G4VAN1_SCHMA Loading...

SAYSvFN domain-containing protein

AlphaFold DB , UniProt , Accession G4VAN1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 137 aa.

						>G4VAN1_SCHMA|G4VAN1
MVPKFKQRSYFEIKAQLDAYRLANPVTPDFKPPIVDVLQKPVNSSVVKEPSTILARITAIWNLWYVQFIITLLLWLIAIKIEFGAVFFIMGALYWIWVWGTIKNPKPRISNNPDEQIVSASFFFDNSPIPSNIMSSK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.4	Very low	65.9	Low	243 Å²	243	162.2 Å²	162.2	100%	1.197	77%	0.767	S	S	*	*				0	109.7	0	-95.3	171.3	166.9	0	0	107.9
2	V	52.5	Low	67.5	Low	137 Å²	137	156.7 Å²	156.7	83%	0.83	74%	0.74	S	S	*	*			trans	-84.3	128.7	173.4	179.9	0	0	0	0	107.6	K4	V2-K4 PolarHBondContact O-N 3.31Å
3	P	63.2	Low	68.8	Low	98 Å²	98	152 Å²	152	64%	0.636	72%	0.721	S	S	*	*			trans	-65.6	125.8	178.4	25.8	-31.2	0	0	0	109.7	F5	P3-F5 PolarHBondContact O-N 3.03Å; P3-F5 VanDerWaalsContact O-N 3.1Å
4	K	59.5	Low	70.2	Confident	210 Å²	210	147.6 Å²	147.6	91%	0.913	70%	0.698	S	S	*	*			trans	-63.8	109.5	168.3	-79.4	-176.7	175	180	0	108	V2 K6	V2-K4 PolarHBondContact O-N 3.31Å; K4-K6 PolarHBondContact O-N 3.16Å
5	F	62.1	Low	71.4	Confident	192 Å²	192	141.7 Å²	141.7	84%	0.842	68%	0.684	S	S	*	*			trans	-63.7	108.3	166.8	-76.3	-84.8	0	0	0	108.4	P3 Q7	P3-F5 PolarHBondContact O-N 3.03Å; P3-F5 VanDerWaalsContact O-N 3.1Å; F5-Q7 PolarHBondContact O-N 2.89Å; F5-Q7 VanDerWaalsContact O-N 3.15Å
6	K	67.1	Low	72.4	Confident	192 Å²	192	139.2 Å²	139.2	84%	0.835	67%	0.671	S	S	*	*			trans	-68.3	109.2	171.1	-167.8	179.6	-177.2	-172	0	106.9	K4 R8	K4-K6 PolarHBondContact O-N 3.16Å; K6-R8 PolarHBondContact O-N 2.83Å
7	Q	63.9	Low	73.2	Confident	193 Å²	193	135.8 Å²	135.8	90%	0.902	66%	0.656	S	S	*	*			trans	-60.5	108.6	177	-137.7	174.2	0.1	0	0	107.9	F5	F5-Q7 PolarHBondContact O-N 2.89Å; F5-Q7 VanDerWaalsContact O-N 3.15Å
8	R	70.7	Confident	73.9	Confident	139 Å²	139	131.7 Å²	131.7	53%	0.525	64%	0.639	S	S	.	*			trans	-71.4	137.2	174.8	-73.6	-164.4	-178.2	165.3	1	108.9	K6 E12 I13 Q16	K6-R8 PolarHBondContact O-N 2.83Å; R8-E12 WeakPolarHBondContact CA-OE2 3.17Å; R8-E12 HydrophobicContact CB-CB 4.44Å; R8-E12 VanDerWaalsContact CB-OE2 3.28Å; R8-E12 WeakPolarHBondContact CB-OE2 3.44Å; R8-E12 VanDerWaalsContact CG-OE2 3.26Å; R8-E12 WeakPolarHBondContact CG-OE2 3.4Å; R8-I13 HydrophobicContact CB-CD1 4.44Å; R8-I13 HydrophobicContact CB-CG1 4.13Å; R8-Q16 VanDerWaalsContact NH1-CD 3.32Å
9	S	78.9	Confident	74.7	Confident	63 Å²	63	127.7 Å²	127.7	44%	0.441	63%	0.629	S	S	.	*			trans	-64.3	146.4	175.8	178.3	0	0	0	0	109.8	F11 E12 I13	S9-F11 PolarHBondContact O-N 3.09Å; S9-F11 VanDerWaalsContact O-N 3.09Å; S9-E12 WeakPolarHBondContact O-CB 3.33Å; S9-E12 PolarHBondContact O-N 2.69Å; S9-I13 PolarHBondContact O-N 3.21Å
10	Y	81.6	Confident	75.1	Confident	161 Å²	161	129.2 Å²	129.2	63%	0.631	63%	0.629	S	S	*	*	H	α-helix	trans	-47.8	-39.6	175.3	168.8	-97.6	0	0	0	112.2	E12 I13 K14	Y10-E12 VanDerWaalsContact C-N 3.34Å; Y10-E12 PolarHBondContact O-N 3.27Å; Y10-I13 PolarHBondContact O-N 2.8Å; Y10-K14 HydrophobicContact CE1-CD 4.04Å; Y10-K14 WeakPolarHBondContact O-CB 3.44Å; Y10-K14 PolarHBondContact O-N 2.84Å
11	F	81.4	Confident	75.4	Confident	156 Å²	156	130.1 Å²	130.1	68%	0.684	63%	0.625	S	S	*	*	H	α-helix	trans	-64.8	-34.1	178.9	-67.6	-77.3	0	0	0	113.4	S9 A15	S9-F11 PolarHBondContact O-N 3.09Å; S9-F11 VanDerWaalsContact O-N 3.09Å; F11-A15 VanDerWaalsContact O-CB 3.28Å; F11-A15 WeakPolarHBondContact O-CB 2.97Å; F11-A15 PolarHBondContact O-N 3.07Å
12	E	84.2	Confident	77.3	Confident	96 Å²	96	125.7 Å²	125.7	45%	0.449	61%	0.606	S	S	.	*	H	α-helix	trans	-69.4	-42.1	176.1	-66.6	-178.8	163.7	0	0	111.2	R8 S9 Y10 A15 Q16	R8-E12 WeakPolarHBondContact CA-OE2 3.17Å; R8-E12 HydrophobicContact CB-CB 4.44Å; R8-E12 VanDerWaalsContact CB-OE2 3.28Å; R8-E12 WeakPolarHBondContact CB-OE2 3.44Å; R8-E12 VanDerWaalsContact CG-OE2 3.26Å; R8-E12 WeakPolarHBondContact CG-OE2 3.4Å; S9-E12 WeakPolarHBondContact O-CB 3.33Å; S9-E12 PolarHBondContact O-N 2.69Å; Y10-E12 VanDerWaalsContact C-N 3.34Å; Y10-E12 PolarHBondContact O-N 3.27Å; E12-A15 PolarHBondContact O-N 3.4Å; E12-Q16 WeakPolarHBondContact O-CG 3.36Å; E12-Q16 PolarHBondContact O-N 3Å
13	I	85.3	Confident	78.8	Confident	96 Å²	96	122.7 Å²	122.7	49%	0.492	60%	0.596	S	S	.	*	H	α-helix	trans	-65.3	-44.1	178.1	-58.6	169.5	0	0	0	109.6	R8 S9 Y10 Q16 L17	R8-I13 HydrophobicContact CB-CD1 4.44Å; R8-I13 HydrophobicContact CB-CG1 4.13Å; S9-I13 PolarHBondContact O-N 3.21Å; Y10-I13 PolarHBondContact O-N 2.8Å; I13-Q16 PolarHBondContact O-N 2.7Å; I13-L17 WeakPolarHBondContact O-CB 3.5Å; I13-L17 PolarHBondContact O-N 2.72Å
14	K	87.9	Confident	79.5	Confident	90 Å²	90	121.9 Å²	121.9	39%	0.391	59%	0.586	S	S	.	*	H	α-helix	trans	-62.7	-45.3	176.8	-175.6	174.5	-176.7	-59	0	111.7	Y10 Q16 L17 D18	Y10-K14 HydrophobicContact CE1-CD 4.04Å; Y10-K14 WeakPolarHBondContact O-CB 3.44Å; Y10-K14 PolarHBondContact O-N 2.84Å; K14-Q16 VanDerWaalsContact C-N 3.33Å; K14-Q16 PolarHBondContact O-N 2.69Å; K14-L17 PolarHBondContact O-N 2.84Å; K14-D18 IonicContact NZ-OD2 2.81Å; K14-D18 PolarHBondContact NZ-OD2 3.36Å; K14-D18 WeakPolarHBondContact O-CB 3.28Å; K14-D18 PolarHBondContact O-N 2.99Å
15	A	88.3	Confident	80	Confident	60 Å²	60	116.5 Å²	116.5	50%	0.496	57%	0.572	S	S	.	*	H	α-helix	trans	-62.6	-39.2	177.5	0	0	0	0	0	112.3	F11 E12 A19	F11-A15 VanDerWaalsContact O-CB 3.28Å; F11-A15 WeakPolarHBondContact O-CB 2.97Å; F11-A15 PolarHBondContact O-N 3.07Å; E12-A15 PolarHBondContact O-N 3.4Å; A15-A19 VanDerWaalsContact O-CB 3.28Å; A15-A19 WeakPolarHBondContact O-CB 3.41Å; A15-A19 PolarHBondContact O-N 3.45Å
16	Q	87.2	Confident	80.2	Confident	101 Å²	101	113.8 Å²	113.8	47%	0.472	57%	0.571	S	S	.	*	H	α-helix	trans	-66.6	-39.8	174.8	-75.9	178	12.2	0	0	112.5	R8 E12 I13 K14 A19 Y20	R8-Q16 VanDerWaalsContact NH1-CD 3.32Å; E12-Q16 WeakPolarHBondContact O-CG 3.36Å; E12-Q16 PolarHBondContact O-N 3Å; I13-Q16 PolarHBondContact O-N 2.7Å; K14-Q16 VanDerWaalsContact C-N 3.33Å; K14-Q16 PolarHBondContact O-N 2.69Å; Q16-A19 PolarHBondContact O-N 2.89Å; Q16-Y20 WeakPolarHBondContact O-CB 3.41Å; Q16-Y20 PolarHBondContact O-N 3.35Å
17	L	86.1	Confident	79.9	Confident	81 Å²	81	109.8 Å²	109.8	42%	0.424	56%	0.563	S	S	.	*	H	α-helix	trans	-66.6	-42.3	176.8	-172.9	65.5	0	0	0	111.6	I13 K14 Y20 R21	I13-L17 WeakPolarHBondContact O-CB 3.5Å; I13-L17 PolarHBondContact O-N 2.72Å; K14-L17 PolarHBondContact O-N 2.84Å; L17-Y20 PolarHBondContact O-N 2.93Å; L17-R21 WeakPolarHBondContact O-CB 3.35Å; L17-R21 WeakPolarHBondContact O-CG 3.38Å; L17-R21 PolarHBondContact O-N 2.86Å
18	D	86.5	Confident	79.6	Confident	63 Å²	63	105.4 Å²	105.4	34%	0.337	55%	0.551	S	S	.	*	H	α-helix	trans	-66.9	-39.8	177.5	-71.4	-19.1	0	0	0	110.6	K14 R21 L22	K14-D18 IonicContact NZ-OD2 2.81Å; K14-D18 PolarHBondContact NZ-OD2 3.36Å; K14-D18 WeakPolarHBondContact O-CB 3.28Å; K14-D18 PolarHBondContact O-N 2.99Å; D18-R21 PolarHBondContact O-N 2.8Å; D18-R21 IonicContact OD1-NH1 3.73Å; D18-L22 WeakPolarHBondContact O-CB 2.84Å; D18-L22 PolarHBondContact O-N 2.76Å
