3.46Å; K45-Y49 PolarHBondContact O-N 3.23Å
46	L	98	Very high	97.8	Very high	120 Å²	120	100 Å²	100	63%	0.628	50%	0.499	S	S	*	.	H	α-helix	trans	-65.9	-39.1	178.1	-176	63.4	0	0	0	111.4	E42 C43 E44 Y49 G50	E42-L46 WeakPolarHBondContact O-CB 3.5Å; E42-L46 PolarHBondContact O-N 2.9Å; C43-L46 PolarHBondContact O-N 3.48Å; E44-L46 VanDerWaalsContact C-N 3.3Å; E44-L46 PolarHBondContact O-N 3.21Å; L46-Y49 PolarHBondContact O-N 3.03Å; L46-G50 PolarHBondContact O-N 3.33Å
47	V	98.1	Very high	97.8	Very high	83 Å²	83	99 Å²	99	50%	0.503	50%	0.497	S	S	.	.	H	α-helix	trans	-66	-46.6	175.6	171.5	0	0	0	0	110.9	C43 E44 K45 Y49 G50 F51	C43-V47 WeakPolarHBondContact O-CG2 3.3Å; C43-V47 PolarHBondContact O-N 3.13Å; E44-V47 PolarHBondContact O-N 2.94Å; E44-V47 VanDerWaalsContact O-N 3.14Å; K45-V47 VanDerWaalsContact C-N 3.34Å; V47-Y49 VanDerWaalsContact C-N 3.3Å; V47-Y49 PolarHBondContact O-N 3.39Å; V47-G50 WeakPolarHBondContact O-CA 3.4Å; V47-G50 PolarHBondContact O-N 3.48Å; V47-G50 VanDerWaalsContact O-N 3.11Å; V47-F51 HydrophobicContact CG1-CD2 3.88Å; V47-F51 HydrophobicContact CG1-CE2 3.44Å; V47-F51 VanDerWaalsContact CG1-CE2 3.44Å; V47-F51 HydrophobicContact CG1-CZ 4.32Å; V47-F51 VanDerWaalsContact O-CD2 3.28Å; V47-F51 WeakPolarHBondContact O-CD2 3.42Å; V47-F51 PolarHBondContact O-N 2.96Å
48	E	97.9	Very high	97.9	Very high	113 Å²	113	101.9 Å²	101.9	53%	0.528	50%	0.504	S	S	.	.	H	α-helix	trans	-58.7	-41.2	175.2	-71	-179.6	164.9	0	0	112.5	E44 K45 F51 T52	E44-E48 WeakPolarHBondContact O-CG 3.28Å; E44-E48 PolarHBondContact O-N 2.91Å; K45-E48 PolarHBondContact O-N 3Å; E48-F51 PolarHBondContact O-N 3.48Å; E48-T52 PolarHBondContact O-N 3.39Å; E48-T52 VanDerWaalsContact O-N 3.07Å; E48-T52 PolarHBondContact O-OG1 3.44Å
49	Y	98	Very high	97.9	Very high	146 Å²	146	99.2 Å²	99.2	57%	0.573	50%	0.498	S	S	*	.	H	α-helix	trans	-65.5	-40.3	174.8	-176.3	-115.2	0	0	0	111.6	K45 L46 V47 F51 T52 I53	K45-Y49 VanDerWaalsContact O-CB 3.32Å; K45-Y49 WeakPolarHBondContact O-CB 3.46Å; K45-Y49 PolarHBondContact O-N 3.23Å; L46-Y49 PolarHBondContact O-N 3.03Å; V47-Y49 VanDerWaalsContact C-N 3.3Å; V47-Y49 PolarHBondContact O-N 3.39Å; Y49-F51 PolarHBondContact O-N 3.11Å; Y49-T52 WeakPolarHBondContact O-CB 3.45Å; Y49-T52 PolarHBondContact O-N 3.15Å; Y49-T52 VanDerWaalsContact O-N 3.15Å; Y49-I53 HydrophobicContact CD1-CD1 3.75Å; Y49-I53 HydrophobicContact CE1-CD1 3.29Å; Y49-I53 HydrophobicContact CE1-CG1 4.2Å; Y49-I53 HydrophobicContact CE2-CD1 4.38Å; Y49-I53 HydrophobicContact CE2-CG1 4.45Å; Y49-I53 HydrophobicContact CG-CD1 4.47Å; Y49-I53 PolarHBondContact O-N 2.98Å
50	G	98.3	Very high	97.9	Very high	34 Å²	34	99.4 Å²	99.4	35%	0.351	50%	0.504	S	S	.	.	H	α-helix	trans	-55.9	-47.9	172.6	0	0	0	0	0	112.5	L46 V47 T52 I53 E54	L46-G50 PolarHBondContact O-N 3.33Å; V47-G50 WeakPolarHBondContact O-CA 3.4Å; V47-G50 PolarHBondContact O-N 3.48Å; V47-G50 VanDerWaalsContact O-N 3.11Å; G50-T52 VanDerWaalsContact C-N 3.29Å; G50-T52 PolarHBondContact O-N 3.39Å; G50-I53 PolarHBondContact O-N 2.94Å; G50-E54 PolarHBondContact O-N 3.38Å
51	F	98	Very high	97.9	Very high	131 Å²	131	97.8 Å²	97.8	58%	0.575	50%	0.497	S	S	*	.	H	α-helix	trans	-61.5	-36.8	175.1	-75.3	-57.7	0	0	0	112.9	V47 E48 Y49 E54 K55	V47-F51 HydrophobicContact CG1-CD2 3.88Å; V47-F51 HydrophobicContact CG1-CE2 3.44Å; V47-F51 VanDerWaalsContact CG1-CE2 3.44Å; V47-F51 HydrophobicContact CG1-CZ 4.32Å; V47-F51 VanDerWaalsContact O-CD2 3.28Å; V47-F51 WeakPolarHBondContact O-CD2 3.42Å; V47-F51 PolarHBondContact O-N 2.96Å; E48-F51 PolarHBondContact O-N 3.48Å; Y49-F51 PolarHBondContact O-N 3.11Å; F51-E54 PolarHBondContact O-N 2.91Å; F51-K55 WeakPolarHBondContact O-CB 3.32Å; F51-K55 PolarHBondContact O-N 2.99Å
52	T	98	Very high	97.9	Very high	91 Å²	91	100.3 Å²	100.3	56%	0.558	50%	0.501	S	S	*	.	H	α-helix	trans	-64.2	-43.5	176.4	-58.5	0	0	0	0	111.3	E48 Y49 G50 A56	E48-T52 PolarHBondContact O-N 3.39Å; E48-T52 VanDerWaalsContact O-N 3.07Å; E48-T52 PolarHBondContact O-OG1 3.44Å; Y49-T52 WeakPolarHBondContact O-CB 3.45Å; Y49-T52 PolarHBondContact O-N 3.15Å; Y49-T52 VanDerWaalsContact O-N 3.15Å; G50-T52 VanDerWaalsContact C-N 3.29Å; G50-T52 PolarHBondContact O-N 3.39Å; T52-A56 WeakPolarHBondContact O-CB 3.49Å; T52-A56 PolarHBondContact O-N 2.88Å
53	I	98.3	Very high	97.9	Very high	70 Å²	70	98 Å²	98	36%	0.359	50%	0.499	S	S	.	.	H	α-helix	trans	-64.2	-46.6	175.6	-70.8	168.8	0	0	0	110.7	Y49 G50 K55 A56 I57	Y49-I53 HydrophobicContact CD1-CD1 3.75Å; Y49-I53 HydrophobicContact CE1-CD1 3.29Å; Y49-I53 HydrophobicContact CE1-CG1 4.2Å; Y49-I53 HydrophobicContact CE2-CD1 4.38Å; Y49-I53 HydrophobicContact CE2-CG1 4.45Å; Y49-I53 HydrophobicContact CG-CD1 4.47Å; Y49-I53 PolarHBondContact O-N 2.98Å; G50-I53 PolarHBondContact O-N 2.94Å; I53-K55 VanDerWaalsContact C-N 3.33Å; I53-K55 PolarHBondContact O-N 3.07Å; I53-A56 PolarHBondContact O-N 3.03Å; I53-A56 VanDerWaalsContact O-N 3.15Å; I53-I57 HydrophobicContact CG2-CD1 3.67Å; I53-I57 HydrophobicContact CG2-CG1 4.26Å; I53-I57 WeakPolarHBondContact O-CG1 3.36Å; I53-I57 PolarHBondContact O-N 3.43Å
