G4VAG4_SCHMA Loading...

Smp_200090 AlphaSync

AlphaFold DB , UniProt , Accession G4VAG4, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 31 aa.

						>G4VAG4_SCHMA|G4VAG4
MDNILCRIYILLLLSYYNVFESKQPILIIRM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure AlphaSync Parameters PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	62	Low	89.7	Confident	205 Å²	205	129.2 Å²	129.2	100%	1.01	64%	0.636	S	S	*	*				0	-29.8	0	-124.7	163.4	73.6	0	0	111	N3 I4 L5	M1-N3 PolarHBondContact O-N 2.93Å; M1-I4 PolarHBondContact O-N 3.45Å; M1-L5 PolarHBondContact O-N 3.24Å
2	D	76	Confident	90.2	Very high	128 Å²	128	128 Å²	128	68%	0.684	63%	0.633	S	S	*	*	H	α-helix	trans	-58.8	-40.8	-178.4	-54.8	-89.4	0	0	0	114.7	I4 L5 C6	D2-I4 VanDerWaalsContact C-N 3.32Å; D2-I4 PolarHBondContact O-N 2.88Å; D2-L5 PolarHBondContact O-N 3.12Å; D2-C6 WeakPolarHBondContact O-CB 3.19Å; D2-C6 PolarHBondContact O-N 3.4Å
3	N	86.7	Confident	90.4	Very high	142 Å²	142	123.7 Å²	123.7	76%	0.759	61%	0.614	S	S	*	*	H	α-helix	trans	-65.6	-34.2	-178.4	-71.5	-11.1	0	0	0	113.2	M1 R7	M1-N3 PolarHBondContact O-N 2.93Å; N3-R7 WeakPolarHBondContact O-CB 3.3Å; N3-R7 PolarHBondContact O-N 3.42Å
4	I	94.8	Very high	90.5	Very high	118 Å²	118	122.1 Å²	122.1	61%	0.605	61%	0.608	S	S	*	*	H	α-helix	trans	-71.2	-44.3	179.4	-66.2	168.6	0	0	0	109.4	M1 D2 C6 R7 I8	M1-I4 PolarHBondContact O-N 3.45Å; D2-I4 VanDerWaalsContact C-N 3.32Å; D2-I4 PolarHBondContact O-N 2.88Å; I4-C6 VanDerWaalsContact C-N 3.35Å; I4-C6 PolarHBondContact O-N 2.78Å; I4-R7 PolarHBondContact O-N 3.33Å; I4-I8 HydrophobicContact CG2-CD1 3.84Å; I4-I8 HydrophobicContact CG2-CG1 4.49Å; I4-I8 WeakPolarHBondContact O-CG1 3.39Å; I4-I8 PolarHBondContact O-N 3.02Å
5	L	91.5	Very high	90.5	Very high	126 Å²	126	118.2 Å²	118.2	66%	0.66	60%	0.597	S	S	*	*	H	α-helix	trans	-61.1	-43.9	177.3	-167.1	74.4	0	0	0	111.4	M1 D2 R7 I8 Y9	M1-L5 PolarHBondContact O-N 3.24Å; D2-L5 PolarHBondContact O-N 3.12Å; L5-R7 PolarHBondContact O-N 3.17Å; L5-I8 PolarHBondContact O-N 2.9Å; L5-Y9 WeakPolarHBondContact O-CB 3.49Å; L5-Y9 PolarHBondContact O-N 2.89Å