19	A	88.1	Confident	78.6	Confident	56 Å²	56	105.7 Å²	105.7	46%	0.463	56%	0.563	S	S	.	*	H	α-helix	trans	-63.9	-39.6	172.5	0	0	0	0	0	112.7	A15 Q16 L22 A23	A15-A19 VanDerWaalsContact O-CB 3.28Å; A15-A19 WeakPolarHBondContact O-CB 3.41Å; A15-A19 PolarHBondContact O-N 3.45Å; Q16-A19 PolarHBondContact O-N 2.89Å; A19-L22 PolarHBondContact O-N 2.81Å; A19-A23 WeakPolarHBondContact O-CB 2.93Å; A19-A23 PolarHBondContact O-N 2.89Å
20	Y	82.6	Confident	77.2	Confident	156 Å²	156	111.9 Å²	111.9	61%	0.612	58%	0.583	S	S	*	*	H	α-helix	trans	-67.1	-40.6	177.2	-174.2	-94.1	0	0	0	112.3	Q16 L17 L22 A23 N24	Q16-Y20 WeakPolarHBondContact O-CB 3.41Å; Q16-Y20 PolarHBondContact O-N 3.35Å; L17-Y20 PolarHBondContact O-N 2.93Å; Y20-L22 VanDerWaalsContact C-N 3.32Å; Y20-A23 PolarHBondContact O-N 3.29Å; Y20-N24 VanDerWaalsContact CE2-ND2 3.28Å; Y20-N24 WeakPolarHBondContact CE2-ND2 3.39Å; Y20-N24 PolarHBondContact O-N 3.48Å; Y20-N24 PolarHBondContact O-ND2 2.71Å
21	R	83	Confident	75.6	Confident	149 Å²	149	112.6 Å²	112.6	56%	0.562	59%	0.589	S	S	*	*	H	α-helix	trans	-65.3	-34.9	174.2	-76.1	174.1	173.7	156.1	-3.6	112.6	L17 D18 N24	L17-R21 WeakPolarHBondContact O-CB 3.35Å; L17-R21 WeakPolarHBondContact O-CG 3.38Å; L17-R21 PolarHBondContact O-N 2.86Å; D18-R21 PolarHBondContact O-N 2.8Å; D18-R21 IonicContact OD1-NH1 3.73Å; R21-N24 CarbonylContact O-C 3.31Å; R21-N24 VanDerWaalsContact O-C 3.31Å
22	L	83.9	Confident	74.4	Confident	151 Å²	151	110.2 Å²	110.2	79%	0.791	59%	0.589	S	S	*	*	H	α-helix	trans	-72.1	-37	175.8	-167.3	71	0	0	0	111.7	D18 A19 Y20	D18-L22 WeakPolarHBondContact O-CB 2.84Å; D18-L22 PolarHBondContact O-N 2.76Å; A19-L22 PolarHBondContact O-N 2.81Å; Y20-L22 VanDerWaalsContact C-N 3.32Å
23	A	83.9	Confident	72.8	Confident	74 Å²	74	110.5 Å²	110.5	61%	0.612	60%	0.599	S	S	*	*	H	α-helix	trans	-73.3	-32.4	176.8	0	0	0	0	0	113	A19 Y20 P25	A19-A23 WeakPolarHBondContact O-CB 2.93Å; A19-A23 PolarHBondContact O-N 2.89Å; Y20-A23 PolarHBondContact O-N 3.29Å; A23-P25 WeakPolarHBondContact O-CD 3.28Å
24	N	77.2	Confident	70.9	Confident	81 Å²	81	113.9 Å²	113.9	43%	0.433	62%	0.617	S	S	.	*	S	Bend	trans	-121.9	78.7	178.4	-60.1	-66.6	0	0	0	109.3	Y20 R21 V26	Y20-N24 VanDerWaalsContact CE2-ND2 3.28Å; Y20-N24 WeakPolarHBondContact CE2-ND2 3.39Å; Y20-N24 PolarHBondContact O-N 3.48Å; Y20-N24 PolarHBondContact O-ND2 2.71Å; R21-N24 CarbonylContact O-C 3.31Å; R21-N24 VanDerWaalsContact O-C 3.31Å; N24-V26 PolarHBondContact O-N 3.48Å
25	P	70.2	Confident	69.2	Low	97 Å²	97	114.1 Å²	114.1	63%	0.63	63%	0.626	S	S	*	*			trans	-58.8	118.7	172.4	24.7	-31.7	0	0	0	107.9	A23 T27	A23-P25 WeakPolarHBondContact O-CD 3.28Å; P25-T27 VanDerWaalsContact C-N 3.26Å; P25-T27 PolarHBondContact O-N 3.43Å
26	V	66.5	Low	67.1	Low	135 Å²	135	118.5 Å²	118.5	82%	0.818	64%	0.641	S	S	*	*			trans	-66.3	92.6	171.9	179.5	0	0	0	0	106.4	N24 P28	N24-V26 PolarHBondContact O-N 3.48Å; V26-P28 WeakPolarHBondContact O-CD 3.28Å
27	T	61.1	Low	65.4	Low	108 Å²	108	118.8 Å²	118.8	66%	0.663	65%	0.649	S	S	*	*			trans	-61.3	123	161.7	10.2	0	0	0	0	106.4	P25 D29	P25-T27 VanDerWaalsContact C-N 3.26Å; P25-T27 PolarHBondContact O-N 3.43Å; T27-D29 PolarHBondContact O-N 2.99Å
28	P	56.7	Low	63.4	Low	100 Å²	100	122 Å²	122	65%	0.649	67%	0.666	S	S	*	*			trans	-75.9	72.9	174.3	32.8	-31.6	0	0	0	107.3	V26 F30	V26-P28 WeakPolarHBondContact O-CD 3.28Å; P28-F30 HydrophobicContact CB-CD2 4.09Å; P28-F30 HydrophobicContact CB-CE2 4.14Å; P28-F30 PolarHBondContact O-N 2.93Å
29	D	50.9	Low	61.3	Low	145 Å²	145	127.9 Å²	127.9	78%	0.775	69%	0.691	S	S	*	*			trans	-73.9	83.8	165	-107.3	-36.4	0	0	0	107.1	T27 K31	T27-D29 PolarHBondContact O-N 2.99Å; D29-K31 PolarHBondContact O-N 3.32Å
30	F	48.3	Very low	59.4	Low	194 Å²	194	133.4 Å²	133.4	85%	0.851	71%	0.705	S	S	*	*			trans	-62.8	80.7	161.6	-85.2	-88.1	0	0	0	108.6	P28	P28-F30 HydrophobicContact CB-CD2 4.09Å; P28-F30 HydrophobicContact CB-CE2 4.14Å; P28-F30 PolarHBondContact O-N 2.93Å
31	K	48.9	Very low	57.5	Low	175 Å²	175	130.4 Å²	130.4	76%	0.761	71%	0.705	S	S	*	*			trans	-139	99.2	152.9	-153.3	176.9	-171.2	-175.8	0	106.9	D29 P33	D29-K31 PolarHBondContact O-N 3.32Å; K31-P33 WeakPolarHBondContact O-CD 3.44Å
32	P	56.3	Low	55.8	Low	106 Å²	106	129.2 Å²	129.2	69%	0.688	71%	0.713	S	S	*	*			trans	-59.7	118.6	169.5	25.5	-29.8	0	0	0	105.9	I34	P32-I34 PolarHBondContact O-N 2.89Å; P32-I34 VanDerWaalsContact O-N 3.09Å
33	P	50.4	Low	53.8	Low	103 Å²	103	128.5 Å²	128.5	67%	0.669	71%	0.711	S	S	*	*			trans	-62.5	120.9	164.7	26.8	-27.3	0	0	0	104.5	K31 V35	K31-P33 WeakPolarHBondContact O-CD 3.44Å; P33-V35 HydrophobicContact CB-CG2 3.83Å; P33-V35 HydrophobicContact CG-CG2 3.95Å; P33-V35 PolarHBondContact O-N 3.34Å
34	I	46.1	Very low	52	Low	167 Å²	167	128.8 Å²	128.8	86%	0.856	71%	0.708	S	S	*	*			trans	-63.9	75.1	161.9	-60	165.7	0	0	0	104.5	P32 D36	P32-I34 PolarHBondContact O-N 2.89Å; P32-I34 VanDerWaalsContact O-N 3.09Å; I34-D36 PolarHBondContact O-N 2.87Å
35	V	50.5	Low	50.5	Low	95 Å²	95	129.6 Å²	129.6	58%	0.576	72%	0.72	S	S	*	*			trans	-77.1	105.2	162.4	-174.6	0	0	0	0	102	P33 V37	P33-V35 HydrophobicContact CB-CG2 3.83Å; P33-V35 HydrophobicContact CG-CG2 3.95Å; P33-V35 PolarHBondContact O-N 3.34Å; V35-V37 HydrophobicContact CB-CG2 3.95Å; V35-V37 HydrophobicContact CG1-CG2 3.51Å; V35-V37 PolarHBondContact O-N 2.71Å
36	D	44.2	Very low	49.4	Very low	152 Å²	152	130.8 Å²	130.8	81%	0.813	73%	0.725	S	S	*	*			trans	-60.9	73.2	163.1	-155.7	3.5	0	0	0	106.5	I34 L38	I34-D36 PolarHBondContact O-N 2.87Å; D36-L38 PolarHBondContact O-N 2.74Å
37	V	52.6	Low	48.5	Very low	106 Å²	106	129.5 Å²	129.5	64%	0.642	72%	0.717	S	S	*	*			trans	-70.9	89	171.4	179.6	0	0	0	0	103.1	V35 Q39	V35-V37 HydrophobicContact CB-CG2 3.95Å; V35-V37 HydrophobicContact CG1-CG2 3.51Å; V35-V37 PolarHBondContact O-N 2.71Å; V37-Q39 PolarHBondContact O-N 2.72Å
38	L	43	Very low	48	Very low	150 Å²	150	132.8 Å²	132.8	79%	0.785	72%	0.723	S	S	*	*			trans	-38	98.3	159	-172.6	76	0	0	0	106.5	D36 K40	D36-L38 PolarHBondContact O-N 2.74Å; L38-K40 PolarHBondContact O-N 2.74Å
39	Q	43.5	Very low	47.8	Very low	186 Å²	186	134 Å²	134	87%	0.869	72%	0.72	S	S	*	*			trans	-66.9	73.8	174	-104.8	-178.4	-5.9	0	0	105.8	V37 P41	V37-Q39 PolarHBondContact O-N 2.72Å; Q39-P41 WeakPolarHBondContact O-CD 3.37Å
40	K	46.8	Very low	48	Very low	171 Å²	171	130.3 Å²	130.3	74%	0.743	70%	0.703	S	S	*	*			trans	-62	117.9	159.2	-170.7	176.9	-175.8	-178.9	0	103.7	L38 V42	L38-K40 PolarHBondContact O-N 2.74Å; K40-V42 VanDerWaalsContact C-N 3.34Å; K40-V42 PolarHBondContact O-N 3.44Å
41	P	43.1	Very low	48.5	Very low	94 Å²	94	125 Å²	125	61%	0.61	69%	0.691	S	S	*	*			trans	-59.5	108.4	174.7	25.7	-31.4	0	0	0	105.1	Q39 N43	Q39-P41 WeakPolarHBondContact O-CD 3.37Å; P41-N43 PolarHBondContact O-N 2.92Å
42	V	48.1	Very low	49	Very low	123 Å²	123	120 Å²	120	75%	0.745	68%	0.675	S	S	*	*			trans	-65.5	90.9	160.3	173.1	0	0	0	0	102.3	K40 S44	K40-V42 VanDerWaalsContact C-N 3.34Å; K40-V42 PolarHBondContact O-N 3.44Å; V42-S44 PolarHBondContact O-N 3.44Å
43	N	42.5	Very low	49.2	Very low	137 Å²	137	120.1 Å²	120.1	73%	0.733	67%	0.668	S	S	*	*			trans	-60.9	67.3	155.5	-59.6	-16.1	0	0	0	105.3	P41 S45	P41-N43 PolarHBondContact O-N 2.92Å; N43-S45 PolarHBondContact O-N 3.24Å