54	E	98.2	Very high	97.9	Very high	105 Å²	105	101 Å²	101	49%	0.491	51%	0.506	S	S	.	.	H	α-helix	trans	-56.8	-48.5	179.2	-177.3	171.8	-153.3	0	0	111	G50 F51 A56 I57 E58	G50-E54 PolarHBondContact O-N 3.38Å; F51-E54 PolarHBondContact O-N 2.91Å; E54-A56 VanDerWaalsContact C-N 3.35Å; E54-A56 PolarHBondContact O-N 3.46Å; E54-I57 WeakPolarHBondContact O-CB 3.48Å; E54-I57 PolarHBondContact O-N 3.28Å; E54-I57 VanDerWaalsContact O-N 3.16Å; E54-E58 WeakPolarHBondContact O-CG 3.24Å; E54-E58 PolarHBondContact O-N 3.04Å
55	K	97.9	Very high	97.9	Very high	127 Å²	127	103.2 Å²	103.2	55%	0.552	51%	0.511	S	S	*	.	H	α-helix	trans	-58.7	-44.1	175.1	-175.6	177.8	176.9	-176.6	0	112.4	F51 I53 I57 E58 E59	F51-K55 WeakPolarHBondContact O-CB 3.32Å; F51-K55 PolarHBondContact O-N 2.99Å; I53-K55 VanDerWaalsContact C-N 3.33Å; I53-K55 PolarHBondContact O-N 3.07Å; K55-I57 VanDerWaalsContact C-N 3.33Å; K55-I57 PolarHBondContact O-N 2.94Å; K55-E58 PolarHBondContact O-N 3.23Å; K55-E59 VanDerWaalsContact CE-OE1 3.24Å; K55-E59 WeakPolarHBondContact CE-OE1 3.34Å; K55-E59 WeakPolarHBondContact O-CG 3.34Å; K55-E59 PolarHBondContact O-N 3.16Å
56	A	97.9	Very high	97.9	Very high	48 Å²	48	102.6 Å²	102.6	40%	0.397	51%	0.51	S	S	.	.	H	α-helix	trans	-62.5	-40	177.2	0	0	0	0	0	111.9	T52 I53 E54 E59 C60	T52-A56 WeakPolarHBondContact O-CB 3.49Å; T52-A56 PolarHBondContact O-N 2.88Å; I53-A56 PolarHBondContact O-N 3.03Å; I53-A56 VanDerWaalsContact O-N 3.15Å; E54-A56 VanDerWaalsContact C-N 3.35Å; E54-A56 PolarHBondContact O-N 3.46Å; A56-E59 PolarHBondContact O-N 3.15Å; A56-C60 PolarHBondContact O-N 3.48Å; A56-C60 PolarHBondContact O-SG 3.21Å
57	I	98.1	Very high	97.9	Very high	83 Å²	83	100 Å²	100	43%	0.426	50%	0.502	S	S	.	.	H	α-helix	trans	-63.8	-42.8	175.6	-69.8	169.1	0	0	0	111	I53 E54 K55 E59 C60 K61	I53-I57 HydrophobicContact CG2-CD1 3.67Å; I53-I57 HydrophobicContact CG2-CG1 4.26Å; I53-I57 WeakPolarHBondContact O-CG1 3.36Å; I53-I57 PolarHBondContact O-N 3.43Å; E54-I57 WeakPolarHBondContact O-CB 3.48Å; E54-I57 PolarHBondContact O-N 3.28Å; E54-I57 VanDerWaalsContact O-N 3.16Å; K55-I57 VanDerWaalsContact C-N 3.33Å; K55-I57 PolarHBondContact O-N 2.94Å; I57-E59 VanDerWaalsContact C-N 3.35Å; I57-C60 PolarHBondContact O-N 2.98Å; I57-K61 HydrophobicContact CG2-CD 4.14Å; I57-K61 HydrophobicContact CG2-CG 4.48Å; I57-K61 WeakPolarHBondContact O-CB 3.48Å; I57-K61 WeakPolarHBondContact O-CG 3.5Å; I57-K61 PolarHBondContact O-N 3.41Å
58	E	97.9	Very high	97.9	Very high	113 Å²	113	103.4 Å²	103.4	53%	0.528	51%	0.506	S	S	.	.	H	α-helix	trans	-62.7	-41.2	176.3	-72.1	-176	163.9	0	0	112.3	E54 K55 K61 R62	E54-E58 WeakPolarHBondContact O-CG 3.24Å; E54-E58 PolarHBondContact O-N 3.04Å; K55-E58 PolarHBondContact O-N 3.23Å; E58-K61 PolarHBondContact O-N 3.4Å; E58-R62 WeakPolarHBondContact O-CB 3.49Å; E58-R62 PolarHBondContact O-N 2.93Å
59	E	98	Very high	97.9	Very high	86 Å²	86	102.8 Å²	102.8	40%	0.402	51%	0.505	S	S	.	.	H	α-helix	trans	-64.8	-42.6	175.5	-70.2	177.9	177.2	0	0	111.9	K55 A56 I57 R62 A63	K55-E59 VanDerWaalsContact CE-OE1 3.24Å; K55-E59 WeakPolarHBondContact CE-OE1 3.34Å; K55-E59 WeakPolarHBondContact O-CG 3.34Å; K55-E59 PolarHBondContact O-N 3.16Å; A56-E59 PolarHBondContact O-N 3.15Å; I57-E59 VanDerWaalsContact C-N 3.35Å; E59-R62 PolarHBondContact O-N 3.37Å; E59-A63 PolarHBondContact O-N 3.34Å
60	C	97.5	Very high	97.9	Very high	76 Å²	76	99.6 Å²	99.6	51%	0.514	50%	0.504	S	S	.	.	H	α-helix	trans	-60.1	-48.5	173.3	-72.9	0	0	0	0	111.8	A56 I57 R62 A63 E64	A56-C60 PolarHBondContact O-N 3.48Å; A56-C60 PolarHBondContact O-SG 3.21Å; I57-C60 PolarHBondContact O-N 2.98Å; C60-R62 VanDerWaalsContact C-N 3.32Å; C60-R62 PolarHBondContact O-N 2.98Å; C60-A63 PolarHBondContact O-N 3.43Å; C60-E64 WeakPolarHBondContact O-CG 3.11Å; C60-E64 PolarHBondContact O-N 2.93Å
61	K	97.8	Very high	97.9	Very high	115 Å²	115	104.2 Å²	104.2	50%	0.5	52%	0.517	S	S	.	.	H	α-helix	trans	-58.5	-44.8	177.3	-75.9	174.6	179.8	174.4	0	111.5	I57 E58 A63 E64 Y65	I57-K61 HydrophobicContact CG2-CD 4.14Å; I57-K61 HydrophobicContact CG2-CG 4.48Å; I57-K61 WeakPolarHBondContact O-CB 3.48Å; I57-K61 WeakPolarHBondContact O-CG 3.5Å; I57-K61 PolarHBondContact O-N 3.41Å; E58-K61 PolarHBondContact O-N 3.4Å; K61-A63 PolarHBondContact O-N 3.31Å; K61-E64 PolarHBondContact O-N 2.93Å; K61-Y65 WeakPolarHBondContact O-CD2 3.43Å; K61-Y65 PolarHBondContact O-N 3.36Å
62	R	97.8	Very high	97.9	Very high	133 Å²	133	102.1 Å²	102.1	50%	0.502	51%	0.509	S	S	.	.	H	α-helix	trans	-59.3	-46.9	177.4	-175.6	178.3	65.9	-116.7	-1.6	111.1	E58 E59 C60 E64 Y65 E66	E58-R62 WeakPolarHBondContact O-CB 3.49Å; E58-R62 PolarHBondContact O-N 2.93Å; E59-R62 PolarHBondContact O-N 3.37Å; C60-R62 VanDerWaalsContact C-N 3.32Å; C60-R62 PolarHBondContact O-N 2.98Å; R62-E64 PolarHBondContact O-N 3Å; R62-Y65 PolarHBondContact O-N 2.95Å; R62-E66 WeakPolarHBondContact CG-OE1 3.43Å; R62-E66 WeakPolarHBondContact O-CG 3.43Å; R62-E66 PolarHBondContact O-N 3.47Å
63	A	97.7	Very high	97.9	Very high	56 Å²	56	102.4 Å²	102.4	46%	0.463	51%	0.507	S	S	.	.	H	α-helix	trans	-62.8	-40.2	178.5	0	0	0	0	0	112.6	E59 C60 K61 E66 S67	E59-A63 PolarHBondContact O-N 3.34Å; C60-A63 PolarHBondContact O-N 3.43Å; K61-A63 PolarHBondContact O-N 3.31Å; A63-E66 PolarHBondContact O-N 3.32Å; A63-S67 WeakPolarHBondContact O-CB 3.36Å; A63-S67 PolarHBondContact O-N 3.41Å