6	C	94.6	Very high	90.6	Very high	68 Å²	68	120.5 Å²	120.5	46%	0.459	60%	0.598	S	S	.	*	H	α-helix	trans	-61.7	-43.8	176.5	-173.3	0	0	0	0	111.9	D2 I4 I8 Y9 I10	D2-C6 WeakPolarHBondContact O-CB 3.19Å; D2-C6 PolarHBondContact O-N 3.4Å; I4-C6 VanDerWaalsContact C-N 3.35Å; I4-C6 PolarHBondContact O-N 2.78Å; C6-I8 PolarHBondContact O-N 3.37Å; C6-Y9 PolarHBondContact O-N 3.46Å; C6-I10 WeakPolarHBondContact O-CG1 3.4Å; C6-I10 PolarHBondContact O-N 2.8Å
7	R	95.5	Very high	90.5	Very high	186 Å²	186	121.5 Å²	121.5	70%	0.702	59%	0.594	S	S	*	*	H	α-helix	trans	-63.5	-41.2	176.6	-178.6	174.1	-97.8	177	-7	112.2	N3 I4 L5 Y9 I10 L11	N3-R7 WeakPolarHBondContact O-CB 3.3Å; N3-R7 PolarHBondContact O-N 3.42Å; I4-R7 PolarHBondContact O-N 3.33Å; L5-R7 PolarHBondContact O-N 3.17Å; R7-Y9 VanDerWaalsContact C-N 3.35Å; R7-I10 PolarHBondContact O-N 2.73Å; R7-L11 HydrophobicContact CG-CD1 4.22Å; R7-L11 WeakPolarHBondContact O-CB 3.34Å; R7-L11 WeakPolarHBondContact O-CG 3.31Å; R7-L11 PolarHBondContact O-N 3.37Å
8	I	97.1	Very high	90	Very high	87 Å²	87	119.3 Å²	119.3	45%	0.446	59%	0.586	S	S	.	*	H	α-helix	trans	-63.4	-43.1	175.1	-68	168.2	0	0	0	110.4	I4 L5 C6 L11 L12	I4-I8 HydrophobicContact CG2-CD1 3.84Å; I4-I8 HydrophobicContact CG2-CG1 4.49Å; I4-I8 WeakPolarHBondContact O-CG1 3.39Å; I4-I8 PolarHBondContact O-N 3.02Å; L5-I8 PolarHBondContact O-N 2.9Å; C6-I8 PolarHBondContact O-N 3.37Å; I8-L11 PolarHBondContact O-N 3.35Å; I8-L12 HydrophobicContact CG2-CD1 4.02Å; I8-L12 WeakPolarHBondContact O-CG 3.35Å; I8-L12 PolarHBondContact O-N 3.16Å
9	Y	96.5	Very high	89.6	Confident	157 Å²	157	116.7 Å²	116.7	62%	0.616	58%	0.577	S	S	*	*	H	α-helix	trans	-61.5	-46.4	177.4	-177.4	-97.3	0	0	0	112.2	L5 C6 R7 L11 L12 L13	L5-Y9 WeakPolarHBondContact O-CB 3.49Å; L5-Y9 PolarHBondContact O-N 2.89Å; C6-Y9 PolarHBondContact O-N 3.46Å; R7-Y9 VanDerWaalsContact C-N 3.35Å; Y9-L11 VanDerWaalsContact C-N 3.34Å; Y9-L11 PolarHBondContact O-N 2.88Å; Y9-L12 PolarHBondContact O-N 2.95Å; Y9-L13 WeakPolarHBondContact O-CB 3.46Å; Y9-L13 PolarHBondContact O-N 3.46Å
10	I	96.7	Very high	88.9	Confident	95 Å²	95	115.7 Å²	115.7	49%	0.487	57%	0.569	S	S	.	*	H	α-helix	trans	-60.8	-43.5	176.6	-68.5	167.9	0	0	0	110.9	C6 R7 L13 L14	C6-I10 WeakPolarHBondContact O-CG1 3.4Å; C6-I10 PolarHBondContact O-N 2.8Å; R7-I10 PolarHBondContact O-N 2.73Å; I10-L13 PolarHBondContact O-N 3.39Å; I10-L14 WeakPolarHBondContact O-CB 3.39Å; I10-L14 PolarHBondContact O-N 2.98Å