44	S	45	Very low	49.7	Very low	80 Å²	80	120.2 Å²	120.2	56%	0.559	66%	0.663	S	S	*	*			trans	-64	94.4	155.8	50.4	0	0	0	0	102.4	V42 V46	V42-S44 PolarHBondContact O-N 3.44Å; S44-V46 PolarHBondContact O-N 2.94Å
45	S	46.2	Very low	50.4	Low	98 Å²	98	114.9 Å²	114.9	69%	0.685	64%	0.643	S	S	*	*			trans	-47.3	93.1	150	41.4	0	0	0	0	105.3	N43 V47	N43-S45 PolarHBondContact O-N 3.24Å; S45-V47 PolarHBondContact O-N 2.91Å
46	V	47.4	Very low	51	Low	121 Å²	121	119.5 Å²	119.5	73%	0.733	65%	0.65	S	S	*	*			trans	-59.6	90.5	157.3	176.3	0	0	0	0	102.2	S44 K48	S44-V46 PolarHBondContact O-N 2.94Å; V46-K48 PolarHBondContact O-N 3.36Å
47	V	47.1	Very low	52.1	Low	108 Å²	108	116.6 Å²	116.6	66%	0.655	63%	0.634	S	S	*	*			trans	-60.4	95.2	171.9	175	0	0	0	0	103.5	S45 E49	S45-V47 PolarHBondContact O-N 2.91Å; V47-E49 VanDerWaalsContact C-N 3.29Å; V47-E49 HydrophobicContact CG1-CG 4.29Å; V47-E49 PolarHBondContact O-N 2.99Å
48	K	50.9	Low	52.6	Low	178 Å²	178	115.3 Å²	115.3	77%	0.774	63%	0.627	S	S	*	*			trans	-53.5	100.9	165.3	-95.6	-179.1	177.1	179.5	0	105	V46 P50	V46-K48 PolarHBondContact O-N 3.36Å; K48-P50 HydrophobicContact CB-CG 4.21Å; K48-P50 WeakPolarHBondContact O-CD 3.41Å
49	E	51.7	Low	53.7	Low	126 Å²	126	110.9 Å²	110.9	59%	0.589	61%	0.611	S	S	*	*			trans	-94.9	55.5	156.2	-72.8	-156.3	162.7	0	0	111.4	V47 S51	V47-E49 VanDerWaalsContact C-N 3.29Å; V47-E49 HydrophobicContact CG1-CG 4.29Å; V47-E49 PolarHBondContact O-N 2.99Å; E49-S51 PolarHBondContact O-N 3.13Å
50	P	55	Low	54.9	Low	66 Å²	66	107.7 Å²	107.7	43%	0.429	60%	0.599	S	S	.	*	H	α-helix	trans	-73.3	-14.4	169.9	32.4	-33.6	0	0	0	111.3	K48 L54	K48-P50 HydrophobicContact CB-CG 4.21Å; K48-P50 WeakPolarHBondContact O-CD 3.41Å; P50-L54 HydrophobicContact CB-CD1 4.47Å; P50-L54 WeakPolarHBondContact O-CB 3.01Å; P50-L54 WeakPolarHBondContact O-CD1 3.21Å; P50-L54 WeakPolarHBondContact O-CG 3.45Å; P50-L54 PolarHBondContact O-N 2.76Å
51	S	59.4	Low	56.1	Low	84 Å²	84	105.9 Å²	105.9	59%	0.587	59%	0.588	S	S	*	*	H	α-helix	trans	-71.8	-38	-172.6	54.3	0	0	0	0	113.4	E49 A55	E49-S51 PolarHBondContact O-N 3.13Å; S51-A55 VanDerWaalsContact O-CB 3.31Å; S51-A55 WeakPolarHBondContact O-CB 3.42Å; S51-A55 PolarHBondContact O-N 2.76Å; S51-A55 VanDerWaalsContact O-N 3.16Å
52	T	60	Low	57.2	Low	70 Å²	70	106.3 Å²	106.3	43%	0.429	59%	0.585	S	S	.	*	H	α-helix	trans	-77.3	-35.4	-178.2	45.6	0	0	0	0	112.5	R56	T52-R56 PolarHBondContact O-N 2.89Å; T52-R56 VanDerWaalsContact O-N 3.13Å
53	I	60.3	Low	58.4	Low	107 Å²	107	107 Å²	107	55%	0.549	58%	0.584	S	S	.	*	H	α-helix	trans	-70.4	-45.8	177.4	-58.5	175.3	0	0	0	110.4	A55 R56 I57	I53-A55 VanDerWaalsContact C-N 3.32Å; I53-A55 PolarHBondContact O-N 3.32Å; I53-R56 PolarHBondContact O-N 2.89Å; I53-I57 HydrophobicContact CG2-CD1 3.79Å; I53-I57 HydrophobicContact CG2-CG1 4.45Å; I53-I57 VanDerWaalsContact O-CG1 3.3Å; I53-I57 WeakPolarHBondContact O-CG1 3.28Å; I53-I57 PolarHBondContact O-N 3.43Å
54	L	59.5	Low	59.9	Low	105 Å²	105	105.4 Å²	105.4	55%	0.55	57%	0.567	S	S	.	*	H	α-helix	trans	-63.2	-39	177.2	-69.9	173	0	0	0	111.7	P50 R56 I57 T58	P50-L54 HydrophobicContact CB-CD1 4.47Å; P50-L54 WeakPolarHBondContact O-CB 3.01Å; P50-L54 WeakPolarHBondContact O-CD1 3.21Å; P50-L54 WeakPolarHBondContact O-CG 3.45Å; P50-L54 PolarHBondContact O-N 2.76Å; L54-R56 VanDerWaalsContact C-N 3.34Å; L54-R56 PolarHBondContact O-N 2.9Å; L54-I57 PolarHBondContact O-N 3.09Å; L54-T58 WeakPolarHBondContact O-CG2 3.26Å; L54-T58 PolarHBondContact O-N 3.32Å; L54-T58 PolarHBondContact O-OG1 3.28Å
55	A	62.2	Low	61.3	Low	55 Å²	55	106.5 Å²	106.5	46%	0.455	56%	0.56	S	S	.	*	H	α-helix	trans	-63.1	-37	174.9	0	0	0	0	0	113	S51 I53 T58 A59	S51-A55 VanDerWaalsContact O-CB 3.31Å; S51-A55 WeakPolarHBondContact O-CB 3.42Å; S51-A55 PolarHBondContact O-N 2.76Å; S51-A55 VanDerWaalsContact O-N 3.16Å; I53-A55 VanDerWaalsContact C-N 3.32Å; I53-A55 PolarHBondContact O-N 3.32Å; A55-T58 WeakPolarHBondContact CA-OG1 3.37Å; A55-T58 PolarHBondContact O-OG1 3.21Å; A55-T58 VanDerWaalsContact O-OG1 3.05Å; A55-A59 VanDerWaalsContact O-CB 3.32Å; A55-A59 WeakPolarHBondContact O-CB 3.37Å; A55-A59 PolarHBondContact O-N 3.02Å
56	R	62.6	Low	62.5	Low	192 Å²	192	105.6 Å²	105.6	73%	0.725	55%	0.55	S	S	*	*	H	α-helix	trans	-69.3	-41	173.8	-78.8	-177.6	174.8	-174.5	0.4	111.9	T52 I53 L54 A59 I60	T52-R56 PolarHBondContact O-N 2.89Å; T52-R56 VanDerWaalsContact O-N 3.13Å; I53-R56 PolarHBondContact O-N 2.89Å; L54-R56 VanDerWaalsContact C-N 3.34Å; L54-R56 PolarHBondContact O-N 2.9Å; R56-A59 PolarHBondContact O-N 2.73Å; R56-I60 WeakPolarHBondContact O-CD1 3.42Å; R56-I60 VanDerWaalsContact O-CG1 3.23Å; R56-I60 WeakPolarHBondContact O-CG1 3.07Å; R56-I60 PolarHBondContact O-N 2.81Å
57	I	67	Low	64	Low	91 Å²	91	104.9 Å²	104.9	47%	0.467	54%	0.539	S	S	.	.	H	α-helix	trans	-64.9	-43.3	178	-66.1	165.8	0	0	0	110.4	I53 L54 I60 W61	I53-I57 HydrophobicContact CG2-CD1 3.79Å; I53-I57 HydrophobicContact CG2-CG1 4.45Å; I53-I57 VanDerWaalsContact O-CG1 3.3Å; I53-I57 WeakPolarHBondContact O-CG1 3.28Å; I53-I57 PolarHBondContact O-N 3.43Å; L54-I57 PolarHBondContact O-N 3.09Å; I57-I60 PolarHBondContact O-N 3.19Å; I57-W61 WeakPolarHBondContact O-CB 3.48Å; I57-W61 PolarHBondContact O-N 2.62Å
58	T	63.8	Low	65.5	Low	80 Å²	80	104.4 Å²	104.4	49%	0.491	53%	0.528	S	S	.	.	H	α-helix	trans	-68	-34.3	176.6	53.6	0	0	0	0	112.4	L54 A55 W61 N62	L54-T58 WeakPolarHBondContact O-CG2 3.26Å; L54-T58 PolarHBondContact O-N 3.32Å; L54-T58 PolarHBondContact O-OG1 3.28Å; A55-T58 WeakPolarHBondContact CA-OG1 3.37Å; A55-T58 PolarHBondContact O-OG1 3.21Å; A55-T58 VanDerWaalsContact O-OG1 3.05Å; T58-W61 PolarHBondContact O-N 2.83Å; T58-N62 WeakPolarHBondContact O-CB 3.47Å; T58-N62 PolarHBondContact O-N 3.42Å
59	A	66.4	Low	66.9	Low	56 Å²	56	100.9 Å²	100.9	46%	0.463	52%	0.517	S	S	.	.	H	α-helix	trans	-64	-43.4	172.5	0	0	0	0	0	112.3	A55 R56 W61 N62 L63	A55-A59 VanDerWaalsContact O-CB 3.32Å; A55-A59 WeakPolarHBondContact O-CB 3.37Å; A55-A59 PolarHBondContact O-N 3.02Å; R56-A59 PolarHBondContact O-N 2.73Å; A59-W61 VanDerWaalsContact C-N 3.34Å; A59-N62 PolarHBondContact O-N 3.06Å; A59-L63 PolarHBondContact O-N 3.43Å
60	I	69	Low	68.2	Low	120 Å²	120	99.2 Å²	99.2	62%	0.615	51%	0.511	S	S	*	.	H	α-helix	trans	-63.9	-42.4	175.6	-66.1	161.8	0	0	0	110.4	R56 I57 L63 W64	R56-I60 WeakPolarHBondContact O-CD1 3.42Å; R56-I60 VanDerWaalsContact O-CG1 3.23Å; R56-I60 WeakPolarHBondContact O-CG1 3.07Å; R56-I60 PolarHBondContact O-N 2.81Å; I57-I60 PolarHBondContact O-N 3.19Å; I60-L63 PolarHBondContact O-N 2.88Å; I60-W64 WeakPolarHBondContact O-CB 3.4Å; I60-W64 PolarHBondContact O-N 3.27Å