64	E	97.6	Very high	98	Very high	136 Å²	136	105.4 Å²	105.4	64%	0.636	52%	0.517	S	S	*	.	H	α-helix	trans	-62.6	-45.3	174.9	-74	175.3	-178.6	0	0	112	C60 K61 R62 S67 R68	C60-E64 WeakPolarHBondContact O-CG 3.11Å; C60-E64 PolarHBondContact O-N 2.93Å; K61-E64 PolarHBondContact O-N 2.93Å; R62-E64 PolarHBondContact O-N 3Å; E64-S67 PolarHBondContact O-N 2.82Å; E64-R68 WeakPolarHBondContact O-CB 3.39Å; E64-R68 PolarHBondContact O-N 2.91Å
65	Y	97.9	Very high	98	Very high	167 Å²	167	103.8 Å²	103.8	66%	0.655	52%	0.517	S	S	*	.	H	α-helix	trans	-62.7	-43.6	175.8	-81.7	-63.8	0	0	0	112.3	K61 R62 R68 L69	K61-Y65 WeakPolarHBondContact O-CD2 3.43Å; K61-Y65 PolarHBondContact O-N 3.36Å; R62-Y65 PolarHBondContact O-N 2.95Å; Y65-R68 PolarHBondContact O-N 2.91Å; Y65-L69 VanDerWaalsContact O-CB 3.28Å; Y65-L69 WeakPolarHBondContact O-CB 3.46Å; Y65-L69 PolarHBondContact O-N 2.94Å
66	E	97.7	Very high	98	Very high	122 Å²	122	102.3 Å²	102.3	57%	0.57	51%	0.514	S	S	*	.	H	α-helix	trans	-63.3	-43	177.1	-75.9	175.3	-172	0	0	111.6	R62 A63 L69 S70	R62-E66 WeakPolarHBondContact CG-OE1 3.43Å; R62-E66 WeakPolarHBondContact O-CG 3.43Å; R62-E66 PolarHBondContact O-N 3.47Å; A63-E66 PolarHBondContact O-N 3.32Å; E66-L69 PolarHBondContact O-N 3.45Å; E66-S70 WeakPolarHBondContact O-CB 3.41Å; E66-S70 PolarHBondContact O-N 3.29Å
67	S	97.4	Very high	98	Very high	66 Å²	66	108.5 Å²	108.5	46%	0.462	53%	0.527	S	S	.	.	H	α-helix	trans	-61.4	-49.8	176.7	-171.1	0	0	0	0	111.3	A63 E64 L69 S70 E71	A63-S67 WeakPolarHBondContact O-CB 3.36Å; A63-S67 PolarHBondContact O-N 3.41Å; E64-S67 PolarHBondContact O-N 2.82Å; S67-L69 PolarHBondContact O-N 3.48Å; S67-S70 WeakPolarHBondContact O-CB 3.28Å; S67-S70 PolarHBondContact O-N 3.47Å; S67-E71 PolarHBondContact O-N 3.27Å
68	R	98	Very high	98	Very high	154 Å²	154	108.8 Å²	108.8	58%	0.581	53%	0.53	S	S	*	.	H	α-helix	trans	-61.3	-44.8	178.6	-178.5	178.8	167.1	179.8	-1.4	112	E64 Y65 S70 E71 E72	E64-R68 WeakPolarHBondContact O-CB 3.39Å; E64-R68 PolarHBondContact O-N 2.91Å; Y65-R68 PolarHBondContact O-N 2.91Å; R68-S70 VanDerWaalsContact C-N 3.29Å; R68-S70 PolarHBondContact O-N 3.44Å; R68-E71 PolarHBondContact O-N 3.02Å; R68-E72 IonicContact CZ-OE1 3.47Å; R68-E72 IonicContact NE-OE1 3.03Å; R68-E72 PolarHBondContact NE-OE1 2.95Å; R68-E72 IonicContact NH2-OE1 3.23Å; R68-E72 PolarHBondContact NH2-OE1 2.93Å; R68-E72 WeakPolarHBondContact O-CG 3.27Å; R68-E72 PolarHBondContact O-N 3.48Å
69	L	98.1	Very high	98.1	Very high	99 Å²	99	108.7 Å²	108.7	52%	0.518	53%	0.529	S	S	.	.	H	α-helix	trans	-61.9	-39.8	177.6	-178	63.1	0	0	0	111.4	Y65 E66 S67 E72 L73	Y65-L69 VanDerWaalsContact O-CB 3.28Å; Y65-L69 WeakPolarHBondContact O-CB 3.46Å; Y65-L69 PolarHBondContact O-N 2.94Å; E66-L69 PolarHBondContact O-N 3.45Å; S67-L69 PolarHBondContact O-N 3.48Å; L69-E72 PolarHBondContact O-N 2.92Å; L69-L73 HydrophobicContact CD1-CD1 4.4Å; L69-L73 HydrophobicContact CD1-CG 4.33Å; L69-L73 HydrophobicContact CG-CD1 4.14Å; L69-L73 HydrophobicContact CG-CG 4.47Å; L69-L73 WeakPolarHBondContact O-CB 3.37Å; L69-L73 VanDerWaalsContact O-CG 3.27Å; L69-L73 WeakPolarHBondContact O-CG 3.34Å; L69-L73 PolarHBondContact O-N 2.95Å
70	S	98	Very high	98.1	Very high	79 Å²	79	106.6 Å²	106.6	55%	0.552	52%	0.524	S	S	*	.	H	α-helix	trans	-62.4	-43.5	176.2	-172.8	0	0	0	0	112.1	E66 S67 R68 K74	E66-S70 WeakPolarHBondContact O-CB 3.41Å; E66-S70 PolarHBondContact O-N 3.29Å; S67-S70 WeakPolarHBondContact O-CB 3.28Å; S67-S70 PolarHBondContact O-N 3.47Å; R68-S70 VanDerWaalsContact C-N 3.29Å; R68-S70 PolarHBondContact O-N 3.44Å; S70-K74 WeakPolarHBondContact O-CB 3.34Å; S70-K74 PolarHBondContact O-N 2.88Å
71	E	98.2	Very high	98.1	Very high	131 Å²	131	105.8 Å²	105.8	61%	0.612	52%	0.523	S	S	*	.	H	α-helix	trans	-64.9	-44.9	175.8	-71.8	-180	174.1	0	0	112.4	S67 R68 K74 S75	S67-E71 PolarHBondContact O-N 3.27Å; R68-E71 PolarHBondContact O-N 3.02Å; E71-K74 PolarHBondContact O-N 3.42Å; E71-S75 WeakPolarHBondContact O-CB 3.34Å; E71-S75 PolarHBondContact O-N 3.24Å
72	E	98.3	Very high	98.1	Very high	88 Å²	88	104.5 Å²	104.5	41%	0.411	53%	0.528	S	S	.	.	H	α-helix	trans	-61.8	-45.6	176.8	-73.1	179.5	-167.5	0	0	111.2	R68 L69 K74 S75 I76	R68-E72 IonicContact CZ-OE1 3.47Å; R68-E72 IonicContact NE-OE1 3.03Å; R68-E72 PolarHBondContact NE-OE1 2.95Å; R68-E72 IonicContact NH2-OE1 3.23Å; R68-E72 PolarHBondContact NH2-OE1 2.93Å; R68-E72 WeakPolarHBondContact O-CG 3.27Å; R68-E72 PolarHBondContact O-N 3.48Å; L69-E72 PolarHBondContact O-N 2.92Å; E72-K74 VanDerWaalsContact C-N 3.34Å; E72-K74 PolarHBondContact O-N 2.95Å; E72-S75 PolarHBondContact O-N 2.86Å; E72-I76 WeakPolarHBondContact O-CG1 3.34Å; E72-I76 PolarHBondContact O-N 3.44Å
73	L	98.5	Very high	98.2	Very high	97 Å²	97	102.4 Å²	102.4	51%	0.508	52%	0.524	S	S	.	.	H	α-helix	trans	-63.5	-38.3	176.3	-74.4	175.3	0	0	0	112.5	L69 R77	L69-L73 HydrophobicContact CD1-CD1 4.4Å; L69-L73 HydrophobicContact CD1-CG 4.33Å; L69-L73 HydrophobicContact CG-CD1 4.14Å; L69-L73 HydrophobicContact CG-CG 4.47Å; L69-L73 WeakPolarHBondContact O-CB 3.37Å; L69-L73 VanDerWaalsContact O-CG 3.27Å; L69-L73 WeakPolarHBondContact O-CG 3.34Å; L69-L73 PolarHBondContact O-N 2.95Å; L73-R77 WeakPolarHBondContact O-CB 3.42Å; L73-R77 PolarHBondContact O-N 3.26Å