11	L	95.3	Very high	88	Confident	109 Å²	109	115.2 Å²	115.2	57%	0.571	57%	0.566	S	S	*	*	H	α-helix	trans	-65	-42	178.7	-76	169.9	0	0	0	112.3	R7 I8 Y9 L13 L14 S15	R7-L11 HydrophobicContact CG-CD1 4.22Å; R7-L11 WeakPolarHBondContact O-CB 3.34Å; R7-L11 WeakPolarHBondContact O-CG 3.31Å; R7-L11 PolarHBondContact O-N 3.37Å; I8-L11 PolarHBondContact O-N 3.35Å; Y9-L11 VanDerWaalsContact C-N 3.34Å; Y9-L11 PolarHBondContact O-N 2.88Å; L11-L13 VanDerWaalsContact C-N 3.34Å; L11-L14 PolarHBondContact O-N 3.48Å; L11-S15 WeakPolarHBondContact O-CB 3.4Å; L11-S15 PolarHBondContact O-N 3.34Å
12	L	95.1	Very high	88.3	Confident	115 Å²	115	110 Å²	110	60%	0.602	55%	0.549	S	S	*	.	H	α-helix	trans	-62.6	-42.7	174.9	-81.1	169	0	0	0	111.5	I8 Y9 S15 Y16	I8-L12 HydrophobicContact CG2-CD1 4.02Å; I8-L12 WeakPolarHBondContact O-CG 3.35Å; I8-L12 PolarHBondContact O-N 3.16Å; Y9-L12 PolarHBondContact O-N 2.95Å; L12-S15 PolarHBondContact O-N 3.34Å; L12-Y16 WeakPolarHBondContact O-CB 3.34Å; L12-Y16 PolarHBondContact O-N 2.9Å
13	L	93.9	Very high	87.8	Confident	72 Å²	72	111.4 Å²	111.4	38%	0.377	55%	0.549	S	S	.	.	H	α-helix	trans	-63.3	-46.5	178.3	-171.5	69.3	0	0	0	111.1	Y9 I10 L11 S15 Y16 Y17	Y9-L13 WeakPolarHBondContact O-CB 3.46Å; Y9-L13 PolarHBondContact O-N 3.46Å; I10-L13 PolarHBondContact O-N 3.39Å; L11-L13 VanDerWaalsContact C-N 3.34Å; L13-S15 VanDerWaalsContact C-N 3.33Å; L13-S15 PolarHBondContact O-N 2.94Å; L13-Y16 WeakPolarHBondContact O-CB 3.35Å; L13-Y16 PolarHBondContact O-N 2.89Å; L13-Y17 HydrophobicContact CD1-CD2 4.35Å; L13-Y17 HydrophobicContact CD1-CE2 3.84Å; L13-Y17 HydrophobicContact CD2-CE2 4.31Å; L13-Y17 HydrophobicContact CG-CD2 4.03Å; L13-Y17 HydrophobicContact CG-CE2 3.77Å; L13-Y17 WeakPolarHBondContact O-CD2 3.46Å; L13-Y17 PolarHBondContact O-N 3.24Å
14	L	91.8	Very high	86.3	Confident	101 Å²	101	108.5 Å²	108.5	53%	0.529	53%	0.531	S	S	.	.	H	α-helix	trans	-63.3	-40.8	177.4	-159.5	116.1	0	0	0	111.3	I10 L11 Y16 Y17 N18	I10-L14 WeakPolarHBondContact O-CB 3.39Å; I10-L14 PolarHBondContact O-N 2.98Å; L11-L14 PolarHBondContact O-N 3.48Å; L14-Y16 VanDerWaalsContact C-N 3.33Å; L14-Y16 PolarHBondContact O-N 3.18Å; L14-Y17 PolarHBondContact O-N 2.85Å; L14-N18 WeakPolarHBondContact O-CB 3.42Å; L14-N18 VanDerWaalsContact O-CG 3.27Å; L14-N18 PolarHBondContact O-N 2.92Å; L14-N18 PolarHBondContact O-ND2 3.33Å