61	W	71.3	Confident	69.2	Low	133 Å²	133	98.8 Å²	98.8	50%	0.504	51%	0.507	S	S	.	.	H	α-helix	trans	-64.1	-41.8	178.4	-163.8	-92.9	0	0	0	112.2	I57 T58 A59 W64 Y65	I57-W61 WeakPolarHBondContact O-CB 3.48Å; I57-W61 PolarHBondContact O-N 2.62Å; T58-W61 PolarHBondContact O-N 2.83Å; A59-W61 VanDerWaalsContact C-N 3.34Å; W61-W64 WeakPolarHBondContact O-CB 3.41Å; W61-W64 PolarHBondContact O-N 3.46Å; W61-Y65 AromaticContact CD1-CD2 3.49Å; W61-Y65 VanDerWaalsContact CD1-CD2 3.49Å; W61-Y65 AromaticContact CD1-CE2 3.11Å; W61-Y65 AromaticContact CD1-CZ 3.97Å; W61-Y65 AromaticContact CE2-CE2 3.9Å; W61-Y65 AromaticContact CE2-CZ 3.97Å; W61-Y65 HydrophobicContact CG-CD2 4.49Å; W61-Y65 HydrophobicContact CG-CE2 4.29Å; W61-Y65 AromaticContact NE1-CD2 3.65Å; W61-Y65 AromaticContact NE1-CE2 2.81Å; W61-Y65 AromaticContact NE1-CZ 3.22Å; W61-Y65 PolarHBondContact NE1-OH 3.15Å; W61-Y65 VanDerWaalsContact NE1-OH 3.15Å; W61-Y65 WeakPolarHBondContact O-CD2 3.31Å; W61-Y65 PolarHBondContact O-N 3.2Å
62	N	65.4	Low	70.2	Confident	102 Å²	102	98.6 Å²	98.6	55%	0.545	50%	0.499	S	S	.	.	H	α-helix	trans	-64.9	-41.4	174.5	-81.4	-14.5	0	0	0	112.1	T58 A59 W64 Y65 V66	T58-N62 WeakPolarHBondContact O-CB 3.47Å; T58-N62 PolarHBondContact O-N 3.42Å; A59-N62 PolarHBondContact O-N 3.06Å; N62-W64 VanDerWaalsContact C-N 3.25Å; N62-W64 PolarHBondContact O-N 3.04Å; N62-Y65 PolarHBondContact O-N 3.13Å; N62-V66 VanDerWaalsContact O-CG2 3.29Å; N62-V66 WeakPolarHBondContact O-CG2 3.3Å; N62-V66 PolarHBondContact O-N 3.28Å
63	L	74	Confident	71.3	Confident	138 Å²	138	100 Å²	100	72%	0.723	50%	0.504	S	S	*	.	H	α-helix	trans	-61.6	-38.1	175.5	-136.3	78.5	0	0	0	111.4	A59 I60 V66 Q67	A59-L63 PolarHBondContact O-N 3.43Å; I60-L63 PolarHBondContact O-N 2.88Å; L63-V66 PolarHBondContact O-N 3.16Å; L63-Q67 PolarHBondContact O-N 3.06Å; L63-Q67 VanDerWaalsContact O-N 3.07Å
64	W	73.1	Confident	72	Confident	103 Å²	103	100.5 Å²	100.5	39%	0.39	51%	0.507	S	S	.	.	H	α-helix	trans	-67.1	-42.8	177.9	-167.8	64	0	0	0	112.4	I60 W61 N62 Q67 F68 W99	I60-W64 WeakPolarHBondContact O-CB 3.4Å; I60-W64 PolarHBondContact O-N 3.27Å; W61-W64 WeakPolarHBondContact O-CB 3.41Å; W61-W64 PolarHBondContact O-N 3.46Å; N62-W64 VanDerWaalsContact C-N 3.25Å; N62-W64 PolarHBondContact O-N 3.04Å; W64-Q67 PolarHBondContact O-N 2.88Å; W64-F68 PolarHBondContact O-N 2.96Å; W64-W99 AromaticContact CE2-CH2 3.85Å; W64-W99 AromaticContact CE2-CZ2 3.75Å; W64-W99 HydrophobicContact CH2-CH2 4.44Å; W64-W99 AromaticContact CZ2-CH2 3.41Å; W64-W99 HydrophobicContact CZ2-CH2 3.41Å; W64-W99 VanDerWaalsContact CZ2-CH2 3.41Å; W64-W99 AromaticContact CZ2-CZ2 3.51Å; W64-W99 HydrophobicContact CZ2-CZ2 3.51Å; W64-W99 AromaticContact NE1-CH2 3.81Å; W64-W99 AromaticContact NE1-CZ2 3.4Å
65	Y	75.4	Confident	72.6	Confident	104 Å²	104	100.3 Å²	100.3	41%	0.408	50%	0.499	S	S	.	.	H	α-helix	trans	-63.3	-41.9	173.5	-83	-52.6	0	0	0	112.8	W61 N62 Q67 F68 I69	W61-Y65 AromaticContact CD1-CD2 3.49Å; W61-Y65 VanDerWaalsContact CD1-CD2 3.49Å; W61-Y65 AromaticContact CD1-CE2 3.11Å; W61-Y65 AromaticContact CD1-CZ 3.97Å; W61-Y65 AromaticContact CE2-CE2 3.9Å; W61-Y65 AromaticContact CE2-CZ 3.97Å; W61-Y65 HydrophobicContact CG-CD2 4.49Å; W61-Y65 HydrophobicContact CG-CE2 4.29Å; W61-Y65 AromaticContact NE1-CD2 3.65Å; W61-Y65 AromaticContact NE1-CE2 2.81Å; W61-Y65 AromaticContact NE1-CZ 3.22Å; W61-Y65 PolarHBondContact NE1-OH 3.15Å; W61-Y65 VanDerWaalsContact NE1-OH 3.15Å; W61-Y65 WeakPolarHBondContact O-CD2 3.31Å; W61-Y65 PolarHBondContact O-N 3.2Å; N62-Y65 PolarHBondContact O-N 3.13Å; Y65-Q67 VanDerWaalsContact C-N 3.31Å; Y65-Q67 PolarHBondContact O-N 2.92Å; Y65-F68 PolarHBondContact O-N 2.81Å; Y65-I69 WeakPolarHBondContact O-CB 3.23Å; Y65-I69 VanDerWaalsContact O-CG1 3.26Å; Y65-I69 WeakPolarHBondContact O-CG1 3.33Å; Y65-I69 PolarHBondContact O-N 3.1Å
66	V	71.9	Confident	73.3	Confident	79 Å²	79	102.2 Å²	102.2	48%	0.479	50%	0.501	S	S	.	.	H	α-helix	trans	-60.7	-44	177.8	171.5	0	0	0	0	110.3	N62 L63 F68 I69 I70	N62-V66 VanDerWaalsContact O-CG2 3.29Å; N62-V66 WeakPolarHBondContact O-CG2 3.3Å; N62-V66 PolarHBondContact O-N 3.28Å; L63-V66 PolarHBondContact O-N 3.16Å; V66-F68 VanDerWaalsContact C-N 3.33Å; V66-F68 PolarHBondContact O-N 2.83Å; V66-I69 PolarHBondContact O-N 3.15Å; V66-I70 HydrophobicContact CG1-CD1 3.55Å; V66-I70 HydrophobicContact CG1-CG1 4.3Å; V66-I70 WeakPolarHBondContact O-CB 3.39Å; V66-I70 WeakPolarHBondContact O-CD1 3.43Å; V66-I70 WeakPolarHBondContact O-CG1 3.43Å; V66-I70 PolarHBondContact O-N 2.9Å
67	Q	77.1	Confident	73.8	Confident	106 Å²	106	97.4 Å²	97.4	50%	0.495	49%	0.489	S	S	.	.	H	α-helix	trans	-61.6	-41.6	175.8	-170.4	66.2	17.4	0	0	112.1	L63 W64 Y65 T71	L63-Q67 PolarHBondContact O-N 3.06Å; L63-Q67 VanDerWaalsContact O-N 3.07Å; W64-Q67 PolarHBondContact O-N 2.88Å; Y65-Q67 VanDerWaalsContact C-N 3.31Å; Y65-Q67 PolarHBondContact O-N 2.92Å; Q67-T71 VanDerWaalsContact O-CB 3.31Å; Q67-T71 WeakPolarHBondContact O-CB 3.32Å; Q67-T71 PolarHBondContact O-N 3.33Å; Q67-T71 PolarHBondContact O-OG1 2.99Å
68	F	78.8	Confident	73.8	Confident	98 Å²	98	94.2 Å²	94.2	43%	0.43	48%	0.475	S	S	.	.	H	α-helix	trans	-64.6	-46.1	177.7	-174.1	-95.5	0	0	0	111.7	W64 Y65 V66 T71 L72	W64-F68 PolarHBondContact O-N 2.96Å; Y65-F68 PolarHBondContact O-N 2.81Å; V66-F68 VanDerWaalsContact C-N 3.33Å; V66-F68 PolarHBondContact O-N 2.83Å; F68-T71 PolarHBondContact O-N 3.21Å; F68-L72 HydrophobicContact CD1-CD1 4.48Å; F68-L72 HydrophobicContact CE1-CD1 3.7Å; F68-L72 HydrophobicContact CZ-CD1 4.14Å; F68-L72 WeakPolarHBondContact O-CB 3.23Å; F68-L72 PolarHBondContact O-N 3.36Å
69	I	80.5	Confident	74	Confident	103 Å²	103	94.9 Å²	94.9	53%	0.528	48%	0.475	S	S	.	.	H	α-helix	trans	-64.5	-44.9	179.2	-67.3	167.9	0	0	0	110.9	Y65 V66 T71 L72 L73	Y65-I69 WeakPolarHBondContact O-CB 3.23Å; Y65-I69 VanDerWaalsContact O-CG1 3.26Å; Y65-I69 WeakPolarHBondContact O-CG1 3.33Å; Y65-I69 PolarHBondContact O-N 3.1Å; V66-I69 PolarHBondContact O-N 3.15Å; I69-T71 VanDerWaalsContact C-N 3.29Å; I69-T71 PolarHBondContact O-N 3.33Å; I69-L72 PolarHBondContact O-N 3.01Å; I69-L73 WeakPolarHBondContact O-CB 3.49Å; I69-L73 PolarHBondContact O-N 3.39Å
70	I	79.5	Confident	74.2	Confident	91 Å²	91	101.3 Å²	101.3	47%	0.467	49%	0.492	S	S	.	.	H	α-helix	trans	-60.7	-43.3	176.9	-69.7	166.6	0	0	0	110.2	V66 L73 L74	V66-I70 HydrophobicContact CG1-CD1 3.55Å; V66-I70 HydrophobicContact CG1-CG1 4.3Å; V66-I70 WeakPolarHBondContact O-CB 3.39Å; V66-I70 WeakPolarHBondContact O-CD1 3.43Å; V66-I70 WeakPolarHBondContact O-CG1 3.43Å; V66-I70 PolarHBondContact O-N 2.9Å; I70-L73 PolarHBondContact O-N 2.87Å; I70-L74 VanDerWaalsContact O-CB 3.31Å; I70-L74 WeakPolarHBondContact O-CB 3.38Å; I70-L74 PolarHBondContact O-N 3.05Å
71	T	75.7	Confident	74.1	Confident	57 Å²	57	100.7 Å²	100.7	35%	0.35	49%	0.49	S	S	.	.	H	α-helix	trans	-62.8	-43.5	177.5	-56.3	0	0	0	0	111	Q67 F68 I69 L74 W75	Q67-T71 VanDerWaalsContact O-CB 3.31Å; Q67-T71 WeakPolarHBondContact O-CB 3.32Å; Q67-T71 PolarHBondContact O-N 3.33Å; Q67-T71 PolarHBondContact O-OG1 2.99Å; F68-T71 PolarHBondContact O-N 3.21Å; I69-T71 VanDerWaalsContact C-N 3.29Å; I69-T71 PolarHBondContact O-N 3.33Å; T71-L74 PolarHBondContact O-N 2.76Å; T71-W75 VanDerWaalsContact O-CB 3.3Å; T71-W75 WeakPolarHBondContact O-CB 3.23Å; T71-W75 PolarHBondContact O-N 2.96Å
