G4VAZ8_SCHMA Loading...

Small integral membrane protein 15

AlphaFold DB , UniProt , Accession G4VAZ8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 104 aa.

						>G4VAZ8_SCHMA|G4VAZ8
MNDHPSEPLEVDSLNKLNSINLGHSPDNWSDWFSYMSLQFVLYVAKSPWEFLTSVLIILTPLMIICAYCSYKLAKELKRQEADQKMKARRTAAINKSKKQVKVD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.6	Very low	58	Low	228 Å²	228	139.1 Å²	139.1	100%	1.123	75%	0.749	S	S	*	*				0	79.1	0	-82.6	121.7	143.8	0	0	105.1
2	N	49	Very low	58.7	Low	137 Å²	137	137.4 Å²	137.4	73%	0.733	74%	0.739	S	S	*	*				49.1	109.8	57.2	-51.4	22.7	0	0	0	106.5
3	D	52.5	Low	59.5	Low	149 Å²	149	132.6 Å²	132.6	80%	0.797	72%	0.723	S	S	*	*				-152.5	122.9	65.4	-60.5	-56.4	0	0	0	110.1
4	H	60.4	Low	59.8	Low	166 Å²	166	130.5 Å²	130.5	77%	0.769	71%	0.71	S	S	*	*				54.2	108.9	103.1	-116.2	-80	0	0	0	114.9	S6	H4-S6 PolarHBondContact O-N 3.11Å
5	P	58.3	Low	60.4	Low	128 Å²	128	128.5 Å²	128.5	83%	0.831	70%	0.698	S	S	*	*			trans	-80.5	98.6	173.2	31.5	-28.8	0	0	0	109.5
6	S	59.8	Low	60.8	Low	90 Å²	90	130.4 Å²	130.4	63%	0.629	70%	0.698	S	S	*	*			trans	-92	106.6	176.8	-60.1	0	0	0	0	111.5	H4	H4-S6 PolarHBondContact O-N 3.11Å
7	E	62.4	Low	61	Low	141 Å²	141	129.8 Å²	129.8	66%	0.659	69%	0.694	S	S	*	*				63.7	113.9	129.7	-70.7	171.6	93.1	0	0	121	L9	E7-L9 PolarHBondContact O-N 3.12Å; E7-L9 VanDerWaalsContact O-N 3.13Å; E7-L9 WeakPolarHBondContact OE1-CD1 3.37Å
8	P	64.3	Low	61.1	Low	113 Å²	113	127.8 Å²	127.8	73%	0.734	68%	0.683	S	S	*	*	S	Bend	trans	-77.5	27.3	167.4	32.8	-34.3	0	0	0	114.5	V11	P8-V11 WeakPolarHBondContact O-CG2 3.35Å
9	L	61.7	Low	61.1	Low	112 Å²	112	125.6 Å²	125.6	59%	0.586	68%	0.679	S	S	*	*	H	α-helix	trans	-82.7	-18.5	-170	-89.2	174.8	0	0	0	116.2	E7	E7-L9 PolarHBondContact O-N 3.12Å; E7-L9 VanDerWaalsContact O-N 3.13Å; E7-L9 WeakPolarHBondContact OE1-CD1 3.37Å
10	E	62.8	Low	60.9	Low	171 Å²	171	125.3 Å²	125.3	80%	0.799	68%	0.676	S	S	*	*	H	α-helix	trans	-78.5	-35.7	179.8	-91.8	-162.7	96.4	0	0	113.7	D12 S13 L14	E10-D12 VanDerWaalsContact C-N 3.26Å; E10-D12 PolarHBondContact O-N 3.11Å; E10-S13 PolarHBondContact O-N 3.08Å; E10-L14 PolarHBondContact O-N 3.35Å; E10-L14 VanDerWaalsContact O-N 3.09Å
11	V	63.8	Low	60.6	Low	95 Å²	95	125.1 Å²	125.1	58%	0.576	67%	0.674	S	S	*	*	H	α-helix	trans	-65.2	-31.4	-174.9	-68.5	0	0	0	0	112.7	P8 N15	P8-V11 WeakPolarHBondContact O-CG2 3.35Å; V11-N15 WeakPolarHBondContact O-CB 3.3Å; V11-N15 PolarHBondContact O-N 3.11Å; V11-N15 PolarHBondContact O-ND2 3.01Å
12	D	67	Low	61.4	Low	119 Å²	119	122.6 Å²	122.6	64%	0.636	67%	0.665	S	S	*	*	H	α-helix	trans	-75.1	-36.7	180	-133.6	18.7	0	0	0	111.4	E10 N15 K16	E10-D12 VanDerWaalsContact C-N 3.26Å; E10-D12 PolarHBondContact O-N 3.11Å; D12-N15 PolarHBondContact O-N 3.27Å; D12-K16 WeakPolarHBondContact O-CB 3.3Å; D12-K16 PolarHBondContact O-N 2.99Å
13	S	68.4	Low	61.8	Low	75 Å²	75	119.3 Å²	119.3	52%	0.524	66%	0.663	S	S	.	*	H	α-helix	trans	-66.7	-38.1	174.6	-63.2	0	0	0	0	111.9	E10 K16 L17	E10-S13 PolarHBondContact O-N 3.08Å; S13-K16 PolarHBondContact O-N 2.87Å; S13-L17 PolarHBondContact O-N 3.48Å
14	L	65	Low	61.9	Low	103 Å²	103	119.1 Å²	119.1	54%	0.539	66%	0.657	S	S	.	*	H	α-helix	trans	-71.8	-38.6	177.9	-160	148.2	0	0	0	111.7	E10 K16 L17 N18	E10-L14 PolarHBondContact O-N 3.35Å; E10-L14 VanDerWaalsContact O-N 3.09Å; L14-K16 VanDerWaalsContact C-N 3.3Å; L14-K16 PolarHBondContact O-N 3.47Å; L14-L17 PolarHBondContact O-N 3.38Å; L14-N18 WeakPolarHBondContact CD2-ND2 3.41Å; L14-N18 WeakPolarHBondContact O-CB 3.33Å; L14-N18 PolarHBondContact O-N 3.27Å
15	N	67.4	Low	61.7	Low	101 Å²	101	115.4 Å²	115.4	54%	0.54	65%	0.65	S	S	.	*	H	α-helix	trans	-62.7	-37.4	170	-83.9	-40.7	0	0	0	112.1	V11 D12 N18 S19	V11-N15 WeakPolarHBondContact O-CB 3.3Å; V11-N15 PolarHBondContact O-N 3.11Å; V11-N15 PolarHBondContact O-ND2 3.01Å; D12-N15 PolarHBondContact O-N 3.27Å; N15-N18 PolarHBondContact O-N 2.95Å; N15-S19 WeakPolarHBondContact O-CB 3.28Å; N15-S19 PolarHBondContact O-N 3.44Å
16	K	67.4	Low	61.8	Low	158 Å²	158	113.1 Å²	113.1	69%	0.687	63%	0.634	S	S	*	*	H	α-helix	trans	-66.6	-40.1	176	-148.3	179.6	-173.1	-162.5	0	112.2	D12 S13 L14 S19	D12-K16 WeakPolarHBondContact O-CB 3.3Å; D12-K16 PolarHBondContact O-N 2.99Å; S13-K16 PolarHBondContact O-N 2.87Å; L14-K16 VanDerWaalsContact C-N 3.3Å; L14-K16 PolarHBondContact O-N 3.47Å; K16-S19 PolarHBondContact O-N 3.45Å; K16-S19 PolarHBondContact O-OG 3.27Å
17	L	64.4	Low	62.1	Low	120 Å²	120	114.7 Å²	114.7	63%	0.628	64%	0.636	S	S	*	*	H	α-helix	trans	-65.2	-43.6	172.7	-81.5	161	0	0	0	112.1	S13 L14 S19 I20	S13-L17 PolarHBondContact O-N 3.48Å; L14-L17 PolarHBondContact O-N 3.38Å; L17-S19 VanDerWaalsContact C-N 3.26Å; L17-S19 PolarHBondContact O-N 2.99Å; L17-I20 HydrophobicContact CD2-CD1 4.39Å; L17-I20 WeakPolarHBondContact O-CB 3.31Å; L17-I20 PolarHBondContact O-N 3.05Å; L17-I20 VanDerWaalsContact O-N 3.11Å
18	N	62.8	Low	62.9	Low	94 Å²	94	112 Å²	112	50%	0.503	63%	0.626	S	S	.	*	H	α-helix	trans	-67	-26	175.7	-81.4	-24.3	0	0	0	112.8	L14 N15 I20 N21	L14-N18 WeakPolarHBondContact CD2-ND2 3.41Å; L14-N18 WeakPolarHBondContact O-CB 3.33Å; L14-N18 PolarHBondContact O-N 3.27Å; N15-N18 PolarHBondContact O-N 2.95Å; N18-I20 PolarHBondContact O-N 3.19Å; N18-N21 PolarHBondContact O-ND2 3.48Å
19	S	61	Low	63.6	Low	86 Å²	86	115.8 Å²	115.8	60%	0.601	63%	0.626	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.5	-11.6	173.7	76.3	0	0	0	0	113.6	N15 K16 L17 N21	N15-S19 WeakPolarHBondContact O-CB 3.28Å; N15-S19 PolarHBondContact O-N 3.44Å; K16-S19 PolarHBondContact O-N 3.45Å; K16-S19 PolarHBondContact O-OG 3.27Å; L17-S19 VanDerWaalsContact C-N 3.26Å; L17-S19 PolarHBondContact O-N 2.99Å; S19-N21 PolarHBondContact O-N 2.88Å