15	S	90.3	Very high	84.3	Confident	64 Å²	64	107.8 Å²	107.8	45%	0.448	53%	0.534	S	S	.	.	H	α-helix	trans	-63.1	-39.2	173.9	-172	0	0	0	0	112.1	L11 L12 L13 N18 V19	L11-S15 WeakPolarHBondContact O-CB 3.4Å; L11-S15 PolarHBondContact O-N 3.34Å; L12-S15 PolarHBondContact O-N 3.34Å; L13-S15 VanDerWaalsContact C-N 3.33Å; L13-S15 PolarHBondContact O-N 2.94Å; S15-N18 PolarHBondContact O-N 3.44Å; S15-V19 VanDerWaalsContact O-CG2 3.31Å; S15-V19 WeakPolarHBondContact O-CG2 3.33Å; S15-V19 PolarHBondContact O-N 3.04Å
16	Y	91.3	Very high	82.5	Confident	155 Å²	155	106.9 Å²	106.9	61%	0.608	53%	0.529	S	S	*	.	H	α-helix	trans	-63.1	-45.5	176.7	176	-95.8	0	0	0	111.1	L12 L13 L14 V19 F20	L12-Y16 WeakPolarHBondContact O-CB 3.34Å; L12-Y16 PolarHBondContact O-N 2.9Å; L13-Y16 WeakPolarHBondContact O-CB 3.35Å; L13-Y16 PolarHBondContact O-N 2.89Å; L14-Y16 VanDerWaalsContact C-N 3.33Å; L14-Y16 PolarHBondContact O-N 3.18Å; Y16-V19 PolarHBondContact O-N 2.95Å; Y16-F20 WeakPolarHBondContact O-CB 3.49Å; Y16-F20 PolarHBondContact O-N 3.46Å
17	Y	89.3	Confident	80.5	Confident	137 Å²	137	109.8 Å²	109.8	54%	0.537	54%	0.539	S	S	.	.	H	α-helix	trans	-62.8	-43	174.3	-80.3	-68.2	0	0	0	112.1	L13 L14 V19 F20 E21	L13-Y17 HydrophobicContact CD1-CD2 4.35Å; L13-Y17 HydrophobicContact CD1-CE2 3.84Å; L13-Y17 HydrophobicContact CD2-CE2 4.31Å; L13-Y17 HydrophobicContact CG-CD2 4.03Å; L13-Y17 HydrophobicContact CG-CE2 3.77Å; L13-Y17 WeakPolarHBondContact O-CD2 3.46Å; L13-Y17 PolarHBondContact O-N 3.24Å; L14-Y17 PolarHBondContact O-N 2.85Å; Y17-V19 PolarHBondContact O-N 3.31Å; Y17-F20 CarbonylContact O-C 3.55Å; Y17-F20 WeakPolarHBondContact O-CB 3.41Å; Y17-F20 PolarHBondContact O-N 3.28Å; Y17-F20 VanDerWaalsContact O-N 3.16Å; Y17-E21 WeakPolarHBondContact O-CB 3.5Å; Y17-E21 PolarHBondContact O-N 3.45Å
18	N	81.4	Confident	78.6	Confident	83 Å²	83	107 Å²	107	44%	0.444	54%	0.537	S	S	.	.	H	α-helix	trans	-64.5	-39.1	177.5	-73.5	-20.9	0	0	0	112.6	L14 S15 F20 E21 S22	L14-N18 WeakPolarHBondContact O-CB 3.42Å; L14-N18 VanDerWaalsContact O-CG 3.27Å; L14-N18 PolarHBondContact O-N 2.92Å; L14-N18 PolarHBondContact O-ND2 3.33Å; S15-N18 PolarHBondContact O-N 3.44Å; N18-F20 VanDerWaalsContact C-N 3.3Å; N18-E21 PolarHBondContact O-N 3.49Å; N18-S22 VanDerWaalsContact O-CB 3.3Å; N18-S22 WeakPolarHBondContact O-CB 3.37Å; N18-S22 PolarHBondContact O-N 2.9Å; N18-S22 PolarHBondContact O-OG 3.49Å