72	L	80.9	Confident	73.7	Confident	80 Å²	80	104.2 Å²	104.2	42%	0.419	51%	0.512	S	S	.	.	H	α-helix	trans	-68.1	-38.4	179	-164.2	150.6	0	0	0	112	F68 I69 W75 L76	F68-L72 HydrophobicContact CD1-CD1 4.48Å; F68-L72 HydrophobicContact CE1-CD1 3.7Å; F68-L72 HydrophobicContact CZ-CD1 4.14Å; F68-L72 WeakPolarHBondContact O-CB 3.23Å; F68-L72 PolarHBondContact O-N 3.36Å; I69-L72 PolarHBondContact O-N 3.01Å; L72-W75 WeakPolarHBondContact O-CB 3.22Å; L72-W75 PolarHBondContact O-N 2.97Å; L72-L76 HydrophobicContact CD2-CD1 3.9Å; L72-L76 HydrophobicContact CD2-CG 4.4Å; L72-L76 PolarHBondContact O-N 3.47Å
73	L	81.9	Confident	73.5	Confident	100 Å²	100	105.7 Å²	105.7	52%	0.524	51%	0.513	S	S	.	.	H	α-helix	trans	-66.8	-44.3	175.3	-173.9	64.7	0	0	0	111.3	I69 I70 W75 L76 I77	I69-L73 WeakPolarHBondContact O-CB 3.49Å; I69-L73 PolarHBondContact O-N 3.39Å; I70-L73 PolarHBondContact O-N 2.87Å; L73-W75 PolarHBondContact O-N 3.46Å; L73-L76 WeakPolarHBondContact O-CB 3.48Å; L73-L76 PolarHBondContact O-N 3.41Å; L73-I77 HydrophobicContact CG-CD1 4.28Å; L73-I77 WeakPolarHBondContact O-CD1 3.3Å; L73-I77 VanDerWaalsContact O-CG1 3.31Å; L73-I77 WeakPolarHBondContact O-CG1 3.34Å; L73-I77 PolarHBondContact O-N 3.32Å
74	L	76	Confident	73	Confident	117 Å²	117	99.4 Å²	99.4	61%	0.613	48%	0.482	S	S	*	.	H	α-helix	trans	-60.7	-36.9	173.7	-171.9	65	0	0	0	110.8	I70 T71 I77 A78	I70-L74 VanDerWaalsContact O-CB 3.31Å; I70-L74 WeakPolarHBondContact O-CB 3.38Å; I70-L74 PolarHBondContact O-N 3.05Å; T71-L74 PolarHBondContact O-N 2.76Å; L74-I77 PolarHBondContact O-N 2.88Å; L74-A78 WeakPolarHBondContact O-CB 3.48Å; L74-A78 PolarHBondContact O-N 3.37Å
75	W	72.5	Confident	72.7	Confident	102 Å²	102	97.8 Å²	97.8	39%	0.386	49%	0.49	S	S	.	.	H	α-helix	trans	-66.4	-42.6	176.4	-161.2	56.2	0	0	0	112.8	T71 L72 L73 I77 A78 I79 F88	T71-W75 VanDerWaalsContact O-CB 3.3Å; T71-W75 WeakPolarHBondContact O-CB 3.23Å; T71-W75 PolarHBondContact O-N 2.96Å; L72-W75 WeakPolarHBondContact O-CB 3.22Å; L72-W75 PolarHBondContact O-N 2.97Å; L73-W75 PolarHBondContact O-N 3.46Å; W75-I77 VanDerWaalsContact C-N 3.33Å; W75-I77 PolarHBondContact O-N 3.06Å; W75-A78 PolarHBondContact O-N 3.48Å; W75-I79 HydrophobicContact CD2-CD1 3.91Å; W75-I79 HydrophobicContact CE3-CD1 3.87Å; W75-I79 HydrophobicContact CH2-CD1 4.1Å; W75-I79 HydrophobicContact CZ2-CD1 4.1Å; W75-I79 HydrophobicContact CZ3-CD1 3.97Å; W75-I79 WeakPolarHBondContact O-CG1 3.29Å; W75-I79 PolarHBondContact O-N 3.38Å; W75-F88 AromaticContact CD1-CD2 3.76Å; W75-F88 HydrophobicContact CD2-CD2 4.34Å; W75-F88 HydrophobicContact CD2-CE2 4.44Å; W75-F88 AromaticContact CE2-CD2 3.2Å; W75-F88 AromaticContact CE2-CE2 3.4Å; W75-F88 VanDerWaalsContact CE2-CE2 3.4Å; W75-F88 AromaticContact CE2-CG 3.8Å; W75-F88 HydrophobicContact CH2-CE2 4.03Å; W75-F88 HydrophobicContact CH2-CZ 4.2Å; W75-F88 HydrophobicContact CZ2-CD1 4.11Å; W75-F88 AromaticContact CZ2-CD2 3.34Å; W75-F88 HydrophobicContact CZ2-CD2 3.34Å; W75-F88 HydrophobicContact CZ2-CE1 4.01Å; W75-F88 AromaticContact CZ2-CE2 3.15Å; W75-F88 HydrophobicContact CZ2-CE2 3.15Å; W75-F88 AromaticContact CZ2-CG 3.76Å; W75-F88 HydrophobicContact CZ2-CG 3.76Å; W75-F88 AromaticContact CZ2-CZ 3.52Å; W75-F88 HydrophobicContact CZ2-CZ 3.52Å; W75-F88 AromaticContact NE1-CD2 2.82Å; W75-F88 AromaticContact NE1-CE2 3.56Å; W75-F88 AromaticContact NE1-CG 3.29Å; W75-F88 VanDerWaalsContact NE1-CG 3.29Å
76	L	76.2	Confident	72.4	Confident	95 Å²	95	97 Å²	97	50%	0.497	50%	0.496	S	S	.	.	H	α-helix	trans	-59.9	-41.5	173	-82.1	166.8	0	0	0	112.3	L72 L73 I79 K80	L72-L76 HydrophobicContact CD2-CD1 3.9Å; L72-L76 HydrophobicContact CD2-CG 4.4Å; L72-L76 PolarHBondContact O-N 3.47Å; L73-L76 WeakPolarHBondContact O-CB 3.48Å; L73-L76 PolarHBondContact O-N 3.41Å; L76-I79 PolarHBondContact O-N 3.39Å; L76-K80 PolarHBondContact O-N 3.32Å
77	I	73.4	Confident	72.3	Confident	91 Å²	91	99.6 Å²	99.6	47%	0.467	50%	0.502	S	S	.	.	H	α-helix	trans	-66.1	-42.7	176.5	-64.4	160.5	0	0	0	110	L73 L74 W75 I79 K80 I81	L73-I77 HydrophobicContact CG-CD1 4.28Å; L73-I77 WeakPolarHBondContact O-CD1 3.3Å; L73-I77 VanDerWaalsContact O-CG1 3.31Å; L73-I77 WeakPolarHBondContact O-CG1 3.34Å; L73-I77 PolarHBondContact O-N 3.32Å; L74-I77 PolarHBondContact O-N 2.88Å; W75-I77 VanDerWaalsContact C-N 3.33Å; W75-I77 PolarHBondContact O-N 3.06Å; I77-I79 VanDerWaalsContact C-N 3.34Å; I77-I79 PolarHBondContact O-N 3.27Å; I77-K80 PolarHBondContact O-N 3.34Å; I77-I81 HydrophobicContact CG2-CD1 4.17Å; I77-I81 PolarHBondContact O-N 3Å
78	A	67.7	Low	72	Confident	23 Å²	23	99.2 Å²	99.2	19%	0.19	50%	0.498	C	S	.	.	H	α-helix	trans	-63.4	-36.8	179	0	0	0	0	0	112.3	L74 W75 K80 I81 G84	L74-A78 WeakPolarHBondContact O-CB 3.48Å; L74-A78 PolarHBondContact O-N 3.37Å; W75-A78 PolarHBondContact O-N 3.48Å; A78-K80 VanDerWaalsContact C-N 3.28Å; A78-K80 PolarHBondContact O-N 2.98Å; A78-I81 PolarHBondContact O-N 2.99Å; A78-G84 WeakPolarHBondContact O-CA 3.36Å; A78-G84 PolarHBondContact O-N 3Å
79	I	68	Low	72	Confident	95 Å²	95	99.7 Å²	99.7	49%	0.487	50%	0.504	S	S	.	.	H	α-helix	trans	-64.4	-32.7	176.7	-69.9	163.3	0	0	0	111.9	W75 L76 I77	W75-I79 HydrophobicContact CD2-CD1 3.91Å; W75-I79 HydrophobicContact CE3-CD1 3.87Å; W75-I79 HydrophobicContact CH2-CD1 4.1Å; W75-I79 HydrophobicContact CZ2-CD1 4.1Å; W75-I79 HydrophobicContact CZ3-CD1 3.97Å; W75-I79 WeakPolarHBondContact O-CG1 3.29Å; W75-I79 PolarHBondContact O-N 3.38Å; L76-I79 PolarHBondContact O-N 3.39Å; I77-I79 VanDerWaalsContact C-N 3.34Å; I77-I79 PolarHBondContact O-N 3.27Å
80	K	69.6	Low	72	Confident	190 Å²	190	100.6 Å²	100.6	83%	0.826	51%	0.508	S	S	*	.	H	α-helix	trans	-73.9	-25.7	-179.5	-78.8	-151.1	167.3	-170.6	0	114.3	L76 I77 A78	L76-K80 PolarHBondContact O-N 3.32Å; I77-K80 PolarHBondContact O-N 3.34Å; A78-K80 VanDerWaalsContact C-N 3.28Å; A78-K80 PolarHBondContact O-N 2.98Å
81	I	66.6	Low	72	Confident	108 Å²	108	98 Å²	98	55%	0.554	50%	0.504	S	S	*	.	S	Bend	trans	-93.9	115.5	174.4	-61	158.5	0	0	0	103.6	I77 A78 F83 G84	I77-I81 HydrophobicContact CG2-CD1 4.17Å; I77-I81 PolarHBondContact O-N 3Å; A78-I81 PolarHBondContact O-N 2.99Å; I81-F83 HydrophobicContact CG2-CB 4.36Å; I81-F83 PolarHBondContact O-N 2.99Å; I81-G84 PolarHBondContact O-N 3.44Å
82	E	63.9	Low	72.1	Confident	207 Å²	207	97 Å²	97	97%	0.967	50%	0.501	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.1	10.4	-169.9	-62.1	-177.6	151.4	0	0	116.4
83	F	61.5	Low	72.3	Confident	132 Å²	132	98.5 Å²	98.5	58%	0.579	51%	0.509	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.4	2.2	171.8	-142.2	-93.3	0	0	0	114.4	I81 A85 F87	I81-F83 HydrophobicContact CG2-CB 4.36Å; I81-F83 PolarHBondContact O-N 2.99Å; F83-A85 PolarHBondContact O-N 2.87Å; F83-F87 AromaticContact CD1-CD2 3.68Å; F83-F87 HydrophobicContact CD1-CD2 3.68Å; F83-F87 AromaticContact CD1-CE2 3.39Å; F83-F87 HydrophobicContact CD1-CE2 3.39Å; F83-F87 HydrophobicContact CE1-CD2 4.25Å; F83-F87 AromaticContact CE1-CE2 3.7Å; F83-F87 HydrophobicContact CE1-CE2 3.7Å; F83-F87 HydrophobicContact CE1-CZ 4.47Å