20	I	57.8	Low	64.5	Low	120 Å²	120	113.6 Å²	113.6	62%	0.615	62%	0.62	S	S	*	*			trans	-78.7	55.5	167	-48.7	171.5	0	0	0	108	L17 N18 L22	L17-I20 HydrophobicContact CD2-CD1 4.39Å; L17-I20 WeakPolarHBondContact O-CB 3.31Å; L17-I20 PolarHBondContact O-N 3.05Å; L17-I20 VanDerWaalsContact O-N 3.11Å; N18-I20 PolarHBondContact O-N 3.19Å; I20-L22 PolarHBondContact O-N 3.42Å
21	N	54.7	Low	65.2	Low	122 Å²	122	109.4 Å²	109.4	65%	0.652	60%	0.603	S	S	*	*			trans	-83.3	112.3	175.5	-116	-79.2	0	0	0	107.6	N18 S19 G23	N18-N21 PolarHBondContact O-ND2 3.48Å; S19-N21 PolarHBondContact O-N 2.88Å; N21-G23 PolarHBondContact O-N 3.47Å
22	L	57.9	Low	66.1	Low	175 Å²	175	110 Å²	110	92%	0.916	60%	0.595	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.3	30.8	174.8	-99.7	85.8	0	0	0	114.3	I20	I20-L22 PolarHBondContact O-N 3.42Å
23	G	57.1	Low	67.1	Low	67 Å²	67	109.6 Å²	109.6	69%	0.691	59%	0.588	S	S	*	*	T	Hydrogen-bonded Turn	trans	-122	1.7	-175.6	0	0	0	0	0	115.1	N21	N21-G23 PolarHBondContact O-N 3.47Å
24	H	54.5	Low	67.8	Low	145 Å²	145	109.3 Å²	109.3	67%	0.671	59%	0.585	S	S	*	*	S	Bend	trans	-81.4	124.5	179.2	-157.5	85.4	0	0	0	109.8	D27	H24-D27 IonicContact CD2-OD2 3.55Å; H24-D27 IonicContact CE1-OD2 3.87Å; H24-D27 IonicContact NE2-OD2 2.78Å; H24-D27 PolarHBondContact NE2-OD2 3.47Å
25	S	57.9	Low	68.6	Low	89 Å²	89	110.8 Å²	110.8	62%	0.622	59%	0.585	S	S	*	*			trans	-50.8	137.7	171.7	-71.4	0	0	0	0	109.5	D27	S25-D27 VanDerWaalsContact C-N 3.32Å; S25-D27 PolarHBondContact O-N 2.84Å
26	P	58.7	Low	69.4	Low	79 Å²	79	108.5 Å²	108.5	51%	0.513	57%	0.572	S	S	.	*			trans	-69.4	90.2	-173.1	27.9	-34.2	0	0	0	110.4	N28 W32	P26-N28 PolarHBondContact O-N 2.99Å; P26-W32 HydrophobicContact CB-CB 3.98Å; P26-W32 HydrophobicContact CG-CB 4.42Å
27	D	67.4	Low	70.3	Confident	124 Å²	124	103 Å²	103	66%	0.663	55%	0.553	S	S	*	*			trans	-69.6	-19.9	168.4	-71.3	-31.5	0	0	0	110.6	H24 S25	H24-D27 IonicContact CD2-OD2 3.55Å; H24-D27 IonicContact CE1-OD2 3.87Å; H24-D27 IonicContact NE2-OD2 2.78Å; H24-D27 PolarHBondContact NE2-OD2 3.47Å; S25-D27 VanDerWaalsContact C-N 3.32Å; S25-D27 PolarHBondContact O-N 2.84Å
28	N	78.3	Confident	71.2	Confident	85 Å²	85	102.5 Å²	102.5	46%	0.455	55%	0.551	S	S	.	*	S	Bend	trans	-110.9	130.4	-175.9	-45.3	-42.1	0	0	0	110.9	P26 S30 D31 W32	P26-N28 PolarHBondContact O-N 2.99Å; N28-S30 PolarHBondContact O-N 3.29Å; N28-D31 HydrophobicContact CB-CB 4.44Å; N28-D31 PolarHBondContact ND2-OD2 3.04Å; N28-D31 PolarHBondContact O-N 2.97Å; N28-D31 VanDerWaalsContact O-N 3.14Å; N28-W32 PolarHBondContact O-N 2.67Å
29	W	79.1	Confident	72.2	Confident	192 Å²	192	102.2 Å²	102.2	73%	0.727	55%	0.546	S	S	*	.	H	α-helix	trans	-59.6	-28.7	174.9	-170.7	76.7	0	0	0	112.6	W32 F33	W29-W32 AromaticContact CD1-CE3 3.98Å; W29-W32 AromaticContact NE1-CE3 3.78Å; W29-W32 AromaticContact NE1-CZ3 3.68Å; W29-F33 HydrophobicContact CH2-CD2 4.37Å; W29-F33 VanDerWaalsContact O-CB 3.3Å; W29-F33 WeakPolarHBondContact O-CB 3.42Å; W29-F33 PolarHBondContact O-N 2.76Å
30	S	81.5	Confident	73.2	Confident	65 Å²	65	103.6 Å²	103.6	46%	0.455	54%	0.542	S	S	.	.	H	α-helix	trans	-65.2	-39	176.2	55.5	0	0	0	0	113.3	N28 F33 S34	N28-S30 PolarHBondContact O-N 3.29Å; S30-F33 PolarHBondContact O-N 3.41Å; S30-S34 WeakPolarHBondContact O-CB 3.19Å; S30-S34 PolarHBondContact O-N 2.79Å; S30-S34 PolarHBondContact O-OG 3.39Å
31	D	77.9	Confident	74.4	Confident	83 Å²	83	102.5 Å²	102.5	44%	0.444	54%	0.54	S	S	.	.	H	α-helix	trans	-76.9	-39	-177.2	-61.9	-16.3	0	0	0	109.9	N28 S34 Y35	N28-D31 HydrophobicContact CB-CB 4.44Å; N28-D31 PolarHBondContact ND2-OD2 3.04Å; N28-D31 PolarHBondContact O-N 2.97Å; N28-D31 VanDerWaalsContact O-N 3.14Å; D31-S34 PolarHBondContact O-N 3.36Å; D31-Y35 WeakPolarHBondContact O-CB 3.04Å; D31-Y35 PolarHBondContact O-N 3.45Å
32	W	81.4	Confident	75.7	Confident	108 Å²	108	102.2 Å²	102.2	41%	0.409	54%	0.538	S	S	.	.	H	α-helix	trans	-59.4	-45.4	169.1	176.2	81.5	0	0	0	112	P26 N28 W29 S34 Y35 M36	P26-W32 HydrophobicContact CB-CB 3.98Å; P26-W32 HydrophobicContact CG-CB 4.42Å; N28-W32 PolarHBondContact O-N 2.67Å; W29-W32 AromaticContact CD1-CE3 3.98Å; W29-W32 AromaticContact NE1-CE3 3.78Å; W29-W32 AromaticContact NE1-CZ3 3.68Å; W32-S34 VanDerWaalsContact C-N 3.33Å; W32-S34 PolarHBondContact O-N 3.34Å; W32-Y35 PolarHBondContact O-N 3.48Å; W32-M36 HydrophobicContact CD2-CG 4.06Å; W32-M36 HydrophobicContact CG-CG 4.5Å; W32-M36 HydrophobicContact CH2-CG 4.35Å; W32-M36 HydrophobicContact CZ2-CE 4.27Å; W32-M36 HydrophobicContact CZ2-CG 3.79Å; W32-M36 WeakPolarHBondContact O-CB 3.25Å; W32-M36 VanDerWaalsContact O-CG 3.32Å; W32-M36 WeakPolarHBondContact O-CG 3.35Å; W32-M36 PolarHBondContact O-N 3.02Å
33	F	87.7	Confident	76.7	Confident	111 Å²	111	99.2 Å²	99.2	49%	0.487	52%	0.515	S	S	.	.	H	α-helix	trans	-64.9	-38.2	177.5	-174.6	-94.1	0	0	0	111.8	W29 S30 M36 S37	W29-F33 HydrophobicContact CH2-CD2 4.37Å; W29-F33 VanDerWaalsContact O-CB 3.3Å; W29-F33 WeakPolarHBondContact O-CB 3.42Å; W29-F33 PolarHBondContact O-N 2.76Å; S30-F33 PolarHBondContact O-N 3.41Å; F33-M36 PolarHBondContact O-N 2.84Å; F33-S37 VanDerWaalsContact O-CB 3.26Å; F33-S37 WeakPolarHBondContact O-CB 3.42Å; F33-S37 PolarHBondContact O-N 3.27Å; F33-S37 PolarHBondContact O-OG 2.97Å
34	S	83.6	Confident	77.9	Confident	68 Å²	68	98.5 Å²	98.5	48%	0.476	50%	0.498	S	S	.	.	H	α-helix	trans	-64.6	-44.4	175.9	-60.1	0	0	0	0	111.3	S30 D31 W32 S37 L38	S30-S34 WeakPolarHBondContact O-CB 3.19Å; S30-S34 PolarHBondContact O-N 2.79Å; S30-S34 PolarHBondContact O-OG 3.39Å; D31-S34 PolarHBondContact O-N 3.36Å; W32-S34 VanDerWaalsContact C-N 3.33Å; W32-S34 PolarHBondContact O-N 3.34Å; S34-S37 WeakPolarHBondContact CA-OG 3.47Å; S34-S37 PolarHBondContact O-OG 2.91Å; S34-L38 WeakPolarHBondContact O-CB 3.25Å; S34-L38 PolarHBondContact O-N 2.81Å