74	K	98.6	Very high	98.2	Very high	132 Å²	132	106.9 Å²	106.9	57%	0.574	53%	0.534	S	S	*	.	H	α-helix	trans	-65	-44.8	174.9	-173.8	-177.7	177	-173.8	0	110.9	S70 E71 E72 I76 R77 D78	S70-K74 WeakPolarHBondContact O-CB 3.34Å; S70-K74 PolarHBondContact O-N 2.88Å; E71-K74 PolarHBondContact O-N 3.42Å; E72-K74 VanDerWaalsContact C-N 3.34Å; E72-K74 PolarHBondContact O-N 2.95Å; K74-I76 PolarHBondContact O-N 3.42Å; K74-R77 WeakPolarHBondContact O-CB 3.47Å; K74-R77 PolarHBondContact O-N 2.72Å; K74-D78 WeakPolarHBondContact O-CB 3.33Å; K74-D78 VanDerWaalsContact O-CG 3.27Å; K74-D78 PolarHBondContact O-N 2.87Å
75	S	98.5	Very high	98.2	Very high	71 Å²	71	104.7 Å²	104.7	50%	0.497	52%	0.523	S	S	.	.	H	α-helix	trans	-59.5	-46.3	176.7	-179.9	0	0	0	0	112	E71 E72 R77 D78 Q79	E71-S75 WeakPolarHBondContact O-CB 3.34Å; E71-S75 PolarHBondContact O-N 3.24Å; E72-S75 PolarHBondContact O-N 2.86Å; S75-R77 VanDerWaalsContact C-N 3.32Å; S75-R77 PolarHBondContact O-N 2.89Å; S75-D78 PolarHBondContact O-N 3.32Å; S75-Q79 WeakPolarHBondContact O-CB 3.26Å; S75-Q79 PolarHBondContact O-N 3.21Å
76	I	98.5	Very high	98.2	Very high	96 Å²	96	98.1 Å²	98.1	49%	0.492	51%	0.506	S	S	.	.	H	α-helix	trans	-60.9	-42.4	176.2	-68.3	166.2	0	0	0	110.9	E72 K74 S80	E72-I76 WeakPolarHBondContact O-CG1 3.34Å; E72-I76 PolarHBondContact O-N 3.44Å; K74-I76 PolarHBondContact O-N 3.42Å; I76-S80 VanDerWaalsContact O-CB 3.26Å; I76-S80 WeakPolarHBondContact O-CB 3.44Å; I76-S80 PolarHBondContact O-N 3Å; I76-S80 PolarHBondContact O-OG 3.02Å
77	R	98.5	Very high	98.2	Very high	179 Å²	179	98.7 Å²	98.7	68%	0.675	50%	0.504	S	S	*	.	H	α-helix	trans	-62	-48.5	177.6	-178.4	-172.6	-60.6	179.2	2	111.5	L73 K74 S75 S80 A81	L73-R77 WeakPolarHBondContact O-CB 3.42Å; L73-R77 PolarHBondContact O-N 3.26Å; K74-R77 WeakPolarHBondContact O-CB 3.47Å; K74-R77 PolarHBondContact O-N 2.72Å; S75-R77 VanDerWaalsContact C-N 3.32Å; S75-R77 PolarHBondContact O-N 2.89Å; R77-S80 PolarHBondContact O-N 3.48Å; R77-A81 WeakPolarHBondContact O-CB 3.18Å; R77-A81 PolarHBondContact O-N 3.39Å
78	D	98.5	Very high	98.3	Very high	89 Å²	89	99.9 Å²	99.9	48%	0.476	50%	0.501	S	S	.	.	H	α-helix	trans	-66.3	-41.6	-177.7	-68.3	-14.3	0	0	0	110.9	K74 S75 A81 S82	K74-D78 WeakPolarHBondContact O-CB 3.33Å; K74-D78 VanDerWaalsContact O-CG 3.27Å; K74-D78 PolarHBondContact O-N 2.87Å; S75-D78 PolarHBondContact O-N 3.32Å; D78-A81 PolarHBondContact O-N 3.36Å; D78-S82 PolarHBondContact O-N 2.88Å
79	Q	98.5	Very high	98.3	Very high	111 Å²	111	96.3 Å²	96.3	52%	0.519	49%	0.493	S	S	.	.	H	α-helix	trans	-60.8	-50	173	-178.5	-179	-12	0	0	111.2	S75 A81 S82 E83	S75-Q79 WeakPolarHBondContact O-CB 3.26Å; S75-Q79 PolarHBondContact O-N 3.21Å; Q79-A81 VanDerWaalsContact C-N 3.31Å; Q79-A81 PolarHBondContact O-N 3.03Å; Q79-S82 WeakPolarHBondContact O-CB 3.49Å; Q79-S82 PolarHBondContact O-N 2.89Å; Q79-S82 VanDerWaalsContact O-N 3.15Å; Q79-E83 WeakPolarHBondContact CG-OE1 3.45Å; Q79-E83 PolarHBondContact NE2-OE1 3.15Å; Q79-E83 WeakPolarHBondContact O-CG 3.48Å; Q79-E83 PolarHBondContact O-N 3.48Å
80	S	98.3	Very high	98.3	Very high	42 Å²	42	96.6 Å²	96.6	29%	0.294	49%	0.491	S	S	.	.	H	α-helix	trans	-60.1	-42.7	179.7	-59.1	0	0	0	0	111.3	I76 R77 S82 E83 F84	I76-S80 VanDerWaalsContact O-CB 3.26Å; I76-S80 WeakPolarHBondContact O-CB 3.44Å; I76-S80 PolarHBondContact O-N 3Å; I76-S80 PolarHBondContact O-OG 3.02Å; R77-S80 PolarHBondContact O-N 3.48Å; S80-S82 VanDerWaalsContact C-N 3.33Å; S80-S82 PolarHBondContact O-N 3.41Å; S80-E83 PolarHBondContact O-N 2.92Å; S80-F84 WeakPolarHBondContact O-CB 3.36Å; S80-F84 WeakPolarHBondContact O-CD2 3.48Å; S80-F84 WeakPolarHBondContact O-CG 3.47Å; S80-F84 PolarHBondContact O-N 3.04Å
81	A	98.3	Very high	98.2	Very high	58 Å²	58	97.6 Å²	97.6	48%	0.479	49%	0.489	S	S	.	.	H	α-helix	trans	-61.3	-41.5	176.8	0	0	0	0	0	112.1	R77 D78 Q79 F84 E85	R77-A81 WeakPolarHBondContact O-CB 3.18Å; R77-A81 PolarHBondContact O-N 3.39Å; D78-A81 PolarHBondContact O-N 3.36Å; Q79-A81 VanDerWaalsContact C-N 3.31Å; Q79-A81 PolarHBondContact O-N 3.03Å; A81-F84 PolarHBondContact O-N 3.38Å; A81-E85 PolarHBondContact O-N 3.44Å
82	S	98.2	Very high	98.2	Very high	88 Å²	88	96 Å²	96	62%	0.615	48%	0.481	S	S	*	.	H	α-helix	trans	-64.7	-44.2	175.7	-172.6	0	0	0	0	112.3	D78 Q79 S80 E85 G86	D78-S82 PolarHBondContact O-N 2.88Å; Q79-S82 WeakPolarHBondContact O-CB 3.49Å; Q79-S82 PolarHBondContact O-N 2.89Å; Q79-S82 VanDerWaalsContact O-N 3.15Å; S80-S82 VanDerWaalsContact C-N 3.33Å; S80-S82 PolarHBondContact O-N 3.41Å; S82-E85 PolarHBondContact O-N 3.48Å; S82-G86 PolarHBondContact O-N 3.17Å
83	E	98.3	Very high	98.2	Very high	90 Å²	90	99.4 Å²	99.4	42%	0.421	49%	0.49	S	S	.	.	H	α-helix	trans	-62.3	-44.4	176	-71.9	178.5	-161.8	0	0	111.7	Q79 S80 E85 G86 Y87	Q79-E83 WeakPolarHBondContact CG-OE1 3.45Å; Q79-E83 PolarHBondContact NE2-OE1 3.15Å; Q79-E83 WeakPolarHBondContact O-CG 3.48Å; Q79-E83 PolarHBondContact O-N 3.48Å; S80-E83 PolarHBondContact O-N 2.92Å; E83-E85 PolarHBondContact O-N 3.33Å; E83-G86 WeakPolarHBondContact O-CA 3.01Å; E83-G86 PolarHBondContact O-N 2.92Å; E83-Y87 HydrophobicContact CB-CE2 4.39Å; E83-Y87 WeakPolarHBondContact O-CD2 3.36Å; E83-Y87 PolarHBondContact O-N 3.45Å