84	G	62.7	Low	72.3	Confident	7 Å²	7	100.8 Å²	100.8	7%	0.072	51%	0.512	C	S	.	.	H	α-helix	trans	-63.5	-29.2	-170.7	0	0	0	0	0	116.9	A78 I81 V86 F88	A78-G84 WeakPolarHBondContact O-CA 3.36Å; A78-G84 PolarHBondContact O-N 3Å; I81-G84 PolarHBondContact O-N 3.44Å; G84-V86 PolarHBondContact O-N 2.93Å; G84-F88 WeakPolarHBondContact O-CB 3.49Å; G84-F88 PolarHBondContact O-N 3.38Å
85	A	66.9	Low	72.5	Confident	68 Å²	68	99.4 Å²	99.4	56%	0.562	50%	0.498	S	S	*	.	H	α-helix	trans	-67.6	-38.8	-174.9	0	0	0	0	0	113.1	F83 F88 I89	F83-A85 PolarHBondContact O-N 2.87Å; A85-F88 WeakPolarHBondContact O-CB 3.46Å; A85-F88 PolarHBondContact O-N 3.45Å; A85-I89 WeakPolarHBondContact O-CG1 3.22Å; A85-I89 PolarHBondContact O-N 3.46Å
86	V	70.4	Confident	72.9	Confident	87 Å²	87	100.2 Å²	100.2	53%	0.527	51%	0.509	S	S	.	.	H	α-helix	trans	-67.9	-44.2	-180	-179.5	0	0	0	0	110.4	G84 F88 I89 M90	G84-V86 PolarHBondContact O-N 2.93Å; V86-F88 VanDerWaalsContact C-N 3.3Å; V86-F88 PolarHBondContact O-N 3.21Å; V86-I89 PolarHBondContact O-N 3.36Å; V86-M90 WeakPolarHBondContact O-CG 3.27Å; V86-M90 PolarHBondContact O-N 2.87Å
87	F	69.7	Low	73.1	Confident	135 Å²	135	104.3 Å²	104.3	59%	0.592	52%	0.518	S	S	*	.	H	α-helix	trans	-67.5	-30.9	174.7	-76.3	-71.2	0	0	0	112.5	F83 G91	F83-F87 AromaticContact CD1-CD2 3.68Å; F83-F87 HydrophobicContact CD1-CD2 3.68Å; F83-F87 AromaticContact CD1-CE2 3.39Å; F83-F87 HydrophobicContact CD1-CE2 3.39Å; F83-F87 HydrophobicContact CE1-CD2 4.25Å; F83-F87 AromaticContact CE1-CE2 3.7Å; F83-F87 HydrophobicContact CE1-CE2 3.7Å; F83-F87 HydrophobicContact CE1-CZ 4.47Å; F87-G91 WeakPolarHBondContact O-CA 3.37Å; F87-G91 PolarHBondContact O-N 3.26Å
88	F	69.9	Low	73.1	Confident	97 Å²	97	102.1 Å²	102.1	43%	0.425	51%	0.509	S	S	.	.	H	α-helix	trans	-62.9	-47.9	171.5	176.8	-126.4	0	0	0	111.8	W75 G84 A85 V86 G91 A92	W75-F88 AromaticContact CD1-CD2 3.76Å; W75-F88 HydrophobicContact CD2-CD2 4.34Å; W75-F88 HydrophobicContact CD2-CE2 4.44Å; W75-F88 AromaticContact CE2-CD2 3.2Å; W75-F88 AromaticContact CE2-CE2 3.4Å; W75-F88 VanDerWaalsContact CE2-CE2 3.4Å; W75-F88 AromaticContact CE2-CG 3.8Å; W75-F88 HydrophobicContact CH2-CE2 4.03Å; W75-F88 HydrophobicContact CH2-CZ 4.2Å; W75-F88 HydrophobicContact CZ2-CD1 4.11Å; W75-F88 AromaticContact CZ2-CD2 3.34Å; W75-F88 HydrophobicContact CZ2-CD2 3.34Å; W75-F88 HydrophobicContact CZ2-CE1 4.01Å; W75-F88 AromaticContact CZ2-CE2 3.15Å; W75-F88 HydrophobicContact CZ2-CE2 3.15Å; W75-F88 AromaticContact CZ2-CG 3.76Å; W75-F88 HydrophobicContact CZ2-CG 3.76Å; W75-F88 AromaticContact CZ2-CZ 3.52Å; W75-F88 HydrophobicContact CZ2-CZ 3.52Å; W75-F88 AromaticContact NE1-CD2 2.82Å; W75-F88 AromaticContact NE1-CE2 3.56Å; W75-F88 AromaticContact NE1-CG 3.29Å; W75-F88 VanDerWaalsContact NE1-CG 3.29Å; G84-F88 WeakPolarHBondContact O-CB 3.49Å; G84-F88 PolarHBondContact O-N 3.38Å; A85-F88 WeakPolarHBondContact O-CB 3.46Å; A85-F88 PolarHBondContact O-N 3.45Å; V86-F88 VanDerWaalsContact C-N 3.3Å; V86-F88 PolarHBondContact O-N 3.21Å; F88-G91 PolarHBondContact O-N 2.8Å; F88-A92 VanDerWaalsContact O-CB 3.22Å; F88-A92 WeakPolarHBondContact O-CB 3.32Å; F88-A92 PolarHBondContact O-N 2.87Å
89	I	79.3	Confident	73.1	Confident	108 Å²	108	106 Å²	106	55%	0.554	52%	0.519	S	S	*	.	H	α-helix	trans	-62.6	-47.3	179	-65.6	165.7	0	0	0	109.7	A85 V86 G91 A92 L93	A85-I89 WeakPolarHBondContact O-CG1 3.22Å; A85-I89 PolarHBondContact O-N 3.46Å; V86-I89 PolarHBondContact O-N 3.36Å; I89-G91 PolarHBondContact O-N 2.83Å; I89-A92 PolarHBondContact O-N 3.49Å; I89-L93 WeakPolarHBondContact O-CB 3.33Å; I89-L93 PolarHBondContact O-N 3.3Å
90	M	81	Confident	72.8	Confident	122 Å²	122	103.6 Å²	103.6	60%	0.601	52%	0.516	S	S	*	.	H	α-helix	trans	-62.2	-42.1	177.7	-73.6	-65.6	-75.3	0	0	112.5	V86 L93 Y94	V86-M90 WeakPolarHBondContact O-CG 3.27Å; V86-M90 PolarHBondContact O-N 2.87Å; M90-L93 PolarHBondContact O-N 3.43Å; M90-Y94 VanDerWaalsContact O-CB 3.28Å; M90-Y94 WeakPolarHBondContact O-CB 3.26Å; M90-Y94 PolarHBondContact O-N 2.98Å
91	G	77.8	Confident	72.4	Confident	37 Å²	37	98.9 Å²	98.9	38%	0.381	50%	0.504	S	S	.	.	H	α-helix	trans	-66.7	-41.1	177.1	0	0	0	0	0	112.5	F87 F88 I89 Y94 W95	F87-G91 WeakPolarHBondContact O-CA 3.37Å; F87-G91 PolarHBondContact O-N 3.26Å; F88-G91 PolarHBondContact O-N 2.8Å; I89-G91 PolarHBondContact O-N 2.83Å; G91-Y94 PolarHBondContact O-N 3.44Å; G91-W95 VanDerWaalsContact O-CB 3.27Å; G91-W95 WeakPolarHBondContact O-CB 3.48Å; G91-W95 PolarHBondContact O-N 3.07Å
92	A	79	Confident	72	Confident	35 Å²	35	98.6 Å²	98.6	29%	0.289	50%	0.503	S	S	.	.	H	α-helix	trans	-65	-43.2	174.8	0	0	0	0	0	111.3	F88 I89 W95 I96	F88-A92 VanDerWaalsContact O-CB 3.22Å; F88-A92 WeakPolarHBondContact O-CB 3.32Å; F88-A92 PolarHBondContact O-N 2.87Å; I89-A92 PolarHBondContact O-N 3.49Å; A92-W95 PolarHBondContact O-N 3.24Å; A92-I96 WeakPolarHBondContact O-CB 3.49Å; A92-I96 WeakPolarHBondContact O-CD1 3.36Å; A92-I96 VanDerWaalsContact O-CG1 3.23Å; A92-I96 WeakPolarHBondContact O-CG1 3.33Å; A92-I96 PolarHBondContact O-N 2.67Å
93	L	84.4	Confident	71.6	Confident	112 Å²	112	96.8 Å²	96.8	59%	0.586	49%	0.491	S	S	*	.	H	α-helix	trans	-63	-43.9	176.3	-145.7	75.8	0	0	0	111.1	I89 M90 I96 W97	I89-L93 WeakPolarHBondContact O-CB 3.33Å; I89-L93 PolarHBondContact O-N 3.3Å; M90-L93 PolarHBondContact O-N 3.43Å; L93-I96 PolarHBondContact O-N 3.19Å; L93-W97 WeakPolarHBondContact O-CB 3.31Å; L93-W97 PolarHBondContact O-N 2.9Å
94	Y	82.4	Confident	71.1	Confident	149 Å²	149	97.2 Å²	97.2	58%	0.584	50%	0.5	S	S	*	.	H	α-helix	trans	-62.7	-42.3	174.3	-179.2	-99.8	0	0	0	111.7	M90 G91 W97 V98	M90-Y94 VanDerWaalsContact O-CB 3.28Å; M90-Y94 WeakPolarHBondContact O-CB 3.26Å; M90-Y94 PolarHBondContact O-N 2.98Å; G91-Y94 PolarHBondContact O-N 3.44Å; Y94-W97 WeakPolarHBondContact O-CB 3.5Å; Y94-W97 PolarHBondContact O-N 2.8Å; Y94-V98 HydrophobicContact CD1-CG2 4.01Å; Y94-V98 HydrophobicContact CD2-CG2 4.4Å; Y94-V98 HydrophobicContact CE1-CG2 3.58Å; Y94-V98 HydrophobicContact CE2-CG2 4Å; Y94-V98 HydrophobicContact CG-CG2 4.4Å; Y94-V98 VanDerWaalsContact O-CG2 3.32Å; Y94-V98 WeakPolarHBondContact O-CG2 3.32Å; Y94-V98 PolarHBondContact O-N 3.36Å
95	W	80.4	Confident	70.6	Confident	88 Å²	88	102.3 Å²	102.3	33%	0.333	53%	0.532	S	S	.	.	H	α-helix	trans	-63.5	-46.1	177.7	-168	-96.3	0	0	0	111.8	G91 A92 W97 V98 W99	G91-W95 VanDerWaalsContact O-CB 3.27Å; G91-W95 WeakPolarHBondContact O-CB 3.48Å; G91-W95 PolarHBondContact O-N 3.07Å; A92-W95 PolarHBondContact O-N 3.24Å; W95-W97 VanDerWaalsContact C-N 3.25Å; W95-W97 PolarHBondContact O-N 3.36Å; W95-V98 PolarHBondContact O-N 3.47Å; W95-W99 AromaticContact CD1-CD1 3.7Å; W95-W99 AromaticContact CD2-CD1 3.77Å; W95-W99 AromaticContact CD2-NE1 3.67Å; W95-W99 AromaticContact CE2-CD1 3.48Å; W95-W99 VanDerWaalsContact CE2-CD1 3.48Å; W95-W99 AromaticContact CE2-CE2 3.9Å; W95-W99 AromaticContact CE2-NE1 3.02Å; W95-W99 AromaticContact CG-CD1 3.94Å; W95-W99 AromaticContact CH2-NE1 3.71Å; W95-W99 AromaticContact CZ2-CD1 3.99Å; W95-W99 AromaticContact CZ2-CE2 3.72Å; W95-W99 AromaticContact CZ2-CZ2 3.95Å; W95-W99 HydrophobicContact CZ2-CZ2 3.95Å; W95-W99 AromaticContact CZ2-NE1 3.06Å; W95-W99 AromaticContact NE1-CD1 3.41Å; W95-W99 AromaticContact NE1-CE2 3.94Å; W95-W99 AromaticContact NE1-NE1 3.29Å; W95-W99 WeakPolarHBondContact O-CB 3.36Å; W95-W99 VanDerWaalsContact O-CD1 3.25Å; W95-W99 PolarHBondContact O-N 3.42Å