19	V	81.7	Confident	76.6	Confident	70 Å²	70	109.6 Å²	109.6	42%	0.424	55%	0.55	S	S	.	*	H	α-helix	trans	-65.2	-39.3	174.3	170.3	0	0	0	0	110.1	S15 Y16 Y17 S22 K23	S15-V19 VanDerWaalsContact O-CG2 3.31Å; S15-V19 WeakPolarHBondContact O-CG2 3.33Å; S15-V19 PolarHBondContact O-N 3.04Å; Y16-V19 PolarHBondContact O-N 2.95Å; Y17-V19 PolarHBondContact O-N 3.31Å; V19-S22 PolarHBondContact O-OG 3.34Å; V19-K23 WeakPolarHBondContact O-CG 3.2Å; V19-K23 PolarHBondContact O-N 3.47Å
20	F	76.4	Confident	74.4	Confident	95 Å²	95	112.9 Å²	112.9	42%	0.417	56%	0.562	S	S	.	*	H	α-helix	trans	-67.5	-41.9	175.9	-172.1	-99.4	0	0	0	112.4	Y16 Y17 N18 K23 Q24	Y16-F20 WeakPolarHBondContact O-CB 3.49Å; Y16-F20 PolarHBondContact O-N 3.46Å; Y17-F20 CarbonylContact O-C 3.55Å; Y17-F20 WeakPolarHBondContact O-CB 3.41Å; Y17-F20 PolarHBondContact O-N 3.28Å; Y17-F20 VanDerWaalsContact O-N 3.16Å; N18-F20 VanDerWaalsContact C-N 3.3Å; F20-K23 CarbonylContact O-C 3.54Å; F20-K23 WeakPolarHBondContact O-CA 3.43Å; F20-K23 WeakPolarHBondContact O-CB 3.47Å; F20-K23 PolarHBondContact O-N 3.46Å; F20-K23 VanDerWaalsContact O-N 3.12Å; F20-Q24 HydrophobicContact CE1-CG 4.19Å; F20-Q24 PolarHBondContact O-N 3.36Å
21	E	71	Confident	71.8	Confident	107 Å²	107	120.1 Å²	120.1	50%	0.5	60%	0.596	S	S	.	*	H	α-helix	trans	-67.5	-40	177.2	-159.2	-175.6	112.4	0	0	110.9	Y17 N18 K23 Q24	Y17-E21 WeakPolarHBondContact O-CB 3.5Å; Y17-E21 PolarHBondContact O-N 3.45Å; N18-E21 PolarHBondContact O-N 3.49Å; E21-K23 PolarHBondContact O-N 3.33Å; E21-K23 VanDerWaalsContact O-N 3.17Å; E21-Q24 CarbonylContact O-C 3.19Å; E21-Q24 WeakPolarHBondContact O-CA 3.48Å; E21-Q24 PolarHBondContact O-N 3.06Å
22	S	67.5	Low	70.7	Confident	94 Å²	94	120.7 Å²	120.7	66%	0.657	60%	0.598	S	S	*	*	H	α-helix	trans	-61.5	-26.2	172.8	73.7	0	0	0	0	112.9	N18 V19	N18-S22 VanDerWaalsContact O-CB 3.3Å; N18-S22 WeakPolarHBondContact O-CB 3.37Å; N18-S22 PolarHBondContact O-N 2.9Å; N18-S22 PolarHBondContact O-OG 3.49Å; V19-S22 PolarHBondContact O-OG 3.34Å