35	Y	81.8	Confident	79.1	Confident	134 Å²	134	95.3 Å²	95.3	53%	0.525	50%	0.496	S	S	.	.	H	α-helix	trans	-60.7	-48.5	173.6	174.8	-101.8	0	0	0	112.2	D31 W32 L38 Q39	D31-Y35 WeakPolarHBondContact O-CB 3.04Å; D31-Y35 PolarHBondContact O-N 3.45Å; W32-Y35 PolarHBondContact O-N 3.48Å; Y35-L38 PolarHBondContact O-N 3.45Å; Y35-Q39 HydrophobicContact CE1-CG 4.31Å; Y35-Q39 HydrophobicContact CE2-CG 4.48Å; Y35-Q39 WeakPolarHBondContact O-CG 3.17Å; Y35-Q39 PolarHBondContact O-N 2.83Å; Y35-Q39 PolarHBondContact OH-NE2 3.03Å
36	M	85.2	Confident	80.2	Confident	53 Å²	53	99.6 Å²	99.6	26%	0.261	50%	0.504	S	S	.	.	H	α-helix	trans	-63.3	-47.1	179.5	-74.2	-64.1	165.3	0	0	111.5	W32 F33 L38 Q39 F40	W32-M36 HydrophobicContact CD2-CG 4.06Å; W32-M36 HydrophobicContact CG-CG 4.5Å; W32-M36 HydrophobicContact CH2-CG 4.35Å; W32-M36 HydrophobicContact CZ2-CE 4.27Å; W32-M36 HydrophobicContact CZ2-CG 3.79Å; W32-M36 WeakPolarHBondContact O-CB 3.25Å; W32-M36 VanDerWaalsContact O-CG 3.32Å; W32-M36 WeakPolarHBondContact O-CG 3.35Å; W32-M36 PolarHBondContact O-N 3.02Å; F33-M36 PolarHBondContact O-N 2.84Å; M36-L38 VanDerWaalsContact C-N 3.31Å; M36-L38 PolarHBondContact O-N 3.19Å; M36-Q39 WeakPolarHBondContact O-CB 3.42Å; M36-Q39 PolarHBondContact O-N 2.87Å; M36-F40 WeakPolarHBondContact O-CD2 3.43Å; M36-F40 PolarHBondContact O-N 3.02Å
37	S	85.7	Confident	81.3	Confident	44 Å²	44	98.1 Å²	98.1	31%	0.308	50%	0.495	S	S	.	.	H	α-helix	trans	-61.4	-39.7	178.3	62	0	0	0	0	111.9	F33 S34 F40 V41	F33-S37 VanDerWaalsContact O-CB 3.26Å; F33-S37 WeakPolarHBondContact O-CB 3.42Å; F33-S37 PolarHBondContact O-N 3.27Å; F33-S37 PolarHBondContact O-OG 2.97Å; S34-S37 WeakPolarHBondContact CA-OG 3.47Å; S34-S37 PolarHBondContact O-OG 2.91Å; S37-F40 PolarHBondContact O-N 3.33Å; S37-V41 VanDerWaalsContact O-CG2 3.28Å; S37-V41 WeakPolarHBondContact O-CG2 3.4Å; S37-V41 PolarHBondContact O-N 3.14Å
38	L	83.8	Confident	82.1	Confident	109 Å²	109	95.8 Å²	95.8	57%	0.571	49%	0.487	S	S	*	.	H	α-helix	trans	-63.8	-42.5	175	-169.3	69.1	0	0	0	111.9	S34 Y35 M36 V41 L42	S34-L38 WeakPolarHBondContact O-CB 3.25Å; S34-L38 PolarHBondContact O-N 2.81Å; Y35-L38 PolarHBondContact O-N 3.45Å; M36-L38 VanDerWaalsContact C-N 3.31Å; M36-L38 PolarHBondContact O-N 3.19Å; L38-V41 PolarHBondContact O-N 3.43Å; L38-L42 WeakPolarHBondContact O-CG 3.41Å; L38-L42 PolarHBondContact O-N 3.26Å
39	Q	82.2	Confident	82.4	Confident	88 Å²	88	100.9 Å²	100.9	41%	0.411	50%	0.5	S	S	.	.	H	α-helix	trans	-61.2	-43.9	173.1	-74.6	-161.1	-16.9	0	0	112.2	Y35 M36 L42 Y43	Y35-Q39 HydrophobicContact CE1-CG 4.31Å; Y35-Q39 HydrophobicContact CE2-CG 4.48Å; Y35-Q39 WeakPolarHBondContact O-CG 3.17Å; Y35-Q39 PolarHBondContact O-N 2.83Å; Y35-Q39 PolarHBondContact OH-NE2 3.03Å; M36-Q39 WeakPolarHBondContact O-CB 3.42Å; M36-Q39 PolarHBondContact O-N 2.87Å; Q39-L42 PolarHBondContact O-N 3.45Å; Q39-Y43 VanDerWaalsContact O-CB 3.32Å; Q39-Y43 WeakPolarHBondContact O-CB 3.22Å; Q39-Y43 PolarHBondContact O-N 2.91Å
40	F	82.3	Confident	82.6	Confident	115 Å²	115	96.9 Å²	96.9	50%	0.504	49%	0.489	S	S	.	.	H	α-helix	trans	-61.1	-44.3	176	-86	-69.7	0	0	0	111.3	M36 S37 Y43 V44 F51	M36-F40 WeakPolarHBondContact O-CD2 3.43Å; M36-F40 PolarHBondContact O-N 3.02Å; S37-F40 PolarHBondContact O-N 3.33Å; F40-Y43 PolarHBondContact O-N 3.27Å; F40-V44 WeakPolarHBondContact O-CB 3.25Å; F40-V44 WeakPolarHBondContact O-CG2 3.16Å; F40-V44 PolarHBondContact O-N 3.04Å; F40-F51 AromaticContact CD1-CE2 3.9Å; F40-F51 HydrophobicContact CD1-CE2 3.9Å; F40-F51 HydrophobicContact CE1-CE2 4.12Å
41	V	83.1	Confident	82.8	Confident	96 Å²	96	96.3 Å²	96.3	58%	0.582	48%	0.479	S	S	*	.	H	α-helix	trans	-62.9	-44.7	177.9	170.9	0	0	0	0	111.1	S37 L38 Y43 V44 A45	S37-V41 VanDerWaalsContact O-CG2 3.28Å; S37-V41 WeakPolarHBondContact O-CG2 3.4Å; S37-V41 PolarHBondContact O-N 3.14Å; L38-V41 PolarHBondContact O-N 3.43Å; V41-Y43 VanDerWaalsContact C-N 3.31Å; V41-Y43 PolarHBondContact O-N 2.96Å; V41-V44 PolarHBondContact O-N 3.42Å; V41-A45 VanDerWaalsContact O-CB 3.32Å; V41-A45 WeakPolarHBondContact O-CB 3.48Å; V41-A45 PolarHBondContact O-N 3.4Å
42	L	82.1	Confident	83.2	Confident	117 Å²	117	96.7 Å²	96.7	61%	0.613	48%	0.481	S	S	*	.	H	α-helix	trans	-61.9	-39.5	175.1	-74.8	172	0	0	0	112.1	L38 Q39 A45 K46	L38-L42 WeakPolarHBondContact O-CG 3.41Å; L38-L42 PolarHBondContact O-N 3.26Å; Q39-L42 PolarHBondContact O-N 3.45Å; L42-A45 PolarHBondContact O-N 3.39Å; L42-K46 PolarHBondContact O-N 3.1Å; L42-K46 VanDerWaalsContact O-N 3.14Å
43	Y	80.1	Confident	83.6	Confident	111 Å²	111	94 Å²	94	44%	0.435	48%	0.476	S	S	.	.	H	α-helix	trans	-66	-47.2	176.8	-177.7	-101	0	0	0	111.9	Q39 F40 V41 A45 K46 S47 F51	Q39-Y43 VanDerWaalsContact O-CB 3.32Å; Q39-Y43 WeakPolarHBondContact O-CB 3.22Å; Q39-Y43 PolarHBondContact O-N 2.91Å; F40-Y43 PolarHBondContact O-N 3.27Å; V41-Y43 VanDerWaalsContact C-N 3.31Å; V41-Y43 PolarHBondContact O-N 2.96Å; Y43-A45 VanDerWaalsContact C-N 3.29Å; Y43-A45 PolarHBondContact O-N 3.33Å; Y43-K46 PolarHBondContact O-N 2.78Å; Y43-S47 PolarHBondContact O-N 3.3Å; Y43-F51 HydrophobicContact CD1-CB 4.14Å; Y43-F51 AromaticContact CD1-CD2 3.83Å; Y43-F51 HydrophobicContact CD1-CD2 3.83Å; Y43-F51 HydrophobicContact CD1-CG 4.37Å; Y43-F51 HydrophobicContact CE1-CB 3.8Å; Y43-F51 AromaticContact CE1-CD2 3.84Å; Y43-F51 HydrophobicContact CE1-CD2 3.84Å; Y43-F51 HydrophobicContact CE1-CG 4.31Å
44	V	82.5	Confident	83.6	Confident	53 Å²	53	91.1 Å²	91.1	32%	0.321	47%	0.47	S	S	.	.	H	α-helix	trans	-60.9	-38.6	176.3	171.2	0	0	0	0	111	F40 V41 S47 P48 F51	F40-V44 WeakPolarHBondContact O-CB 3.25Å; F40-V44 WeakPolarHBondContact O-CG2 3.16Å; F40-V44 PolarHBondContact O-N 3.04Å; V41-V44 PolarHBondContact O-N 3.42Å; V44-S47 CarbonylContact O-C 3.6Å; V44-P48 WeakPolarHBondContact O-CA 3.42Å; V44-P48 WeakPolarHBondContact O-CD 3.45Å; V44-F51 HydrophobicContact CG2-CB 4.34Å; V44-F51 HydrophobicContact CG2-CD1 3.69Å; V44-F51 HydrophobicContact CG2-CD2 4.05Å; V44-F51 HydrophobicContact CG2-CE1 3.9Å; V44-F51 HydrophobicContact CG2-CE2 4.25Å; V44-F51 HydrophobicContact CG2-CG 3.75Å; V44-F51 HydrophobicContact CG2-CZ 4.17Å