96	I	80	Confident	70	Confident	118 Å²	118	107.7 Å²	107.7	61%	0.605	54%	0.542	S	S	*	.	H	α-helix	trans	-60.8	-38.2	174.7	-68.2	158.7	0	0	0	110.3	A92 L93 G100	A92-I96 WeakPolarHBondContact O-CB 3.49Å; A92-I96 WeakPolarHBondContact O-CD1 3.36Å; A92-I96 VanDerWaalsContact O-CG1 3.23Å; A92-I96 WeakPolarHBondContact O-CG1 3.33Å; A92-I96 PolarHBondContact O-N 2.67Å; L93-I96 PolarHBondContact O-N 3.19Å; I96-G100 WeakPolarHBondContact O-CA 3.21Å; I96-G100 PolarHBondContact O-N 3.44Å
97	W	80.1	Confident	69.2	Low	181 Å²	181	108.9 Å²	108.9	69%	0.686	55%	0.552	S	S	*	*	H	α-helix	trans	-68.2	-47.3	177.1	-173.4	13.8	0	0	0	112.5	L93 Y94 W95 W99 G100 T101	L93-W97 WeakPolarHBondContact O-CB 3.31Å; L93-W97 PolarHBondContact O-N 2.9Å; Y94-W97 WeakPolarHBondContact O-CB 3.5Å; Y94-W97 PolarHBondContact O-N 2.8Å; W95-W97 VanDerWaalsContact C-N 3.25Å; W95-W97 PolarHBondContact O-N 3.36Å; W97-W99 PolarHBondContact O-N 2.84Å; W97-G100 PolarHBondContact O-N 2.79Å; W97-T101 VanDerWaalsContact O-CG2 3.3Å; W97-T101 WeakPolarHBondContact O-CG2 3.39Å; W97-T101 PolarHBondContact O-N 3.36Å; W97-T101 PolarHBondContact O-OG1 3.31Å
98	V	74.7	Confident	68.4	Low	46 Å²	46	113.9 Å²	113.9	28%	0.279	57%	0.567	S	S	.	*	H	α-helix	trans	-61.8	-45.2	177	171.9	0	0	0	0	110.8	Y94 W95 T101 I102	Y94-V98 HydrophobicContact CD1-CG2 4.01Å; Y94-V98 HydrophobicContact CD2-CG2 4.4Å; Y94-V98 HydrophobicContact CE1-CG2 3.58Å; Y94-V98 HydrophobicContact CE2-CG2 4Å; Y94-V98 HydrophobicContact CG-CG2 4.4Å; Y94-V98 VanDerWaalsContact O-CG2 3.32Å; Y94-V98 WeakPolarHBondContact O-CG2 3.32Å; Y94-V98 PolarHBondContact O-N 3.36Å; W95-V98 PolarHBondContact O-N 3.47Å; V98-T101 PolarHBondContact O-N 2.8Å; V98-T101 PolarHBondContact O-OG1 2.99Å; V98-I102 HydrophobicContact CG1-CD1 3.95Å; V98-I102 VanDerWaalsContact O-CD1 3.23Å; V98-I102 WeakPolarHBondContact O-CD1 3.37Å; V98-I102 WeakPolarHBondContact O-CG1 3.28Å; V98-I102 PolarHBondContact O-N 2.96Å
99	W	67.1	Low	67.4	Low	105 Å²	105	115.2 Å²	115.2	40%	0.398	58%	0.577	S	S	.	*	H	α-helix	trans	-74.7	-31.3	178.7	-79.8	76.6	0	0	0	113.5	W64 W95 W97 T101 I102	W64-W99 AromaticContact CE2-CH2 3.85Å; W64-W99 AromaticContact CE2-CZ2 3.75Å; W64-W99 HydrophobicContact CH2-CH2 4.44Å; W64-W99 AromaticContact CZ2-CH2 3.41Å; W64-W99 HydrophobicContact CZ2-CH2 3.41Å; W64-W99 VanDerWaalsContact CZ2-CH2 3.41Å; W64-W99 AromaticContact CZ2-CZ2 3.51Å; W64-W99 HydrophobicContact CZ2-CZ2 3.51Å; W64-W99 AromaticContact NE1-CH2 3.81Å; W64-W99 AromaticContact NE1-CZ2 3.4Å; W95-W99 AromaticContact CD1-CD1 3.7Å; W95-W99 AromaticContact CD2-CD1 3.77Å; W95-W99 AromaticContact CD2-NE1 3.67Å; W95-W99 AromaticContact CE2-CD1 3.48Å; W95-W99 VanDerWaalsContact CE2-CD1 3.48Å; W95-W99 AromaticContact CE2-CE2 3.9Å; W95-W99 AromaticContact CE2-NE1 3.02Å; W95-W99 AromaticContact CG-CD1 3.94Å; W95-W99 AromaticContact CH2-NE1 3.71Å; W95-W99 AromaticContact CZ2-CD1 3.99Å; W95-W99 AromaticContact CZ2-CE2 3.72Å; W95-W99 AromaticContact CZ2-CZ2 3.95Å; W95-W99 HydrophobicContact CZ2-CZ2 3.95Å; W95-W99 AromaticContact CZ2-NE1 3.06Å; W95-W99 AromaticContact NE1-CD1 3.41Å; W95-W99 AromaticContact NE1-CE2 3.94Å; W95-W99 AromaticContact NE1-NE1 3.29Å; W95-W99 WeakPolarHBondContact O-CB 3.36Å; W95-W99 VanDerWaalsContact O-CD1 3.25Å; W95-W99 PolarHBondContact O-N 3.42Å; W97-W99 PolarHBondContact O-N 2.84Å; W99-T101 VanDerWaalsContact C-N 3.29Å; W99-T101 PolarHBondContact O-N 2.98Å; W99-I102 PolarHBondContact O-N 2.88Å
100	G	62.5	Low	65.9	Low	43 Å²	43	111.7 Å²	111.7	44%	0.443	56%	0.562	S	S	.	*	H	α-helix	trans	-65.7	-32.1	175	0	0	0	0	0	112.7	I96 W97	I96-G100 WeakPolarHBondContact O-CA 3.21Å; I96-G100 PolarHBondContact O-N 3.44Å; W97-G100 PolarHBondContact O-N 2.79Å
101	T	59.7	Low	64.7	Low	92 Å²	92	113.8 Å²	113.8	56%	0.564	58%	0.576	S	S	*	*	H	α-helix	trans	-85.1	-17.2	-179.8	53.2	0	0	0	0	113.9	W97 V98 W99 K103	W97-T101 VanDerWaalsContact O-CG2 3.3Å; W97-T101 WeakPolarHBondContact O-CG2 3.39Å; W97-T101 PolarHBondContact O-N 3.36Å; W97-T101 PolarHBondContact O-OG1 3.31Å; V98-T101 PolarHBondContact O-N 2.8Å; V98-T101 PolarHBondContact O-OG1 2.99Å; W99-T101 VanDerWaalsContact C-N 3.29Å; W99-T101 PolarHBondContact O-N 2.98Å; T101-K103 PolarHBondContact O-N 3.22Å
102	I	58.9	Low	63.5	Low	102 Å²	102	115 Å²	115	52%	0.523	57%	0.574	S	S	.	*	T	Hydrogen-bonded Turn	trans	-77.5	-6	179.7	-69.9	162.5	0	0	0	112.8	V98 W99 N104 P105	V98-I102 HydrophobicContact CG1-CD1 3.95Å; V98-I102 VanDerWaalsContact O-CD1 3.23Å; V98-I102 WeakPolarHBondContact O-CD1 3.37Å; V98-I102 WeakPolarHBondContact O-CG1 3.28Å; V98-I102 PolarHBondContact O-N 2.96Å; W99-I102 PolarHBondContact O-N 2.88Å; I102-N104 PolarHBondContact O-N 3.45Å; I102-P105 WeakPolarHBondContact O-CD 3.3Å
103	K	56.2	Low	62.5	Low	168 Å²	168	119.1 Å²	119.1	73%	0.73	60%	0.597	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.6	0.4	-173.8	-69.1	-169.9	179.3	-174.1	0	116.7	T101	T101-K103 PolarHBondContact O-N 3.22Å
104	N	50.3	Low	61.2	Low	142 Å²	142	120.5 Å²	120.5	76%	0.759	61%	0.605	S	S	*	*			trans	-149.4	88.2	167.6	-81.1	-58.8	0	0	0	109.8	I102 K106	I102-N104 PolarHBondContact O-N 3.45Å; N104-K106 PolarHBondContact O-N 2.91Å
105	P	52.5	Low	60	Low	114 Å²	114	118.4 Å²	118.4	74%	0.74	60%	0.601	S	S	*	*			trans	-62.6	95.1	149.3	29	-27.6	0	0	0	104.7	I102	I102-P105 WeakPolarHBondContact O-CD 3.3Å
106	K	53.6	Low	58.6	Low	180 Å²	180	122.6 Å²	122.6	78%	0.783	62%	0.624	S	S	*	*			trans	-42.3	123.5	160.7	-88.5	178.7	175.6	177.8	0	104.6	N104 R108	N104-K106 PolarHBondContact O-N 2.91Å; K106-R108 PolarHBondContact O-N 3.27Å
107	P	53.7	Low	57.3	Low	112 Å²	112	122 Å²	122	73%	0.727	62%	0.621	S	S	*	*			trans	-51.7	116.1	173.1	21	-29.7	0	0	0	104.2	I109	P107-I109 PolarHBondContact O-N 3.25Å
108	R	52	Low	56	Low	240 Å²	240	118.6 Å²	118.6	91%	0.906	62%	0.62	S	S	*	*			trans	-60.9	98.3	169	-73	-175.5	-176.2	-178.4	1.5	102.4	K106 S110	K106-R108 PolarHBondContact O-N 3.27Å; R108-S110 PolarHBondContact O-N 2.9Å
109	I	49.8	Very low	55	Low	126 Å²	126	118.9 Å²	118.9	65%	0.646	62%	0.624	S	S	*	*			trans	-55.4	98	159.8	-65.3	164.1	0	0	0	101.5	P107 N111	P107-I109 PolarHBondContact O-N 3.25Å; I109-N111 PolarHBondContact O-N 3.36Å
110	S	48.7	Very low	54.5	Low	34 Å²	34	117.8 Å²	117.8	24%	0.238	64%	0.637	C	S	.	*			trans	-59.9	128.1	173.1	55.3	0	0	0	0	104.7	R108 N112 E115	R108-S110 PolarHBondContact O-N 2.9Å; S110-N112 PolarHBondContact O-N 3.45Å; S110-E115 WeakPolarHBondContact CB-OE2 3.48Å; S110-E115 VanDerWaalsContact OG-CD 3.29Å; S110-E115 PolarHBondContact OG-OE2 3.29Å
111	N	54.6	Low	54.3	Low	166 Å²	166	119.3 Å²	119.3	89%	0.888	64%	0.641	S	S	*	*	S	Bend	trans	-71.1	26.9	168.4	-74.4	-22.5	0	0	0	110.5	I109 P113	I109-N111 PolarHBondContact O-N 3.36Å; N111-P113 WeakPolarHBondContact O-CD 3.31Å