84	F	98.2	Very high	98.1	Very high	150 Å²	150	99.2 Å²	99.2	66%	0.658	49%	0.488	S	S	*	.	H	α-helix	trans	-61.7	-41.7	176.7	-79.7	-57.6	0	0	0	112.8	S80 A81 G86 Y87 K88	S80-F84 WeakPolarHBondContact O-CB 3.36Å; S80-F84 WeakPolarHBondContact O-CD2 3.48Å; S80-F84 WeakPolarHBondContact O-CG 3.47Å; S80-F84 PolarHBondContact O-N 3.04Å; A81-F84 PolarHBondContact O-N 3.38Å; F84-G86 VanDerWaalsContact C-N 3.31Å; F84-G86 PolarHBondContact O-N 3.16Å; F84-Y87 PolarHBondContact O-N 2.89Å; F84-K88 WeakPolarHBondContact O-CB 3.37Å; F84-K88 PolarHBondContact O-N 3.36Å
85	E	98.3	Very high	98	Very high	89 Å²	89	99.8 Å²	99.8	42%	0.416	49%	0.491	S	S	.	.	H	α-helix	trans	-64.2	-39.5	174.8	-170.1	60.6	-155.3	0	0	111	A81 S82 E83 Y87 K88 I89	A81-E85 PolarHBondContact O-N 3.44Å; S82-E85 PolarHBondContact O-N 3.48Å; E83-E85 PolarHBondContact O-N 3.33Å; E85-Y87 PolarHBondContact O-N 2.99Å; E85-K88 WeakPolarHBondContact O-CB 3.36Å; E85-K88 PolarHBondContact O-N 3.28Å; E85-K88 IonicContact OE1-NZ 2.79Å; E85-K88 PolarHBondContact OE1-NZ 2.88Å; E85-K88 IonicContact OE2-NZ 3Å; E85-I89 HydrophobicContact CG-CD1 4.23Å; E85-I89 WeakPolarHBondContact O-CG1 3.3Å; E85-I89 PolarHBondContact O-N 3.36Å
86	G	97.8	Very high	97.9	Very high	29 Å²	29	100.9 Å²	100.9	30%	0.299	49%	0.488	S	S	.	.	H	α-helix	trans	-58.8	-43.3	172.8	0	0	0	0	0	113.2	S82 E83 F84 Q90	S82-G86 PolarHBondContact O-N 3.17Å; E83-G86 WeakPolarHBondContact O-CA 3.01Å; E83-G86 PolarHBondContact O-N 2.92Å; F84-G86 VanDerWaalsContact C-N 3.31Å; F84-G86 PolarHBondContact O-N 3.16Å; G86-Q90 WeakPolarHBondContact O-CG 3.45Å; G86-Q90 PolarHBondContact O-N 3.26Å; G86-Q90 PolarHBondContact O-NE2 3.36Å
87	Y	97.9	Very high	97.8	Very high	134 Å²	134	101.1 Å²	101.1	53%	0.525	49%	0.491	S	S	.	.	H	α-helix	trans	-67.1	-40.4	175.2	-70.4	-52.5	0	0	0	112.6	E83 F84 E85 Q90 M91	E83-Y87 HydrophobicContact CB-CE2 4.39Å; E83-Y87 WeakPolarHBondContact O-CD2 3.36Å; E83-Y87 PolarHBondContact O-N 3.45Å; F84-Y87 PolarHBondContact O-N 2.89Å; E85-Y87 PolarHBondContact O-N 2.99Å; Y87-Q90 PolarHBondContact O-N 2.92Å; Y87-M91 WeakPolarHBondContact O-CG 3.41Å; Y87-M91 PolarHBondContact O-N 2.99Å
88	K	98.1	Very high	97.6	Very high	92 Å²	92	98.9 Å²	98.9	40%	0.4	49%	0.486	S	S	.	.	H	α-helix	trans	-58.8	-49.7	176.7	-179.9	-173.4	162.5	-153.9	0	111.5	F84 E85 Q90 M91 E92	F84-K88 WeakPolarHBondContact O-CB 3.37Å; F84-K88 PolarHBondContact O-N 3.36Å; E85-K88 WeakPolarHBondContact O-CB 3.36Å; E85-K88 PolarHBondContact O-N 3.28Å; E85-K88 IonicContact OE1-NZ 2.79Å; E85-K88 PolarHBondContact OE1-NZ 2.88Å; E85-K88 IonicContact OE2-NZ 3Å; K88-Q90 VanDerWaalsContact C-N 3.3Å; K88-Q90 PolarHBondContact O-N 3.45Å; K88-M91 PolarHBondContact O-N 3.43Å; K88-M91 VanDerWaalsContact O-N 3.16Å; K88-E92 WeakPolarHBondContact CE-OE1 3.4Å; K88-E92 WeakPolarHBondContact O-CG 3.49Å; K88-E92 PolarHBondContact O-N 3.18Å
89	I	98.1	Very high	97.4	Very high	79 Å²	79	100.9 Å²	100.9	41%	0.405	49%	0.487	S	S	.	.	H	α-helix	trans	-59.6	-41.6	177.3	-67.5	166.2	0	0	0	111.2	E85 E92 R93	E85-I89 HydrophobicContact CG-CD1 4.23Å; E85-I89 WeakPolarHBondContact O-CG1 3.3Å; E85-I89 PolarHBondContact O-N 3.36Å; I89-E92 PolarHBondContact O-N 3Å; I89-R93 WeakPolarHBondContact O-CB 3.44Å; I89-R93 PolarHBondContact O-N 3.36Å
90	Q	97.7	Very high	97.2	Very high	105 Å²	105	97.2 Å²	97.2	49%	0.491	48%	0.479	S	S	.	.	H	α-helix	trans	-63.4	-44	176.4	-75.6	-178.1	81.6	0	0	111.9	G86 Y87 K88 R93 I94	G86-Q90 WeakPolarHBondContact O-CG 3.45Å; G86-Q90 PolarHBondContact O-N 3.26Å; G86-Q90 PolarHBondContact O-NE2 3.36Å; Y87-Q90 PolarHBondContact O-N 2.92Å; K88-Q90 VanDerWaalsContact C-N 3.3Å; K88-Q90 PolarHBondContact O-N 3.45Å; Q90-R93 PolarHBondContact O-N 3.28Å; Q90-I94 VanDerWaalsContact O-CG1 3.3Å; Q90-I94 WeakPolarHBondContact O-CG1 3.4Å; Q90-I94 PolarHBondContact O-N 3.49Å
91	M	97.5	Very high	96.9	Very high	100 Å²	100	104.5 Å²	104.5	49%	0.493	50%	0.5	S	S	.	.	H	α-helix	trans	-62.1	-48.1	176.4	-76	-173.1	-79.5	0	0	111.4	Y87 K88 R93 I94 F95	Y87-M91 WeakPolarHBondContact O-CG 3.41Å; Y87-M91 PolarHBondContact O-N 2.99Å; K88-M91 PolarHBondContact O-N 3.43Å; K88-M91 VanDerWaalsContact O-N 3.16Å; M91-R93 VanDerWaalsContact C-N 3.3Å; M91-R93 PolarHBondContact O-N 2.88Å; M91-I94 PolarHBondContact O-N 3.5Å; M91-I94 VanDerWaalsContact O-N 3.09Å; M91-F95 HydrophobicContact CB-CD2 4.42Å; M91-F95 HydrophobicContact CB-CE2 4.37Å; M91-F95 WeakPolarHBondContact O-CD2 3.43Å; M91-F95 PolarHBondContact O-N 2.88Å
92	E	98	Very high	96.5	Very high	98 Å²	98	107.8 Å²	107.8	46%	0.458	51%	0.509	S	S	.	.	H	α-helix	trans	-55.4	-45.4	176	-73.4	173.4	176	0	0	111.2	K88 I89 I94 F95 E96	K88-E92 WeakPolarHBondContact CE-OE1 3.4Å; K88-E92 WeakPolarHBondContact O-CG 3.49Å; K88-E92 PolarHBondContact O-N 3.18Å; I89-E92 PolarHBondContact O-N 3Å; E92-I94 PolarHBondContact O-N 2.88Å; E92-F95 PolarHBondContact O-N 3.09Å; E92-E96 WeakPolarHBondContact O-CB 3.37Å; E92-E96 WeakPolarHBondContact O-CG 3.43Å; E92-E96 PolarHBondContact O-N 2.99Å