45	A	79.1	Confident	83.9	Confident	78 Å²	78	90.5 Å²	90.5	65%	0.645	46%	0.463	S	S	*	.	H	α-helix	trans	-67.4	-33.3	177.7	0	0	0	0	0	113.1	V41 L42 Y43	V41-A45 VanDerWaalsContact O-CB 3.32Å; V41-A45 WeakPolarHBondContact O-CB 3.48Å; V41-A45 PolarHBondContact O-N 3.4Å; L42-A45 PolarHBondContact O-N 3.39Å; Y43-A45 VanDerWaalsContact C-N 3.29Å; Y43-A45 PolarHBondContact O-N 3.33Å
46	K	80.4	Confident	84.3	Confident	178 Å²	178	88.8 Å²	88.8	77%	0.774	46%	0.462	S	S	*	.	H	α-helix	trans	-74	-42.4	180	-171	175	176.6	70.1	0	112.4	L42 Y43	L42-K46 PolarHBondContact O-N 3.1Å; L42-K46 VanDerWaalsContact O-N 3.14Å; Y43-K46 PolarHBondContact O-N 2.78Å
47	S	81.6	Confident	84.7	Confident	48 Å²	48	91.8 Å²	91.8	34%	0.336	48%	0.478	S	S	.	.			trans	-150	84.4	-176.8	-65.3	0	0	0	0	111	Y43 V44 W49 F51	Y43-S47 PolarHBondContact O-N 3.3Å; V44-S47 CarbonylContact O-C 3.6Å; S47-W49 VanDerWaalsContact C-N 3.26Å; S47-W49 PolarHBondContact O-N 2.95Å; S47-F51 PolarHBondContact O-N 3.37Å
48	P	84.5	Confident	85	Confident	76 Å²	76	95.5 Å²	95.5	49%	0.494	49%	0.493	S	S	.	.	H	α-helix	trans	-63.7	-32.5	-176.5	23.7	-33.5	0	0	0	112.7	V44 L52	V44-P48 WeakPolarHBondContact O-CA 3.42Å; V44-P48 WeakPolarHBondContact O-CD 3.45Å; P48-L52 WeakPolarHBondContact O-CG 3.3Å; P48-L52 PolarHBondContact O-N 3.44Å
49	W	84.4	Confident	85.4	Confident	191 Å²	191	93.9 Å²	93.9	72%	0.723	49%	0.485	S	S	*	.	H	α-helix	trans	-72.8	-40.8	-176.3	-166.5	-103.6	0	0	0	113.7	S47 F51 L52 T53	S47-W49 VanDerWaalsContact C-N 3.26Å; S47-W49 PolarHBondContact O-N 2.95Å; W49-F51 VanDerWaalsContact C-N 3.35Å; W49-L52 PolarHBondContact O-N 2.86Å; W49-T53 WeakPolarHBondContact O-CB 3.45Å; W49-T53 PolarHBondContact O-N 3.41Å; W49-T53 PolarHBondContact O-OG1 3.43Å
50	E	84.5	Confident	85.9	Confident	108 Å²	108	93.3 Å²	93.3	51%	0.505	49%	0.487	S	S	.	.	H	α-helix	trans	-65.8	-38.6	178	-69	-60	142.8	0	0	111.6	T53 S54	E50-T53 PolarHBondContact O-N 2.8Å; E50-S54 WeakPolarHBondContact O-CB 3.48Å; E50-S54 PolarHBondContact O-N 3.29Å; E50-S54 PolarHBondContact O-OG 2.8Å
51	F	84.7	Confident	86.5	Confident	54 Å²	54	90.7 Å²	90.7	24%	0.237	48%	0.482	C	S	.	.	H	α-helix	trans	-61.5	-51.5	174.4	176.2	-103.5	0	0	0	111.4	F40 Y43 V44 S47 W49 T53 S54 V55	F40-F51 AromaticContact CD1-CE2 3.9Å; F40-F51 HydrophobicContact CD1-CE2 3.9Å; F40-F51 HydrophobicContact CE1-CE2 4.12Å; Y43-F51 HydrophobicContact CD1-CB 4.14Å; Y43-F51 AromaticContact CD1-CD2 3.83Å; Y43-F51 HydrophobicContact CD1-CD2 3.83Å; Y43-F51 HydrophobicContact CD1-CG 4.37Å; Y43-F51 HydrophobicContact CE1-CB 3.8Å; Y43-F51 AromaticContact CE1-CD2 3.84Å; Y43-F51 HydrophobicContact CE1-CD2 3.84Å; Y43-F51 HydrophobicContact CE1-CG 4.31Å; V44-F51 HydrophobicContact CG2-CB 4.34Å; V44-F51 HydrophobicContact CG2-CD1 3.69Å; V44-F51 HydrophobicContact CG2-CD2 4.05Å; V44-F51 HydrophobicContact CG2-CE1 3.9Å; V44-F51 HydrophobicContact CG2-CE2 4.25Å; V44-F51 HydrophobicContact CG2-CG 3.75Å; V44-F51 HydrophobicContact CG2-CZ 4.17Å; S47-F51 PolarHBondContact O-N 3.37Å; W49-F51 VanDerWaalsContact C-N 3.35Å; F51-T53 VanDerWaalsContact C-N 3.31Å; F51-T53 PolarHBondContact O-N 2.86Å; F51-S54 PolarHBondContact O-N 2.86Å; F51-V55 HydrophobicContact CD1-CG2 4.21Å; F51-V55 HydrophobicContact CD2-CG2 4.02Å; F51-V55 HydrophobicContact CE1-CG2 3.87Å; F51-V55 HydrophobicContact CE2-CG2 3.66Å; F51-V55 HydrophobicContact CG-CG2 4.3Å; F51-V55 HydrophobicContact CZ-CG2 3.59Å; F51-V55 WeakPolarHBondContact O-CB 3.48Å; F51-V55 VanDerWaalsContact O-CG2 3.23Å; F51-V55 WeakPolarHBondContact O-CG2 3.37Å; F51-V55 PolarHBondContact O-N 3.27Å
52	L	87.3	Confident	87	Confident	91 Å²	91	90.5 Å²	90.5	48%	0.476	48%	0.477	S	S	.	.	H	α-helix	trans	-59.2	-43.5	179.6	-73	171.2	0	0	0	111.7	P48 W49 V55 L56	P48-L52 WeakPolarHBondContact O-CG 3.3Å; P48-L52 PolarHBondContact O-N 3.44Å; W49-L52 PolarHBondContact O-N 2.86Å; L52-V55 PolarHBondContact O-N 3.14Å; L52-L56 WeakPolarHBondContact O-CB 3.47Å; L52-L56 VanDerWaalsContact O-CG 3.23Å; L52-L56 WeakPolarHBondContact O-CG 3.41Å; L52-L56 PolarHBondContact O-N 2.85Å
53	T	88.5	Confident	87.6	Confident	50 Å²	50	90.5 Å²	90.5	31%	0.307	48%	0.475	S	S	.	.	H	α-helix	trans	-63.6	-47.3	179.3	-56.3	0	0	0	0	111.2	W49 E50 F51 V55 L56 I57	W49-T53 WeakPolarHBondContact O-CB 3.45Å; W49-T53 PolarHBondContact O-N 3.41Å; W49-T53 PolarHBondContact O-OG1 3.43Å; E50-T53 PolarHBondContact O-N 2.8Å; F51-T53 VanDerWaalsContact C-N 3.31Å; F51-T53 PolarHBondContact O-N 2.86Å; T53-V55 PolarHBondContact O-N 3.19Å; T53-L56 PolarHBondContact O-N 3.49Å; T53-I57 HydrophobicContact CG2-CD1 3.96Å; T53-I57 VanDerWaalsContact O-CG1 3.29Å; T53-I57 WeakPolarHBondContact O-CG1 3.18Å; T53-I57 PolarHBondContact O-N 3.38Å
54	S	88	Confident	88.3	Confident	51 Å²	51	90.5 Å²	90.5	36%	0.357	48%	0.482	S	S	.	.	H	α-helix	trans	-62	-44.8	177.8	-60.1	0	0	0	0	111.9	E50 F51 L56 I57 I58	E50-S54 WeakPolarHBondContact O-CB 3.48Å; E50-S54 PolarHBondContact O-N 3.29Å; E50-S54 PolarHBondContact O-OG 2.8Å; F51-S54 PolarHBondContact O-N 2.86Å; S54-L56 PolarHBondContact O-N 2.82Å; S54-I57 PolarHBondContact O-N 2.76Å; S54-I58 WeakPolarHBondContact O-CG1 3.31Å; S54-I58 PolarHBondContact O-N 3.32Å; S54-I58 VanDerWaalsContact O-N 3.12Å
55	V	89.8	Confident	88.9	Confident	55 Å²	55	93.2 Å²	93.2	33%	0.333	49%	0.494	S	S	.	.	H	α-helix	trans	-61.4	-44.7	176.2	171	0	0	0	0	110.3	F51 L52 T53 I57 I58 L59	F51-V55 HydrophobicContact CD1-CG2 4.21Å; F51-V55 HydrophobicContact CD2-CG2 4.02Å; F51-V55 HydrophobicContact CE1-CG2 3.87Å; F51-V55 HydrophobicContact CE2-CG2 3.66Å; F51-V55 HydrophobicContact CG-CG2 4.3Å; F51-V55 HydrophobicContact CZ-CG2 3.59Å; F51-V55 WeakPolarHBondContact O-CB 3.48Å; F51-V55 VanDerWaalsContact O-CG2 3.23Å; F51-V55 WeakPolarHBondContact O-CG2 3.37Å; F51-V55 PolarHBondContact O-N 3.27Å; L52-V55 PolarHBondContact O-N 3.14Å; T53-V55 PolarHBondContact O-N 3.19Å; V55-I57 PolarHBondContact O-N 3.44Å; V55-I58 PolarHBondContact O-N 2.91Å; V55-L59 WeakPolarHBondContact O-CA 3.29Å; V55-L59 WeakPolarHBondContact O-CB 3.35Å; V55-L59 PolarHBondContact O-N 2.75Å