112	N	53.9	Low	54.2	Low	63 Å²	63	122.2 Å²	122.2	34%	0.337	65%	0.646	S	S	.	*			trans	-97.9	105.3	177	-169.4	-0.1	0	0	0	107.4	S110 D114 E115	S110-N112 PolarHBondContact O-N 3.45Å; N112-D114 PolarHBondContact O-N 2.88Å; N112-D114 PolarHBondContact OD1-N 3.43Å; N112-E115 HydrophobicContact CB-CB 4.3Å; N112-E115 HydrophobicContact CB-CG 4Å; N112-E115 WeakPolarHBondContact CB-OE1 3.5Å; N112-E115 WeakPolarHBondContact ND2-CG 3.41Å; N112-E115 PolarHBondContact ND2-OE1 3.5Å; N112-E115 PolarHBondContact O-N 3.4Å
113	P	56.7	Low	54.1	Low	121 Å²	121	126.1 Å²	126.1	79%	0.786	66%	0.66	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.2	-10.9	178.9	27.1	-34	0	0	0	113.2	N111	N111-P113 WeakPolarHBondContact O-CD 3.31Å
114	D	57	Low	54	Low	141 Å²	141	126 Å²	126	75%	0.754	66%	0.659	S	S	*	*	T	Hydrogen-bonded Turn	trans	-97.7	-3.9	-178.8	-58.8	-33.1	0	0	0	113.6	N112 Q116	N112-D114 PolarHBondContact O-N 2.88Å; N112-D114 PolarHBondContact OD1-N 3.43Å; D114-Q116 PolarHBondContact O-N 3.46Å
115	E	57.6	Low	54.3	Low	104 Å²	104	125.6 Å²	125.6	49%	0.486	66%	0.657	S	S	.	*	S	Bend	trans	-88	97.2	173.4	-76.8	171.3	-142.3	0	0	109.2	S110 N112 I117	S110-E115 WeakPolarHBondContact CB-OE2 3.48Å; S110-E115 VanDerWaalsContact OG-CD 3.29Å; S110-E115 PolarHBondContact OG-OE2 3.29Å; N112-E115 HydrophobicContact CB-CB 4.3Å; N112-E115 HydrophobicContact CB-CG 4Å; N112-E115 WeakPolarHBondContact CB-OE1 3.5Å; N112-E115 WeakPolarHBondContact ND2-CG 3.41Å; N112-E115 PolarHBondContact ND2-OE1 3.5Å; N112-E115 PolarHBondContact O-N 3.4Å; E115-I117 VanDerWaalsContact C-N 3.28Å; E115-I117 PolarHBondContact O-N 2.87Å
116	Q	50	Low	54.7	Low	177 Å²	177	127 Å²	127	83%	0.827	66%	0.659	S	S	*	*			trans	-57.7	92.5	170.9	-81.4	-177.8	11.4	0	0	110	D114 V118	D114-Q116 PolarHBondContact O-N 3.46Å; Q116-V118 HydrophobicContact CB-CG2 4.36Å; Q116-V118 PolarHBondContact O-N 3.3Å
117	I	53.9	Low	55.1	Low	106 Å²	106	122 Å²	122	54%	0.544	65%	0.646	S	S	.	*			trans	-64.3	91.1	154	-50.3	171.4	0	0	0	104.5	E115 S119	E115-I117 VanDerWaalsContact C-N 3.28Å; E115-I117 PolarHBondContact O-N 2.87Å; I117-S119 PolarHBondContact O-N 3.02Å
118	V	52.4	Low	55.4	Low	108 Å²	108	122.1 Å²	122.1	66%	0.655	65%	0.647	S	S	*	*			trans	-66.9	78.7	163.6	-178.3	0	0	0	0	105.6	Q116 A120 F122	Q116-V118 HydrophobicContact CB-CG2 4.36Å; Q116-V118 PolarHBondContact O-N 3.3Å; V118-A120 PolarHBondContact O-N 3.32Å; V118-A120 VanDerWaalsContact O-N 3.13Å; V118-F122 HydrophobicContact CG1-CE2 4.34Å
119	S	53.9	Low	55.8	Low	52 Å²	52	117.9 Å²	117.9	36%	0.364	64%	0.64	S	S	.	*			trans	-58.9	114	170.9	-71.7	0	0	0	0	106.7	I117 S121 F122	I117-S119 PolarHBondContact O-N 3.02Å; S119-S121 WeakPolarHBondContact CB-OG 3.31Å; S119-S121 PolarHBondContact O-N 3.4Å; S119-F122 WeakPolarHBondContact O-CD2 3.46Å; S119-F122 WeakPolarHBondContact O-CE2 3.42Å
120	A	56.4	Low	56.3	Low	82 Å²	82	115.6 Å²	115.6	68%	0.678	63%	0.634	S	S	*	*	G	3₁₀ helix	trans	-61.3	17.1	174.7	0	0	0	0	0	114.1	V118	V118-A120 PolarHBondContact O-N 3.32Å; V118-A120 VanDerWaalsContact O-N 3.13Å
121	S	57.7	Low	57	Low	75 Å²	75	119.4 Å²	119.4	52%	0.524	66%	0.661	S	S	.	*	G	3₁₀ helix	trans	-83.8	-5.1	177	56.3	0	0	0	0	114.1	S119 F123	S119-S121 WeakPolarHBondContact CB-OG 3.31Å; S119-S121 PolarHBondContact O-N 3.4Å; S121-F123 PolarHBondContact O-N 3.19Å
122	F	58.5	Low	57.3	Low	154 Å²	154	117.8 Å²	117.8	68%	0.675	65%	0.652	S	S	*	*	G	3₁₀ helix	trans	-77.5	-1.6	177.5	-41.4	-66.6	0	0	0	114.1	V118 S119 F124	V118-F122 HydrophobicContact CG1-CE2 4.34Å; S119-F122 WeakPolarHBondContact O-CD2 3.46Å; S119-F122 WeakPolarHBondContact O-CE2 3.42Å; F122-F124 VanDerWaalsContact C-N 3.28Å; F122-F124 PolarHBondContact O-N 3.48Å
123	F	56.4	Low	57.5	Low	184 Å²	184	121.5 Å²	121.5	81%	0.807	67%	0.67	S	S	*	*	G	3₁₀ helix	trans	-82.9	2.1	176.6	-72.6	-78.5	0	0	0	114.1	S121 D125	S121-F123 PolarHBondContact O-N 3.19Å; F123-D125 PolarHBondContact O-N 3.43Å
124	F	55.3	Low	57.5	Low	165 Å²	165	124.5 Å²	124.5	72%	0.724	68%	0.676	S	S	*	*			trans	-91.1	80	166.8	-69.1	-77.6	0	0	0	109.5	F122 N126	F122-F124 VanDerWaalsContact C-N 3.28Å; F122-F124 PolarHBondContact O-N 3.48Å; F124-N126 VanDerWaalsContact C-N 3.3Å; F124-N126 PolarHBondContact O-N 3.4Å
125	D	56.3	Low	57.4	Low	134 Å²	134	123.4 Å²	123.4	72%	0.717	68%	0.68	S	S	*	*			trans	-64.8	93.4	161.7	-174	8.5	0	0	0	108.5	F123 S127	F123-D125 PolarHBondContact O-N 3.43Å; D125-S127 PolarHBondContact O-N 3.49Å; D125-S127 WeakPolarHBondContact OD1-CB 3.03Å; D125-S127 PolarHBondContact OD1-N 3.45Å
126	N	59.7	Low	57	Low	144 Å²	144	124.2 Å²	124.2	77%	0.77	70%	0.696	S	S	*	*			trans	-88.5	33.1	169.8	-68	-26.4	0	0	0	110.9	F124 P128	F124-N126 VanDerWaalsContact C-N 3.3Å; F124-N126 PolarHBondContact O-N 3.4Å; N126-P128 WeakPolarHBondContact O-CD 3.34Å
127	S	63.4	Low	57.1	Low	74 Å²	74	129.1 Å²	129.1	52%	0.517	72%	0.715	S	S	.	*	P	Polyproline II helix	trans	-51.2	118.7	169.9	164	0	0	0	0	109.9	D125 I129	D125-S127 PolarHBondContact O-N 3.49Å; D125-S127 WeakPolarHBondContact OD1-CB 3.03Å; D125-S127 PolarHBondContact OD1-N 3.45Å; S127-I129 PolarHBondContact O-N 2.89Å
128	P	59.9	Low	57.2	Low	114 Å²	114	130.3 Å²	130.3	74%	0.74	72%	0.724	S	S	*	*	P	Polyproline II helix	trans	-65.4	121.3	176.1	25.2	-30	0	0	0	108.5	N126 P130	N126-P128 WeakPolarHBondContact O-CD 3.34Å; P128-P130 VanDerWaalsContact O-N 3.17Å
129	I	60.5	Low	57.5	Low	151 Å²	151	131.5 Å²	131.5	77%	0.774	73%	0.727	S	S	*	*	P	Polyproline II helix	trans	-49.9	122	173.4	-61.2	165.1	0	0	0	108.1	S127 S131	S127-I129 PolarHBondContact O-N 2.89Å; I129-S131 PolarHBondContact O-N 3.38Å; I129-S131 VanDerWaalsContact O-N 3.16Å
130	P	59.1	Low	57.7	Low	79 Å²	79	135.9 Å²	135.9	51%	0.513	75%	0.748	S	S	.	*	P	Polyproline II helix	trans	-62.8	121.3	-179.9	22.9	-30.9	0	0	0	109.5	P128 N132	P128-P130 VanDerWaalsContact O-N 3.17Å; P130-N132 PolarHBondContact O-N 2.58Å
131	S	64	Low	57.7	Low	114 Å²	114	139.1 Å²	139.1	80%	0.797	75%	0.752	S	S	*	*	G	3₁₀ helix	trans	-67.9	3.5	179.4	51.1	0	0	0	0	114.2	I129 I133	I129-S131 PolarHBondContact O-N 3.38Å; I129-S131 VanDerWaalsContact O-N 3.16Å; S131-I133 PolarHBondContact O-N 3.03Å
132	N	61.6	Low	57.8	Low	132 Å²	132	143.1 Å²	143.1	71%	0.706	77%	0.766	S	S	*	*	G	3₁₀ helix	trans	-78.4	-2.7	-177.4	76.4	-13.6	0	0	0	114.4	P130 M134	P130-N132 PolarHBondContact O-N 2.58Å; N132-M134 VanDerWaalsContact C-N 3.33Å
133	I	58	Low	57.7	Low	140 Å²	140	142.3 Å²	142.3	72%	0.718	77%	0.772	S	S	*	*	G	3₁₀ helix	trans	-84.9	-8.2	178.1	-50.3	-179.9	0	0	0	111.6	S131	S131-I133 PolarHBondContact O-N 3.03Å
134	M	56.6	Low	57.8	Low	185 Å²	185	139.4 Å²	139.4	91%	0.911	77%	0.77	S	S	*	*	S	Bend	trans	-100.5	5.5	-169.8	-129.5	160.2	-165.1	0	0	116.5	N132	N132-M134 VanDerWaalsContact C-N 3.33Å
135	S	53.2	Low	58	Low	118 Å²	118	137.4 Å²	137.4	83%	0.825	77%	0.773	S	S	*	*			trans	-132.7	63.9	179.9	-169.8	0	0	0	0	112.4
136	S	50.2	Low	58.1	Low	120 Å²	120	137.7 Å²	137.7	84%	0.839	78%	0.778	S	S	*	*			trans	-125.7	93.5	158.9	-176.7	0	0	0	0	107.9
137	K	51.3	Low	58	Low	281 Å²	281	137.1 Å²	137.1	100%	1.222	78%	0.779	S	S	*	*			trans	-154.4	0	158.5	-121.6	-174	-176.2	-174.2	0	108.9

Retrieved 137 of 137 residues in 96.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).