93	R	97.4	Very high	96	Very high	159 Å²	159	109.8 Å²	109.8	60%	0.6	51%	0.507	S	S	*	.	H	α-helix	trans	-59.9	-43.4	175.1	-172.6	-172.5	-62.1	175.8	1	112.5	I89 Q90 M91 N97	I89-R93 WeakPolarHBondContact O-CB 3.44Å; I89-R93 PolarHBondContact O-N 3.36Å; Q90-R93 PolarHBondContact O-N 3.28Å; M91-R93 VanDerWaalsContact C-N 3.3Å; M91-R93 PolarHBondContact O-N 2.88Å; R93-N97 WeakPolarHBondContact O-CB 3.12Å; R93-N97 PolarHBondContact O-N 3.29Å; R93-N97 PolarHBondContact O-ND2 3.41Å
94	I	97.3	Very high	95.3	Very high	92 Å²	92	108.5 Å²	108.5	47%	0.472	51%	0.507	S	S	.	.	H	α-helix	trans	-64	-44.9	177.9	-69.3	164.1	0	0	0	110.5	Q90 M91 E92 N97 K98	Q90-I94 VanDerWaalsContact O-CG1 3.3Å; Q90-I94 WeakPolarHBondContact O-CG1 3.4Å; Q90-I94 PolarHBondContact O-N 3.49Å; M91-I94 PolarHBondContact O-N 3.5Å; M91-I94 VanDerWaalsContact O-N 3.09Å; E92-I94 PolarHBondContact O-N 2.88Å; I94-N97 PolarHBondContact O-N 3.47Å; I94-K98 HydrophobicContact CG2-CD 4.33Å; I94-K98 WeakPolarHBondContact O-CG 3.37Å; I94-K98 PolarHBondContact O-N 3.49Å
95	F	96.5	Very high	94.6	Very high	145 Å²	145	105.2 Å²	105.2	64%	0.636	50%	0.503	S	S	*	.	H	α-helix	trans	-62.1	-46.3	177.9	-80.6	-65.3	0	0	0	111.5	M91 E92 N97 K98 R99	M91-F95 HydrophobicContact CB-CD2 4.42Å; M91-F95 HydrophobicContact CB-CE2 4.37Å; M91-F95 WeakPolarHBondContact O-CD2 3.43Å; M91-F95 PolarHBondContact O-N 2.88Å; E92-F95 PolarHBondContact O-N 3.09Å; F95-N97 PolarHBondContact O-N 2.95Å; F95-K98 PolarHBondContact O-N 3.41Å; F95-R99 VanDerWaalsContact O-CB 3.28Å; F95-R99 WeakPolarHBondContact O-CB 3.44Å; F95-R99 PolarHBondContact O-N 3.5Å
96	E	96.4	Very high	93.6	Very high	93 Å²	93	103.5 Å²	103.5	44%	0.435	50%	0.504	S	S	.	.	H	α-helix	trans	-61.7	-44.4	177.8	-76.3	-57.1	152.4	0	0	112.5	E92 K98 R99 G100	E92-E96 WeakPolarHBondContact O-CB 3.37Å; E92-E96 WeakPolarHBondContact O-CG 3.43Å; E92-E96 PolarHBondContact O-N 2.99Å; E96-K98 PolarHBondContact O-N 2.98Å; E96-R99 VanDerWaalsContact CD-CZ 3.44Å; E96-R99 PolarHBondContact O-N 3.05Å; E96-R99 IonicContact OE1-CZ 3.66Å; E96-R99 IonicContact OE1-NE 2.82Å; E96-R99 IonicContact OE1-NH1 3.29Å; E96-R99 PolarHBondContact OE1-NH1 3.49Å; E96-R99 IonicContact OE1-NH2 3.06Å; E96-R99 PolarHBondContact OE1-NH2 3.46Å; E96-R99 IonicContact OE2-CZ 3.46Å; E96-R99 IonicContact OE2-NE 3.83Å; E96-R99 PolarHBondContact OE2-NE 2.85Å; E96-R99 IonicContact OE2-NH2 3.52Å; E96-R99 PolarHBondContact OE2-NH2 3.3Å; E96-G100 PolarHBondContact O-N 3.46Å
97	N	95.3	Very high	92.4	Very high	102 Å²	102	107.2 Å²	107.2	55%	0.545	52%	0.517	S	S	.	.	H	α-helix	trans	-61.7	-44.2	176.1	-74.5	-17.2	0	0	0	112.1	R93 I94 F95 G100 R101	R93-N97 WeakPolarHBondContact O-CB 3.12Å; R93-N97 PolarHBondContact O-N 3.29Å; R93-N97 PolarHBondContact O-ND2 3.41Å; I94-N97 PolarHBondContact O-N 3.47Å; F95-N97 PolarHBondContact O-N 2.95Å; N97-G100 PolarHBondContact O-N 3.46Å; N97-R101 WeakPolarHBondContact O-CG 3.28Å; N97-R101 PolarHBondContact O-N 2.99Å
98	K	95.4	Very high	90.6	Very high	131 Å²	131	108.1 Å²	108.1	57%	0.57	52%	0.524	S	S	*	.	H	α-helix	trans	-64.4	-43.2	176.4	-75.5	-175.3	-179.5	-175.4	0	111.6	I94 F95 E96 G100 R101 L102	I94-K98 HydrophobicContact CG2-CD 4.33Å; I94-K98 WeakPolarHBondContact O-CG 3.37Å; I94-K98 PolarHBondContact O-N 3.49Å; F95-K98 PolarHBondContact O-N 3.41Å; E96-K98 PolarHBondContact O-N 2.98Å; K98-G100 PolarHBondContact O-N 3.3Å; K98-R101 PolarHBondContact O-N 2.85Å; K98-L102 WeakPolarHBondContact O-CG 3.21Å; K98-L102 PolarHBondContact O-N 3.03Å
99	R	93.8	Very high	88.9	Confident	132 Å²	132	105.6 Å²	105.6	50%	0.498	52%	0.524	S	S	.	.	H	α-helix	trans	-60.8	-43.9	177	-173	175.6	73.8	164.8	7.6	111.5	F95 E96 L102 K103	F95-R99 VanDerWaalsContact O-CB 3.28Å; F95-R99 WeakPolarHBondContact O-CB 3.44Å; F95-R99 PolarHBondContact O-N 3.5Å; E96-R99 VanDerWaalsContact CD-CZ 3.44Å; E96-R99 PolarHBondContact O-N 3.05Å; E96-R99 IonicContact OE1-CZ 3.66Å; E96-R99 IonicContact OE1-NE 2.82Å; E96-R99 IonicContact OE1-NH1 3.29Å; E96-R99 PolarHBondContact OE1-NH1 3.49Å; E96-R99 IonicContact OE1-NH2 3.06Å; E96-R99 PolarHBondContact OE1-NH2 3.46Å; E96-R99 IonicContact OE2-CZ 3.46Å; E96-R99 IonicContact OE2-NE 3.83Å; E96-R99 PolarHBondContact OE2-NE 2.85Å; E96-R99 IonicContact OE2-NH2 3.52Å; E96-R99 PolarHBondContact OE2-NH2 3.3Å; R99-L102 PolarHBondContact O-N 2.79Å; R99-K103 WeakPolarHBondContact O-CG 3.49Å; R99-K103 PolarHBondContact O-N 3.22Å
100	G	93.3	Very high	87.1	Confident	34 Å²	34	107.3 Å²	107.3	35%	0.351	53%	0.534	S	S	.	.	H	α-helix	trans	-59	-48.5	174.4	0	0	0	0	0	112.3	E96 N97 K98 L102 K103 S104	E96-G100 PolarHBondContact O-N 3.46Å; N97-G100 PolarHBondContact O-N 3.46Å; K98-G100 PolarHBondContact O-N 3.3Å; G100-L102 PolarHBondContact O-N 3.46Å; G100-K103 PolarHBondContact O-N 3.44Å; G100-S104 PolarHBondContact O-N 3.31Å; G100-S104 PolarHBondContact O-OG 3.34Å
101	R	92.1	Very high	85.6	Confident	195 Å²	195	108.7 Å²	108.7	74%	0.736	54%	0.541	S	S	*	.	H	α-helix	trans	-60.5	-40.7	177.4	-72.1	179.3	68.6	-170	0.4	113.2	N97 K98 S104 S105	N97-R101 WeakPolarHBondContact O-CG 3.28Å; N97-R101 PolarHBondContact O-N 2.99Å; K98-R101 PolarHBondContact O-N 2.85Å; R101-S104 PolarHBondContact O-N 3.31Å; R101-S105 WeakPolarHBondContact O-CB 3.41Å; R101-S105 PolarHBondContact O-N 2.63Å