56	L	91	Very high	89.6	Confident	99 Å²	99	92.5 Å²	92.5	52%	0.518	48%	0.483	S	S	.	.	H	α-helix	trans	-64.5	-39.1	178.1	-75	170.4	0	0	0	112.5	L52 T53 S54 I58 L59 T60	L52-L56 WeakPolarHBondContact O-CB 3.47Å; L52-L56 VanDerWaalsContact O-CG 3.23Å; L52-L56 WeakPolarHBondContact O-CG 3.41Å; L52-L56 PolarHBondContact O-N 2.85Å; T53-L56 PolarHBondContact O-N 3.49Å; S54-L56 PolarHBondContact O-N 2.82Å; L56-I58 VanDerWaalsContact C-N 3.29Å; L56-I58 PolarHBondContact O-N 2.84Å; L56-L59 PolarHBondContact O-N 3.46Å; L56-T60 VanDerWaalsContact O-CB 3.23Å; L56-T60 WeakPolarHBondContact O-CB 3.38Å; L56-T60 PolarHBondContact O-N 3.26Å; L56-T60 PolarHBondContact O-OG1 2.93Å
57	I	92.8	Very high	90.2	Very high	116 Å²	116	86.9 Å²	86.9	60%	0.595	47%	0.47	S	S	*	.	H	α-helix	trans	-62.6	-36.9	176.7	-72	167.5	0	0	0	111.4	T53 S54 V55 P61	T53-I57 HydrophobicContact CG2-CD1 3.96Å; T53-I57 VanDerWaalsContact O-CG1 3.29Å; T53-I57 WeakPolarHBondContact O-CG1 3.18Å; T53-I57 PolarHBondContact O-N 3.38Å; S54-I57 PolarHBondContact O-N 2.76Å; V55-I57 PolarHBondContact O-N 3.44Å; I57-P61 WeakPolarHBondContact O-CD 3.25Å; I57-P61 VanDerWaalsContact O-CG 3.27Å; I57-P61 WeakPolarHBondContact O-CG 3.21Å
58	I	92.5	Very high	90.8	Very high	122 Å²	122	91.4 Å²	91.4	63%	0.626	48%	0.481	S	S	*	.	H	α-helix	trans	-82.8	-40.2	178.4	-63.4	167.5	0	0	0	111.2	S54 V55 L56 P61 L62	S54-I58 WeakPolarHBondContact O-CG1 3.31Å; S54-I58 PolarHBondContact O-N 3.32Å; S54-I58 VanDerWaalsContact O-N 3.12Å; V55-I58 PolarHBondContact O-N 2.91Å; L56-I58 VanDerWaalsContact C-N 3.29Å; L56-I58 PolarHBondContact O-N 2.84Å; I58-P61 VanDerWaalsContact O-CD 3.28Å; I58-P61 WeakPolarHBondContact O-CD 3.34Å; I58-P61 VanDerWaalsContact O-CG 3.3Å; I58-P61 WeakPolarHBondContact O-CG 3.46Å; I58-L62 WeakPolarHBondContact O-CB 3.48Å; I58-L62 PolarHBondContact O-N 3.22Å
59	L	92.5	Very high	91.2	Very high	74 Å²	74	91.6 Å²	91.6	39%	0.387	48%	0.483	S	S	.	.	H	α-helix	trans	-70	-37	-176.5	-175.1	64.1	0	0	0	111.4	V55 L56 L62 M63	V55-L59 WeakPolarHBondContact O-CA 3.29Å; V55-L59 WeakPolarHBondContact O-CB 3.35Å; V55-L59 PolarHBondContact O-N 2.75Å; L56-L59 PolarHBondContact O-N 3.46Å; L59-L62 PolarHBondContact O-N 3.29Å; L59-M63 HydrophobicContact CD1-CG 3.94Å; L59-M63 HydrophobicContact CD1-SD 4.44Å; L59-M63 HydrophobicContact CG-CG 3.93Å; L59-M63 VanDerWaalsContact O-CB 3.28Å; L59-M63 WeakPolarHBondContact O-CB 3.3Å; L59-M63 WeakPolarHBondContact O-CG 3.28Å; L59-M63 PolarHBondContact O-N 3.46Å
60	T	92.3	Very high	91.5	Very high	76 Å²	76	86 Å²	86	47%	0.466	47%	0.472	S	S	.	.	H	α-helix	trans	-58.4	-55.5	179.7	-59	0	0	0	0	113	L56 L62 M63 I64	L56-T60 VanDerWaalsContact O-CB 3.23Å; L56-T60 WeakPolarHBondContact O-CB 3.38Å; L56-T60 PolarHBondContact O-N 3.26Å; L56-T60 PolarHBondContact O-OG1 2.93Å; T60-L62 VanDerWaalsContact C-N 3.32Å; T60-L62 PolarHBondContact O-N 2.95Å; T60-M63 PolarHBondContact O-N 3.47Å; T60-I64 HydrophobicContact CG2-CD1 4.14Å; T60-I64 WeakPolarHBondContact O-CG1 3.41Å; T60-I64 PolarHBondContact O-N 2.87Å
61	P	94.2	Very high	91.9	Very high	60 Å²	60	88 Å²	88	39%	0.39	48%	0.477	S	S	.	.	H	α-helix	trans	-65.6	-36.2	177.5	26.1	-33.8	0	0	0	111.7	I57 I58 M63 I64 I65	I57-P61 WeakPolarHBondContact O-CD 3.25Å; I57-P61 VanDerWaalsContact O-CG 3.27Å; I57-P61 WeakPolarHBondContact O-CG 3.21Å; I58-P61 VanDerWaalsContact O-CD 3.28Å; I58-P61 WeakPolarHBondContact O-CD 3.34Å; I58-P61 VanDerWaalsContact O-CG 3.3Å; I58-P61 WeakPolarHBondContact O-CG 3.46Å; P61-M63 PolarHBondContact O-N 3.4Å; P61-I64 PolarHBondContact O-N 2.84Å; P61-I65 WeakPolarHBondContact O-CD1 3.45Å; P61-I65 VanDerWaalsContact O-CG1 3.25Å; P61-I65 WeakPolarHBondContact O-CG1 3.38Å; P61-I65 PolarHBondContact O-N 3.37Å
62	L	94.9	Very high	92.2	Very high	92 Å²	92	91.2 Å²	91.2	48%	0.482	49%	0.49	S	S	.	.	H	α-helix	trans	-60.5	-45.6	175.5	-175.6	63.9	0	0	0	111.4	I58 L59 T60 I64 I65 C66	I58-L62 WeakPolarHBondContact O-CB 3.48Å; I58-L62 PolarHBondContact O-N 3.22Å; L59-L62 PolarHBondContact O-N 3.29Å; T60-L62 VanDerWaalsContact C-N 3.32Å; T60-L62 PolarHBondContact O-N 2.95Å; L62-I64 VanDerWaalsContact C-N 3.34Å; L62-I64 PolarHBondContact O-N 3.47Å; L62-I65 PolarHBondContact O-N 3.33Å; L62-C66 WeakPolarHBondContact O-CB 3.26Å; L62-C66 PolarHBondContact O-N 3.35Å; L62-C66 PolarHBondContact O-SG 2.77Å
63	M	93	Very high	92.2	Very high	117 Å²	117	92.9 Å²	92.9	58%	0.576	50%	0.499	S	S	*	.	H	α-helix	trans	-63.1	-39.1	176.7	-74.4	-68.1	-73.2	0	0	111.8	L59 T60 P61 C66 A67	L59-M63 HydrophobicContact CD1-CG 3.94Å; L59-M63 HydrophobicContact CD1-SD 4.44Å; L59-M63 HydrophobicContact CG-CG 3.93Å; L59-M63 VanDerWaalsContact O-CB 3.28Å; L59-M63 WeakPolarHBondContact O-CB 3.3Å; L59-M63 WeakPolarHBondContact O-CG 3.28Å; L59-M63 PolarHBondContact O-N 3.46Å; T60-M63 PolarHBondContact O-N 3.47Å; P61-M63 PolarHBondContact O-N 3.4Å; M63-C66 PolarHBondContact O-N 3.38Å; M63-A67 WeakPolarHBondContact O-CB 3.42Å; M63-A67 PolarHBondContact O-N 2.86Å
64	I	94.9	Very high	92.3	Very high	111 Å²	111	92.6 Å²	92.6	57%	0.569	50%	0.502	S	S	*	.	H	α-helix	trans	-63.8	-44.9	175.2	-67.5	166.3	0	0	0	110.7	T60 P61 L62 A67 Y68	T60-I64 HydrophobicContact CG2-CD1 4.14Å; T60-I64 WeakPolarHBondContact O-CG1 3.41Å; T60-I64 PolarHBondContact O-N 2.87Å; P61-I64 PolarHBondContact O-N 2.84Å; L62-I64 VanDerWaalsContact C-N 3.34Å; L62-I64 PolarHBondContact O-N 3.47Å; I64-A67 PolarHBondContact O-N 2.89Å; I64-Y68 WeakPolarHBondContact O-CB 3.41Å; I64-Y68 PolarHBondContact O-N 3.11Å