23	K	65.4	Low	69.4	Low	159 Å²	159	121 Å²	121	69%	0.691	60%	0.597	S	S	*	*	H	α-helix	trans	-84	-17.9	172.4	-70	176	-179.6	-176.3	0	112.8	V19 F20 E21 P25	V19-K23 WeakPolarHBondContact O-CG 3.2Å; V19-K23 PolarHBondContact O-N 3.47Å; F20-K23 CarbonylContact O-C 3.54Å; F20-K23 WeakPolarHBondContact O-CA 3.43Å; F20-K23 WeakPolarHBondContact O-CB 3.47Å; F20-K23 PolarHBondContact O-N 3.46Å; F20-K23 VanDerWaalsContact O-N 3.12Å; E21-K23 PolarHBondContact O-N 3.33Å; E21-K23 VanDerWaalsContact O-N 3.17Å; K23-P25 WeakPolarHBondContact O-CD 3.34Å
24	Q	54.2	Low	68	Low	80 Å²	80	123.7 Å²	123.7	37%	0.374	61%	0.61	S	S	.	*	S	Bend	trans	-102.8	89.9	174.2	-75.2	-176.1	-21.7	0	0	109.1	F20 E21 I26	F20-Q24 HydrophobicContact CE1-CG 4.19Å; F20-Q24 PolarHBondContact O-N 3.36Å; E21-Q24 CarbonylContact O-C 3.19Å; E21-Q24 WeakPolarHBondContact O-CA 3.48Å; E21-Q24 PolarHBondContact O-N 3.06Å; Q24-I26 PolarHBondContact O-N 2.98Å
25	P	53.7	Low	66.6	Low	103 Å²	103	125.1 Å²	125.1	67%	0.669	61%	0.614	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.1	116.1	173.4	26.7	-33	0	0	0	108.5	K23 L27	K23-P25 WeakPolarHBondContact O-CD 3.34Å; P25-L27 PolarHBondContact O-N 3.41Å
26	I	54.5	Low	65.1	Low	108 Å²	108	128.9 Å²	128.9	55%	0.554	63%	0.625	S	S	*	*	T	Hydrogen-bonded Turn	trans	74.1	37.4	144.5	-46.2	153.6	0	0	0	113.8	Q24 I28 I29	Q24-I26 PolarHBondContact O-N 2.98Å; I26-I28 VanDerWaalsContact C-N 3.32Å; I26-I29 HydrophobicContact CG2-CB 3.52Å; I26-I29 HydrophobicContact CG2-CD1 4.41Å; I26-I29 HydrophobicContact CG2-CG2 3.34Å
27	L	52.2	Low	63.4	Low	128 Å²	128	127.1 Å²	127.1	67%	0.67	63%	0.626	S	S	*	*	S	Bend	trans	-77.5	-16.8	170	-113	158.1	0	0	0	113.6	P25	P25-L27 PolarHBondContact O-N 3.41Å
28	I	55.7	Low	61.5	Low	129 Å²	129	126.4 Å²	126.4	66%	0.662	63%	0.632	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.6	-10.5	177.1	-61.2	172.7	0	0	0	112.6	I26	I26-I28 VanDerWaalsContact C-N 3.32Å
29	I	54.5	Low	60	Low	140 Å²	140	129.8 Å²	129.8	72%	0.718	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.5	2.9	-179.7	-98.9	163	0	0	0	114.1	I26	I26-I29 HydrophobicContact CG2-CB 3.52Å; I26-I29 HydrophobicContact CG2-CD1 4.41Å; I26-I29 HydrophobicContact CG2-CG2 3.34Å
30	R	49.7	Very low	58.2	Low	227 Å²	227	134.8 Å²	134.8	86%	0.857	67%	0.665	S	S	*	*			trans	-106.3	11.9	178.4	-75.3	-169.6	173	171	-0.5	116.1
31	M	43.7	Very low	56.6	Low	247 Å²	247	138.4 Å²	138.4	100%	1.217	69%	0.688	S	S	*	*			trans	-133.2	0	156.8	-93.1	-169.9	176.6	0	0	109.5

Retrieved 31 of 31 residues in 84.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).