102	L	90.9	Very high	84	Confident	127 Å²	127	107.8 Å²	107.8	67%	0.665	54%	0.537	S	S	*	.	H	α-helix	trans	-65.4	-42.9	177.1	-72.6	172.8	0	0	0	111.8	K98 R99 G100 S105 A106	K98-L102 WeakPolarHBondContact O-CG 3.21Å; K98-L102 PolarHBondContact O-N 3.03Å; R99-L102 PolarHBondContact O-N 2.79Å; G100-L102 PolarHBondContact O-N 3.46Å; L102-S105 PolarHBondContact O-N 3.26Å; L102-A106 WeakPolarHBondContact O-CB 3.05Å; L102-A106 PolarHBondContact O-N 2.98Å
103	K	88.1	Confident	82.6	Confident	130 Å²	130	105.7 Å²	105.7	57%	0.565	54%	0.537	S	S	*	.	H	α-helix	trans	-60.9	-45.3	174.7	-75.1	-177.9	174.6	-175.1	0	111.9	R99 G100 S105 A106 N107	R99-K103 WeakPolarHBondContact O-CG 3.49Å; R99-K103 PolarHBondContact O-N 3.22Å; G100-K103 PolarHBondContact O-N 3.44Å; K103-S105 PolarHBondContact O-N 3.41Å; K103-A106 PolarHBondContact O-N 3.26Å; K103-N107 VanDerWaalsContact O-CG 3.3Å; K103-N107 PolarHBondContact O-N 3.36Å; K103-N107 VanDerWaalsContact O-N 3.14Å; K103-N107 PolarHBondContact O-OD1 2.96Å
104	S	84.1	Confident	81.3	Confident	63 Å²	63	101.8 Å²	101.8	44%	0.441	53%	0.534	S	S	.	.	H	α-helix	trans	-61.3	-44.4	176	-59.5	0	0	0	0	111.7	G100 R101 A106 N107 F108	G100-S104 PolarHBondContact O-N 3.31Å; G100-S104 PolarHBondContact O-OG 3.34Å; R101-S104 PolarHBondContact O-N 3.31Å; S104-A106 VanDerWaalsContact C-N 3.34Å; S104-A106 PolarHBondContact O-N 3.06Å; S104-N107 PolarHBondContact O-N 3.49Å; S104-F108 WeakPolarHBondContact O-CD2 3.45Å; S104-F108 PolarHBondContact O-N 3.32Å
105	S	82.5	Confident	80.1	Confident	81 Å²	81	101.4 Å²	101.4	57%	0.566	53%	0.533	S	S	*	.	H	α-helix	trans	-64.1	-35.7	178.6	-170.3	0	0	0	0	113.2	R101 L102 K103 G109	R101-S105 WeakPolarHBondContact O-CB 3.41Å; R101-S105 PolarHBondContact O-N 2.63Å; L102-S105 PolarHBondContact O-N 3.26Å; K103-S105 PolarHBondContact O-N 3.41Å; S105-G109 PolarHBondContact O-N 3.14Å
106	A	76.7	Confident	78.8	Confident	52 Å²	52	101.9 Å²	101.9	43%	0.43	53%	0.531	S	S	.	.	H	α-helix	trans	-67.3	-42.4	176.7	0	0	0	0	0	111.4	L102 K103 S104 F108 G109 D110	L102-A106 WeakPolarHBondContact O-CB 3.05Å; L102-A106 PolarHBondContact O-N 2.98Å; K103-A106 PolarHBondContact O-N 3.26Å; S104-A106 VanDerWaalsContact C-N 3.34Å; S104-A106 PolarHBondContact O-N 3.06Å; A106-F108 VanDerWaalsContact C-N 3.35Å; A106-F108 PolarHBondContact O-N 3.49Å; A106-G109 PolarHBondContact O-N 3.1Å; A106-G109 VanDerWaalsContact O-N 3.1Å; A106-D110 PolarHBondContact O-N 3.04Å
107	N	72.6	Confident	77.5	Confident	108 Å²	108	101.2 Å²	101.2	58%	0.578	54%	0.536	S	S	*	.	H	α-helix	trans	-62.6	-38.6	178.7	-66.5	-8.6	0	0	0	112.8	K103 S104 G109 D110 E111	K103-N107 VanDerWaalsContact O-CG 3.3Å; K103-N107 PolarHBondContact O-N 3.36Å; K103-N107 VanDerWaalsContact O-N 3.14Å; K103-N107 PolarHBondContact O-OD1 2.96Å; S104-N107 PolarHBondContact O-N 3.49Å; N107-G109 VanDerWaalsContact C-N 3.31Å; N107-G109 PolarHBondContact O-N 3.4Å; N107-D110 PolarHBondContact O-N 3.06Å; N107-E111 WeakPolarHBondContact O-CB 3.49Å; N107-E111 PolarHBondContact O-N 3.19Å
108	F	60.4	Low	76.5	Confident	152 Å²	152	102.5 Å²	102.5	67%	0.667	54%	0.536	S	S	*	.	H	α-helix	trans	-66.2	-33.8	174.4	-75.1	-69.7	0	0	0	112.7	S104 A106 D112	S104-F108 WeakPolarHBondContact O-CD2 3.45Å; S104-F108 PolarHBondContact O-N 3.32Å; A106-F108 VanDerWaalsContact C-N 3.35Å; A106-F108 PolarHBondContact O-N 3.49Å; F108-D112 PolarHBondContact O-N 3.06Å
109	G	62	Low	75.5	Confident	39 Å²	39	104.9 Å²	104.9	40%	0.402	54%	0.542	S	S	.	.	H	α-helix	trans	-69.9	-42.5	176.4	0	0	0	0	0	112.4	S105 A106 N107 A113	S105-G109 PolarHBondContact O-N 3.14Å; A106-G109 PolarHBondContact O-N 3.1Å; A106-G109 VanDerWaalsContact O-N 3.1Å; N107-G109 VanDerWaalsContact C-N 3.31Å; N107-G109 PolarHBondContact O-N 3.4Å; G109-A113 WeakPolarHBondContact O-CB 3.17Å; G109-A113 PolarHBondContact O-N 2.95Å
110	D	61.1	Low	74.6	Confident	115 Å²	115	105 Å²	105	62%	0.615	55%	0.552	S	S	*	*	H	α-helix	trans	-67.8	-37.8	178.1	-77.7	-9.1	0	0	0	111.8	A106 N107 S114	A106-D110 PolarHBondContact O-N 3.04Å; N107-D110 PolarHBondContact O-N 3.06Å; D110-S114 WeakPolarHBondContact O-CB 3.4Å; D110-S114 PolarHBondContact O-N 3.36Å
111	E	65.2	Low	73.7	Confident	135 Å²	135	110.3 Å²	110.3	63%	0.631	57%	0.571	S	S	*	*	H	α-helix	trans	-67.8	-46.9	177.6	-162.6	166.7	-161.8	0	0	111.5	N107 S114 D115	N107-E111 WeakPolarHBondContact O-CB 3.49Å; N107-E111 PolarHBondContact O-N 3.19Å; E111-S114 PolarHBondContact O-N 3.48Å; E111-D115 WeakPolarHBondContact O-CB 3.42Å; E111-D115 PolarHBondContact O-N 2.82Å
112	D	65.8	Low	73	Confident	80 Å²	80	107.2 Å²	107.2	43%	0.428	57%	0.569	S	S	.	*	H	α-helix	trans	-65.2	-39.8	175.8	-174.9	39.6	0	0	0	112	F108 R116	F108-D112 PolarHBondContact O-N 3.06Å; D112-R116 WeakPolarHBondContact O-CB 3.21Å; D112-R116 WeakPolarHBondContact O-CG 3.38Å; D112-R116 PolarHBondContact O-N 2.93Å; D112-R116 IonicContact OD1-CZ 3.06Å; D112-R116 IonicContact OD1-NE 4Å; D112-R116 PolarHBondContact OD1-NE 2.97Å; D112-R116 IonicContact OD1-NH2 3.89Å; D112-R116 IonicContact OD2-CZ 2.82Å; D112-R116 VanDerWaalsContact OD2-CZ 3.29Å; D112-R116 IonicContact OD2-NE 3.49Å; D112-R116 PolarHBondContact OD2-NE 2.86Å; D112-R116 IonicContact OD2-NH2 3.64Å; D112-R116 PolarHBondContact OD2-NH2 2.91Å