65	I	95.2	Very high	92.3	Very high	111 Å²	111	96.4 Å²	96.4	57%	0.569	51%	0.512	S	S	*	.	H	α-helix	trans	-64.5	-45.1	177.8	-66.2	162.2	0	0	0	110.5	P61 L62 A67 Y68 C69	P61-I65 WeakPolarHBondContact O-CD1 3.45Å; P61-I65 VanDerWaalsContact O-CG1 3.25Å; P61-I65 WeakPolarHBondContact O-CG1 3.38Å; P61-I65 PolarHBondContact O-N 3.37Å; L62-I65 PolarHBondContact O-N 3.33Å; I65-A67 PolarHBondContact O-N 3.3Å; I65-Y68 PolarHBondContact O-N 2.68Å; I65-C69 WeakPolarHBondContact O-CB 3.39Å; I65-C69 PolarHBondContact O-N 2.76Å
66	C	94.3	Very high	92.2	Very high	63 Å²	63	97.7 Å²	97.7	43%	0.426	51%	0.514	S	S	.	.	H	α-helix	trans	-60.9	-43.7	175.5	-74.8	0	0	0	0	111.9	L62 M63 C69 S70	L62-C66 WeakPolarHBondContact O-CB 3.26Å; L62-C66 PolarHBondContact O-N 3.35Å; L62-C66 PolarHBondContact O-SG 2.77Å; M63-C66 PolarHBondContact O-N 3.38Å; C66-C69 PolarHBondContact O-N 2.88Å; C66-S70 VanDerWaalsContact O-CB 3.28Å; C66-S70 WeakPolarHBondContact O-CB 3.32Å; C66-S70 PolarHBondContact O-N 3.47Å; C66-S70 PolarHBondContact O-OG 3.43Å
67	A	93.5	Very high	92	Very high	60 Å²	60	97.6 Å²	97.6	50%	0.496	51%	0.514	S	S	.	.	H	α-helix	trans	-64.8	-41.1	176.3	0	0	0	0	0	111.5	M63 I64 I65 S70 Y71	M63-A67 WeakPolarHBondContact O-CB 3.42Å; M63-A67 PolarHBondContact O-N 2.86Å; I64-A67 PolarHBondContact O-N 2.89Å; I65-A67 PolarHBondContact O-N 3.3Å; A67-S70 PolarHBondContact O-N 2.92Å; A67-Y71 VanDerWaalsContact O-CB 3.31Å; A67-Y71 WeakPolarHBondContact O-CB 3.28Å; A67-Y71 PolarHBondContact O-N 3.44Å
68	Y	94.4	Very high	91.6	Very high	143 Å²	143	99.4 Å²	99.4	56%	0.561	52%	0.517	S	S	*	.	H	α-helix	trans	-63	-46	175.8	-179.4	-96.8	0	0	0	111.9	I64 I65 Y71 K72	I64-Y68 WeakPolarHBondContact O-CB 3.41Å; I64-Y68 PolarHBondContact O-N 3.11Å; I65-Y68 PolarHBondContact O-N 2.68Å; Y68-Y71 PolarHBondContact O-N 2.87Å; Y68-K72 HydrophobicContact CE1-CG 4.07Å; Y68-K72 PolarHBondContact O-N 2.78Å; Y68-K72 VanDerWaalsContact OH-CE 3.29Å; Y68-K72 WeakPolarHBondContact OH-CE 3.28Å
69	C	91.6	Very high	91.1	Very high	80 Å²	80	102 Å²	102	54%	0.541	52%	0.519	S	S	.	.	H	α-helix	trans	-60.8	-46	175.6	-170.8	0	0	0	0	110.9	I65 C66 Y71 K72 L73	I65-C69 WeakPolarHBondContact O-CB 3.39Å; I65-C69 PolarHBondContact O-N 2.76Å; C66-C69 PolarHBondContact O-N 2.88Å; C69-Y71 VanDerWaalsContact C-N 3.34Å; C69-Y71 PolarHBondContact O-N 3.35Å; C69-K72 PolarHBondContact O-N 3.31Å; C69-L73 WeakPolarHBondContact O-CB 2.87Å; C69-L73 PolarHBondContact O-N 3.33Å
70	S	91.8	Very high	90.6	Very high	72 Å²	72	102.8 Å²	102.8	50%	0.503	52%	0.521	S	S	.	.	H	α-helix	trans	-62.9	-38.7	176.8	-58.8	0	0	0	0	112	C66 A67 L73 A74	C66-S70 VanDerWaalsContact O-CB 3.28Å; C66-S70 WeakPolarHBondContact O-CB 3.32Å; C66-S70 PolarHBondContact O-N 3.47Å; C66-S70 PolarHBondContact O-OG 3.43Å; A67-S70 PolarHBondContact O-N 2.92Å; S70-L73 PolarHBondContact O-N 3.44Å; S70-A74 WeakPolarHBondContact O-CB 3.15Å; S70-A74 PolarHBondContact O-N 2.8Å
71	Y	92.9	Very high	89.9	Confident	152 Å²	152	103.2 Å²	103.2	60%	0.596	52%	0.518	S	S	*	.	H	α-helix	trans	-66.4	-44.1	176.3	176	-99	0	0	0	112	A67 Y68 C69 A74 K75	A67-Y71 VanDerWaalsContact O-CB 3.31Å; A67-Y71 WeakPolarHBondContact O-CB 3.28Å; A67-Y71 PolarHBondContact O-N 3.44Å; Y68-Y71 PolarHBondContact O-N 2.87Å; C69-Y71 VanDerWaalsContact C-N 3.34Å; C69-Y71 PolarHBondContact O-N 3.35Å; Y71-A74 PolarHBondContact O-N 3.02Å; Y71-K75 HydrophobicContact CE1-CD 4.49Å; Y71-K75 VanDerWaalsContact O-CB 3.3Å; Y71-K75 WeakPolarHBondContact O-CB 3.27Å; Y71-K75 PolarHBondContact O-N 3.13Å
72	K	90.8	Very high	89.1	Confident	121 Å²	121	103.3 Å²	103.3	53%	0.526	52%	0.524	S	S	.	.	H	α-helix	trans	-60.1	-46.1	174	-87.4	-89.9	-169.1	161.9	0	111.3	Y68 C69 K75 E76	Y68-K72 HydrophobicContact CE1-CG 4.07Å; Y68-K72 PolarHBondContact O-N 2.78Å; Y68-K72 VanDerWaalsContact OH-CE 3.29Å; Y68-K72 WeakPolarHBondContact OH-CE 3.28Å; C69-K72 PolarHBondContact O-N 3.31Å; K72-K75 PolarHBondContact O-N 3.48Å; K72-E76 PolarHBondContact O-N 3.25Å
73	L	88.1	Confident	88.3	Confident	126 Å²	126	102.3 Å²	102.3	66%	0.66	52%	0.519	S	S	*	.	H	α-helix	trans	-63	-46.3	177.2	-174.8	63.4	0	0	0	111.5	C69 S70 K75 E76 L77	C69-L73 WeakPolarHBondContact O-CB 2.87Å; C69-L73 PolarHBondContact O-N 3.33Å; S70-L73 PolarHBondContact O-N 3.44Å; L73-K75 VanDerWaalsContact C-N 3.3Å; L73-K75 PolarHBondContact O-N 3.26Å; L73-E76 PolarHBondContact O-N 3.29Å; L73-L77 WeakPolarHBondContact O-CB 3.43Å; L73-L77 PolarHBondContact O-N 2.89Å
74	A	90.1	Very high	87.6	Confident	44 Å²	44	102.7 Å²	102.7	36%	0.364	52%	0.519	S	S	.	.	H	α-helix	trans	-63.5	-35.3	177.1	0	0	0	0	0	112.4	S70 Y71 K78	S70-A74 WeakPolarHBondContact O-CB 3.15Å; S70-A74 PolarHBondContact O-N 2.8Å; Y71-A74 PolarHBondContact O-N 3.02Å; A74-K78 WeakPolarHBondContact O-CB 3.3Å; A74-K78 WeakPolarHBondContact O-CG 3.35Å; A74-K78 PolarHBondContact O-N 2.77Å
75	K	87.6	Confident	86.8	Confident	130 Å²	130	103.3 Å²	103.3	57%	0.565	52%	0.518	S	S	*	.	H	α-helix	trans	-66.7	-43.1	175.7	-174.6	174.7	-178.1	175.2	0	111.4	Y71 K72 L73 K78 R79	Y71-K75 HydrophobicContact CE1-CD 4.49Å; Y71-K75 VanDerWaalsContact O-CB 3.3Å; Y71-K75 WeakPolarHBondContact O-CB 3.27Å; Y71-K75 PolarHBondContact O-N 3.13Å; K72-K75 PolarHBondContact O-N 3.48Å; L73-K75 VanDerWaalsContact C-N 3.3Å; L73-K75 PolarHBondContact O-N 3.26Å; K75-K78 PolarHBondContact O-N 3.47Å; K75-R79 PolarHBondContact O-N 2.97Å; K75-R79 VanDerWaalsContact O-N 3.1Å
76	E	87.6	Confident	85.8	Confident	82 Å²	82	102.7 Å²	102.7	38%	0.383	51%	0.514	S	S	.	.	H	α-helix	trans	-67.7	-40.7	176.7	-172.5	54.2	-147.4	0	0	111.2	K72 L73 K78 R79 Q80	K72-E76 PolarHBondContact O-N 3.25Å; L73-E76 PolarHBondContact O-N 3.29Å; E76-K78 PolarHBondContact O-N 3.35Å; E76-R79 WeakPolarHBondContact O-CB 3.33Å; E76-R79 PolarHBondContact O-N 3.09Å; E76-R79 VanDerWaalsContact O-N 3.14Å; E76-Q80 WeakPolarHBondContact O-CG 3.44Å; E76-Q80 PolarHBondContact O-N 3.02Å; E76-Q80 PolarHBondContact OE1-NE2 3.37Å
77	L	86.9	Confident	85.2	Confident	97 Å²	97	105.4 Å²	105.4	51%	0.508	52%	0.518	S	S	.	.	H	α-helix	trans	-60.1	-43.7	174.3	-169.8	66	0	0	0	111.7	L73 R79 Q80 E81	L73-L77 WeakPolarHBondContact O-CB 3.43Å; L73-L77 PolarHBondContact O-N 2.89Å; L77-R79 VanDerWaalsContact C-N 3.32Å; L77-R79 PolarHBondContact O-N 3.34Å; L77-Q80 PolarHBondContact O-N 2.98Å; L77-E81 WeakPolarHBondContact O-CB 3.38Å; L77-E81 WeakPolarHBondContact O-CG 3.47Å; L77-E81 PolarHBondContact O-N 3.19Å
78	K	84.8	Confident	84.4	Confident	154 Å²	154	105.4 Å²	105.4	67%	0.67	52%	0.518	S	S	*	.	H	α-helix	trans	-60.9	-38.6	174.6	-78.8	177.7	-179.1	173.9	0	112.8	A74 K75 E76 A82	A74-K78 WeakPolarHBondContact O-CB 3.3Å; A74-K78 WeakPolarHBondContact O-CG 3.35Å; A74-K78 PolarHBondContact O-N 2.77Å; K75-K78 PolarHBondContact O-N 3.47Å; E76-K78 PolarHBondContact O-N 3.35Å; K78-A82 WeakPolarHBondContact O-CB 3.34Å; K78-A82 PolarHBondContact O-N 3.4Å
79	R	82.2	Confident	83.7	Confident	177 Å²	177	108 Å²	108	67%	0.668	53%	0.526	S	S	*	.	H	α-helix	trans	-65.9	-45.1	176.4	-172.9	-176.3	-178	-170.8	0.9	110.9	K75 E76 L77 A82 D83	K75-R79 PolarHBondContact O-N 2.97Å; K75-R79 VanDerWaalsContact O-N 3.1Å; E76-R79 WeakPolarHBondContact O-CB 3.33Å; E76-R79 PolarHBondContact O-N 3.09Å; E76-R79 VanDerWaalsContact O-N 3.14Å; L77-R79 VanDerWaalsContact C-N 3.32Å; L77-R79 PolarHBondContact O-N 3.34Å; R79-A82 PolarHBondContact O-N 2.86Å; R79-D83 PolarHBondContact O-N 3.28Å
80	Q	81.9	Confident	83	Confident	91 Å²	91	111.6 Å²	111.6	43%	0.425	53%	0.529	S	S	.	.	H	α-helix	trans	-64.7	-40.8	176.9	-69.2	-177.5	24.5	0	0	111.6	E76 L77 A82 D83 Q84	E76-Q80 WeakPolarHBondContact O-CG 3.44Å; E76-Q80 PolarHBondContact O-N 3.02Å; E76-Q80 PolarHBondContact OE1-NE2 3.37Å; L77-Q80 PolarHBondContact O-N 2.98Å; Q80-A82 PolarHBondContact O-N 2.99Å; Q80-D83 PolarHBondContact O-N 3Å; Q80-Q84 VanDerWaalsContact O-CB 3.25Å; Q80-Q84 WeakPolarHBondContact O-CB 3.49Å; Q80-Q84 VanDerWaalsContact O-CG 3.25Å; Q80-Q84 WeakPolarHBondContact O-CG 3.28Å; Q80-Q84 PolarHBondContact O-N 2.86Å
81	E	77.6	Confident	82.5	Confident	85 Å²	85	112.7 Å²	112.7	40%	0.397	53%	0.533	S	S	.	.	H	α-helix	trans	-62.6	-40.7	174.3	-79.7	-168.8	-163.8	0	0	112.7	L77 K85	L77-E81 WeakPolarHBondContact O-CB 3.38Å; L77-E81 WeakPolarHBondContact O-CG 3.47Å; L77-E81 PolarHBondContact O-N 3.19Å; E81-K85 VanDerWaalsContact O-CB 3.22Å; E81-K85 WeakPolarHBondContact O-CB 3.14Å; E81-K85 WeakPolarHBondContact O-CD 3.23Å; E81-K85 WeakPolarHBondContact O-CG 3.47Å; E81-K85 PolarHBondContact O-N 3.48Å; E81-K85 IonicContact OE2-NZ 3.19Å; E81-K85 PolarHBondContact OE2-NZ 3.47Å
82	A	77.2	Confident	81.9	Confident	62 Å²	62	107.8 Å²	107.8	51%	0.512	52%	0.524	S	S	.	.	H	α-helix	trans	-65.1	-44.2	177.4	0	0	0	0	0	111.5	K78 R79 Q80 K85 M86	K78-A82 WeakPolarHBondContact O-CB 3.34Å; K78-A82 PolarHBondContact O-N 3.4Å; R79-A82 PolarHBondContact O-N 2.86Å; Q80-A82 PolarHBondContact O-N 2.99Å; A82-K85 PolarHBondContact O-N 2.73Å; A82-M86 WeakPolarHBondContact O-CB 3.01Å; A82-M86 PolarHBondContact O-N 3.12Å
83	D	78.5	Confident	81.3	Confident	70 Å²	70	104.8 Å²	104.8	37%	0.374	52%	0.521	S	S	.	.	H	α-helix	trans	-67	-42.4	177.2	-170.5	66.3	0	0	0	111.8	R79 Q80 M86 K87	R79-D83 PolarHBondContact O-N 3.28Å; Q80-D83 PolarHBondContact O-N 3Å; D83-M86 PolarHBondContact O-N 3.42Å; D83-K87 WeakPolarHBondContact O-CB 3.46Å; D83-K87 WeakPolarHBondContact O-CG 3.39Å; D83-K87 PolarHBondContact O-N 3.33Å; D83-K87 WeakPolarHBondContact OD2-CD 3.35Å; D83-K87 WeakPolarHBondContact OD2-CE 3.41Å; D83-K87 IonicContact OD2-NZ 2.67Å; D83-K87 PolarHBondContact OD2-NZ 3.23Å
84	Q	78	Confident	80.9	Confident	125 Å²	125	103.2 Å²	103.2	58%	0.584	51%	0.512	S	S	*	.	H	α-helix	trans	-64.4	-41.9	174.4	-75.7	-172.2	18.4	0	0	112	Q80 M86 K87 A88	Q80-Q84 VanDerWaalsContact O-CB 3.25Å; Q80-Q84 WeakPolarHBondContact O-CB 3.49Å; Q80-Q84 VanDerWaalsContact O-CG 3.25Å; Q80-Q84 WeakPolarHBondContact O-CG 3.28Å; Q80-Q84 PolarHBondContact O-N 2.86Å; Q84-M86 VanDerWaalsContact C-N 3.31Å; Q84-M86 PolarHBondContact O-N 2.83Å; Q84-K87 PolarHBondContact O-N 3.29Å; Q84-A88 WeakPolarHBondContact O-CB 3.23Å; Q84-A88 PolarHBondContact O-N 2.95Å
85	K	77.2	Confident	80.4	Confident	125 Å²	125	105.1 Å²	105.1	54%	0.543	52%	0.517	S	S	.	.	H	α-helix	trans	-62.2	-39.7	174.6	-77.1	168	-176.5	162.9	0	111	E81 A82 R89	E81-K85 VanDerWaalsContact O-CB 3.22Å; E81-K85 WeakPolarHBondContact O-CB 3.14Å; E81-K85 WeakPolarHBondContact O-CD 3.23Å; E81-K85 WeakPolarHBondContact O-CG 3.47Å; E81-K85 PolarHBondContact O-N 3.48Å; E81-K85 IonicContact OE2-NZ 3.19Å; E81-K85 PolarHBondContact OE2-NZ 3.47Å; A82-K85 PolarHBondContact O-N 2.73Å; K85-R89 WeakPolarHBondContact O-CB 3.43Å; K85-R89 VanDerWaalsContact O-CG 3.25Å; K85-R89 WeakPolarHBondContact O-CG 3.32Å; K85-R89 PolarHBondContact O-N 3.38Å
86	M	76	Confident	79.9	Confident	98 Å²	98	106.1 Å²	106.1	48%	0.483	52%	0.521	S	S	.	.	H	α-helix	trans	-67	-45.4	176.1	-165.9	-173.1	-167.5	0	0	111.8	A82 D83 Q84 R89 R90	A82-M86 WeakPolarHBondContact O-CB 3.01Å; A82-M86 PolarHBondContact O-N 3.12Å; D83-M86 PolarHBondContact O-N 3.42Å; Q84-M86 VanDerWaalsContact C-N 3.31Å; Q84-M86 PolarHBondContact O-N 2.83Å; M86-R89 PolarHBondContact O-N 3.34Å; M86-R90 VanDerWaalsContact CE-NH2 3.26Å; M86-R90 WeakPolarHBondContact O-CG 3.39Å; M86-R90 PolarHBondContact O-N 2.82Å
87	K	80.1	Confident	79.3	Confident	120 Å²	120	105 Å²	105	52%	0.522	52%	0.522	S	S	.	.	H	α-helix	trans	-62.9	-45.5	175.8	-75.4	172.7	174.4	165.8	0	111.7	D83 Q84 R89 R90 T91	D83-K87 WeakPolarHBondContact O-CB 3.46Å; D83-K87 WeakPolarHBondContact O-CG 3.39Å; D83-K87 PolarHBondContact O-N 3.33Å; D83-K87 WeakPolarHBondContact OD2-CD 3.35Å; D83-K87 WeakPolarHBondContact OD2-CE 3.41Å; D83-K87 IonicContact OD2-NZ 2.67Å; D83-K87 PolarHBondContact OD2-NZ 3.23Å; Q84-K87 PolarHBondContact O-N 3.29Å; K87-R89 VanDerWaalsContact C-N 3.35Å; K87-R89 PolarHBondContact O-N 2.65Å; K87-R90 PolarHBondContact O-N 2.89Å; K87-T91 PolarHBondContact O-N 2.92Å; K87-T91 PolarHBondContact O-OG1 2.96Å; K87-T91 VanDerWaalsContact O-OG1 3.05Å