113	A	66.8	Low	72	Confident	54 Å²	54	107.9 Å²	107.9	45%	0.446	59%	0.593	S	S	.	*	H	α-helix	trans	-66	-41.6	176.5	0	0	0	0	0	111.9	G109 R116 C117	G109-A113 WeakPolarHBondContact O-CB 3.17Å; G109-A113 PolarHBondContact O-N 2.95Å; A113-R116 PolarHBondContact O-N 3.44Å; A113-C117 WeakPolarHBondContact O-CB 3.38Å; A113-C117 PolarHBondContact O-N 2.9Å
114	S	70.2	Confident	71.1	Confident	78 Å²	78	106.8 Å²	106.8	55%	0.545	59%	0.594	S	S	.	*	H	α-helix	trans	-64.6	-45.4	176.6	-170.3	0	0	0	0	111.3	D110 E111 R116 C117 F118	D110-S114 WeakPolarHBondContact O-CB 3.4Å; D110-S114 PolarHBondContact O-N 3.36Å; E111-S114 PolarHBondContact O-N 3.48Å; S114-R116 VanDerWaalsContact C-N 3.35Å; S114-R116 PolarHBondContact O-N 3.48Å; S114-C117 PolarHBondContact O-N 3.39Å; S114-F118 WeakPolarHBondContact O-CB 3.46Å; S114-F118 PolarHBondContact O-N 3.03Å
115	D	73.2	Confident	70.5	Confident	84 Å²	84	109.1 Å²	109.1	45%	0.449	60%	0.602	S	S	.	*	H	α-helix	trans	-61.7	-42.2	177.4	-121.1	42.9	0	0	0	111.6	E111 F118 R119	E111-D115 WeakPolarHBondContact O-CB 3.42Å; E111-D115 PolarHBondContact O-N 2.82Å; D115-F118 PolarHBondContact O-N 2.98Å; D115-R119 WeakPolarHBondContact O-CB 3.1Å; D115-R119 VanDerWaalsContact O-CG 3.26Å; D115-R119 WeakPolarHBondContact O-CG 3.26Å; D115-R119 PolarHBondContact O-N 3.45Å; D115-R119 IonicContact OD2-NE 2.63Å; D115-R119 IonicContact OD2-NH2 3.07Å
116	R	69.2	Low	69.8	Low	154 Å²	154	110.7 Å²	110.7	58%	0.581	60%	0.604	S	S	*	*	H	α-helix	trans	-65.7	-42.6	175.1	-72.7	175.1	-169.1	-143.2	13.2	112.3	D112 A113 S114 F118 R119 L120	D112-R116 WeakPolarHBondContact O-CB 3.21Å; D112-R116 WeakPolarHBondContact O-CG 3.38Å; D112-R116 PolarHBondContact O-N 2.93Å; D112-R116 IonicContact OD1-CZ 3.06Å; D112-R116 IonicContact OD1-NE 4Å; D112-R116 PolarHBondContact OD1-NE 2.97Å; D112-R116 IonicContact OD1-NH2 3.89Å; D112-R116 IonicContact OD2-CZ 2.82Å; D112-R116 VanDerWaalsContact OD2-CZ 3.29Å; D112-R116 IonicContact OD2-NE 3.49Å; D112-R116 PolarHBondContact OD2-NE 2.86Å; D112-R116 IonicContact OD2-NH2 3.64Å; D112-R116 PolarHBondContact OD2-NH2 2.91Å; A113-R116 PolarHBondContact O-N 3.44Å; S114-R116 VanDerWaalsContact C-N 3.35Å; S114-R116 PolarHBondContact O-N 3.48Å; R116-F118 VanDerWaalsContact C-N 3.35Å; R116-R119 PolarHBondContact O-N 2.87Å; R116-L120 WeakPolarHBondContact O-CG 3.44Å; R116-L120 PolarHBondContact O-N 3.25Å
117	C	68.4	Low	69.4	Low	80 Å²	80	114.1 Å²	114.1	54%	0.541	61%	0.614	S	S	.	*	H	α-helix	trans	-60.7	-44.8	175.2	-103.6	0	0	0	0	111.4	A113 S114 R119 L120 L121	A113-C117 WeakPolarHBondContact O-CB 3.38Å; A113-C117 PolarHBondContact O-N 2.9Å; S114-C117 PolarHBondContact O-N 3.39Å; C117-R119 PolarHBondContact O-N 3.49Å; C117-L120 PolarHBondContact O-N 3.09Å; C117-L121 PolarHBondContact O-N 3.28Å; C117-L121 VanDerWaalsContact O-N 3.09Å
118	F	73.9	Confident	69.2	Low	128 Å²	128	114.5 Å²	114.5	56%	0.561	62%	0.617	S	S	*	*	H	α-helix	trans	-64.5	-40.3	178.8	-165	-98.6	0	0	0	111.9	S114 D115 R116 L120 L121 L122	S114-F118 WeakPolarHBondContact O-CB 3.46Å; S114-F118 PolarHBondContact O-N 3.03Å; D115-F118 PolarHBondContact O-N 2.98Å; R116-F118 VanDerWaalsContact C-N 3.35Å; F118-L120 PolarHBondContact O-N 3.49Å; F118-L121 PolarHBondContact O-N 3.4Å; F118-L122 HydrophobicContact CD1-CD1 3.77Å; F118-L122 HydrophobicContact CE1-CD1 3.36Å; F118-L122 HydrophobicContact CE1-CG 4.31Å; F118-L122 HydrophobicContact CZ-CD1 4.02Å; F118-L122 PolarHBondContact O-N 3.36Å
119	R	74.8	Confident	69.8	Low	181 Å²	181	112 Å²	112	68%	0.683	61%	0.613	S	S	*	*	H	α-helix	trans	-64.5	-35.7	174.8	-73.5	175.7	-172.1	-130.3	4.7	113.3	D115 R116 C117	D115-R119 WeakPolarHBondContact O-CB 3.1Å; D115-R119 VanDerWaalsContact O-CG 3.26Å; D115-R119 WeakPolarHBondContact O-CG 3.26Å; D115-R119 PolarHBondContact O-N 3.45Å; D115-R119 IonicContact OD2-NE 2.63Å; D115-R119 IonicContact OD2-NH2 3.07Å; R116-R119 PolarHBondContact O-N 2.87Å; C117-R119 PolarHBondContact O-N 3.49Å
120	L	74.6	Confident	70.3	Confident	135 Å²	135	117.2 Å²	117.2	71%	0.707	63%	0.628	S	S	*	*	H	α-helix	trans	-73.4	-29.2	177	-75.1	170.7	0	0	0	113.2	R116 C117 F118 L122	R116-L120 WeakPolarHBondContact O-CG 3.44Å; R116-L120 PolarHBondContact O-N 3.25Å; C117-L120 PolarHBondContact O-N 3.09Å; F118-L120 PolarHBondContact O-N 3.49Å; L120-L122 VanDerWaalsContact C-N 3.32Å
121	L	74.3	Confident	71	Confident	145 Å²	145	117.4 Å²	117.4	76%	0.759	63%	0.629	S	S	*	*	H	α-helix	trans	-74.7	-20.5	177	-89.1	155.6	0	0	0	113.6	C117 F118	C117-L121 PolarHBondContact O-N 3.28Å; C117-L121 VanDerWaalsContact O-N 3.09Å; F118-L121 PolarHBondContact O-N 3.4Å
122	L	78.1	Confident	71.5	Confident	131 Å²	131	115.9 Å²	115.9	69%	0.686	63%	0.629	S	S	*	*			trans	-98.3	-8.5	-178.1	-71.2	177.7	0	0	0	114.5	F118 L120	F118-L122 HydrophobicContact CD1-CD1 3.77Å; F118-L122 HydrophobicContact CE1-CD1 3.36Å; F118-L122 HydrophobicContact CE1-CG 4.31Å; F118-L122 HydrophobicContact CZ-CD1 4.02Å; F118-L122 PolarHBondContact O-N 3.36Å; L120-L122 VanDerWaalsContact C-N 3.32Å
123	A	69	Low	72.1	Confident	141 Å²	141	119.2 Å²	119.2	100%	1.165	65%	0.648	S	S	*	*			trans	-95.3	0	178.8	0	0	0	0	0	111.5

Retrieved 123 of 123 residues in 199.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).