88	A	78.1	Confident	78.6	Confident	59 Å²	59	106.9 Å²	106.9	49%	0.488	53%	0.526	S	S	.	.	H	α-helix	trans	-61	-41.6	177.2	0	0	0	0	0	111.9	Q84 T91 A92	Q84-A88 WeakPolarHBondContact O-CB 3.23Å; Q84-A88 PolarHBondContact O-N 2.95Å; A88-T91 PolarHBondContact O-N 3.44Å; A88-A92 WeakPolarHBondContact O-CB 3.18Å; A88-A92 PolarHBondContact O-N 3.49Å
89	R	78.5	Confident	77.9	Confident	197 Å²	197	106 Å²	106	74%	0.743	52%	0.523	S	S	*	.	H	α-helix	trans	-62.7	-43.1	174.2	-76.1	176.6	177.4	-164.4	-0.4	112.2	K85 M86 K87 A92 A93	K85-R89 WeakPolarHBondContact O-CB 3.43Å; K85-R89 VanDerWaalsContact O-CG 3.25Å; K85-R89 WeakPolarHBondContact O-CG 3.32Å; K85-R89 PolarHBondContact O-N 3.38Å; M86-R89 PolarHBondContact O-N 3.34Å; K87-R89 VanDerWaalsContact C-N 3.35Å; K87-R89 PolarHBondContact O-N 2.65Å; R89-A92 PolarHBondContact O-N 3.45Å; R89-A93 WeakPolarHBondContact O-CB 3.35Å; R89-A93 PolarHBondContact O-N 3.49Å
90	R	77.5	Confident	77.1	Confident	157 Å²	157	104.3 Å²	104.3	59%	0.592	52%	0.522	S	S	*	.	H	α-helix	trans	-62.6	-48.4	175.8	-73.5	177.1	174.6	-174	-2.1	111.6	M86 K87 A92 A93 I94	M86-R90 VanDerWaalsContact CE-NH2 3.26Å; M86-R90 WeakPolarHBondContact O-CG 3.39Å; M86-R90 PolarHBondContact O-N 2.82Å; K87-R90 PolarHBondContact O-N 2.89Å; R90-A92 PolarHBondContact O-N 2.86Å; R90-A93 PolarHBondContact O-N 3.25Å; R90-I94 VanDerWaalsContact O-CG1 3.3Å; R90-I94 WeakPolarHBondContact O-CG1 3.23Å; R90-I94 PolarHBondContact O-N 2.88Å
91	T	81.1	Confident	76.2	Confident	95 Å²	95	105.4 Å²	105.4	58%	0.583	54%	0.535	S	S	*	.	H	α-helix	trans	-64.9	-39.1	178.6	-52.7	0	0	0	0	111.7	K87 A88 I94 N95	K87-T91 PolarHBondContact O-N 2.92Å; K87-T91 PolarHBondContact O-OG1 2.96Å; K87-T91 VanDerWaalsContact O-OG1 3.05Å; A88-T91 PolarHBondContact O-N 3.44Å; T91-I94 PolarHBondContact O-N 2.86Å; T91-N95 VanDerWaalsContact O-CB 3.28Å; T91-N95 WeakPolarHBondContact O-CB 3.34Å; T91-N95 PolarHBondContact O-N 3Å
92	A	79.5	Confident	75.5	Confident	49 Å²	49	110.2 Å²	110.2	41%	0.405	56%	0.555	S	S	.	*	H	α-helix	trans	-64.7	-40.2	175.7	0	0	0	0	0	112.2	A88 R89 R90 N95 K96	A88-A92 WeakPolarHBondContact O-CB 3.18Å; A88-A92 PolarHBondContact O-N 3.49Å; R89-A92 PolarHBondContact O-N 3.45Å; R90-A92 PolarHBondContact O-N 2.86Å; A92-N95 PolarHBondContact O-N 2.86Å; A92-K96 VanDerWaalsContact O-CG 3.31Å; A92-K96 WeakPolarHBondContact O-CG 3.29Å; A92-K96 PolarHBondContact O-N 3.23Å
93	A	79.8	Confident	74.9	Confident	58 Å²	58	113.4 Å²	113.4	48%	0.479	57%	0.567	S	S	.	*	H	α-helix	trans	-65.2	-45.1	175.6	0	0	0	0	0	111.9	R89 R90 N95 K96 S97	R89-A93 WeakPolarHBondContact O-CB 3.35Å; R89-A93 PolarHBondContact O-N 3.49Å; R90-A93 PolarHBondContact O-N 3.25Å; A93-N95 VanDerWaalsContact C-N 3.34Å; A93-N95 PolarHBondContact O-N 3.41Å; A93-K96 PolarHBondContact O-N 3.31Å; A93-S97 PolarHBondContact O-N 3.27Å
94	I	78.7	Confident	73.7	Confident	92 Å²	92	119.8 Å²	119.8	47%	0.472	60%	0.601	S	S	.	*	H	α-helix	trans	-64.5	-38.7	176.9	-65.3	164.8	0	0	0	111.2	R90 T91 K96 S97 K98	R90-I94 VanDerWaalsContact O-CG1 3.3Å; R90-I94 WeakPolarHBondContact O-CG1 3.23Å; R90-I94 PolarHBondContact O-N 2.88Å; T91-I94 PolarHBondContact O-N 2.86Å; I94-K96 VanDerWaalsContact C-N 3.34Å; I94-S97 PolarHBondContact O-N 3.49Å; I94-S97 PolarHBondContact O-OG 3.38Å; I94-K98 HydrophobicContact CG2-CD 4.03Å; I94-K98 HydrophobicContact CG2-CG 4.42Å; I94-K98 WeakPolarHBondContact O-CB 3.32Å; I94-K98 WeakPolarHBondContact O-CG 3.38Å; I94-K98 PolarHBondContact O-N 2.89Å
95	N	78.7	Confident	73.5	Confident	85 Å²	85	119.5 Å²	119.5	46%	0.455	60%	0.602	S	S	.	*	H	α-helix	trans	-69.5	-34.7	178	-162.3	24.5	0	0	0	111.6	T91 A92 A93 K99	T91-N95 VanDerWaalsContact O-CB 3.28Å; T91-N95 WeakPolarHBondContact O-CB 3.34Å; T91-N95 PolarHBondContact O-N 3Å; A92-N95 PolarHBondContact O-N 2.86Å; A93-N95 VanDerWaalsContact C-N 3.34Å; A93-N95 PolarHBondContact O-N 3.41Å; N95-K99 VanDerWaalsContact O-CG 3.3Å; N95-K99 WeakPolarHBondContact O-CG 3.45Å; N95-K99 PolarHBondContact O-N 3.39Å; N95-K99 VanDerWaalsContact O-N 3.08Å
96	K	78.4	Confident	73.3	Confident	150 Å²	150	119.2 Å²	119.2	65%	0.652	61%	0.605	S	S	*	*	H	α-helix	trans	-64.7	-45.3	172.7	-75.9	179.4	-179.6	-168.7	0	111.6	A92 A93 I94 K99 Q100	A92-K96 VanDerWaalsContact O-CG 3.31Å; A92-K96 WeakPolarHBondContact O-CG 3.29Å; A92-K96 PolarHBondContact O-N 3.23Å; A93-K96 PolarHBondContact O-N 3.31Å; I94-K96 VanDerWaalsContact C-N 3.34Å; K96-K99 PolarHBondContact O-N 3.44Å; K96-Q100 PolarHBondContact O-N 3.19Å; K96-Q100 VanDerWaalsContact O-N 3.11Å
97	S	73.7	Confident	73.1	Confident	59 Å²	59	120.4 Å²	120.4	41%	0.413	61%	0.612	S	S	.	*	H	α-helix	trans	-66.6	-39.6	178.2	65.1	0	0	0	0	112.5	A93 I94 K99 Q100 V101	A93-S97 PolarHBondContact O-N 3.27Å; I94-S97 PolarHBondContact O-N 3.49Å; I94-S97 PolarHBondContact O-OG 3.38Å; S97-K99 VanDerWaalsContact C-N 3.29Å; S97-K99 PolarHBondContact O-N 3.2Å; S97-Q100 PolarHBondContact O-N 3.14Å; S97-V101 WeakPolarHBondContact O-CG2 3.38Å; S97-V101 PolarHBondContact O-N 3.4Å; S97-V101 VanDerWaalsContact O-N 3.11Å
98	K	74.1	Confident	72.7	Confident	136 Å²	136	120.4 Å²	120.4	59%	0.591	62%	0.617	S	S	*	*	H	α-helix	trans	-64	-31.3	174.3	-75.7	176.7	179.2	-79.5	0	113.5	I94	I94-K98 HydrophobicContact CG2-CD 4.03Å; I94-K98 HydrophobicContact CG2-CG 4.42Å; I94-K98 WeakPolarHBondContact O-CB 3.32Å; I94-K98 WeakPolarHBondContact O-CG 3.38Å; I94-K98 PolarHBondContact O-N 2.89Å
99	K	70.2	Confident	72.4	Confident	137 Å²	137	124.3 Å²	124.3	60%	0.596	63%	0.625	S	S	*	*	H	α-helix	trans	-72.9	-38.4	175.1	-76.6	-178.8	-179.8	-164.7	0	111.9	N95 K96 S97 K102 V103	N95-K99 VanDerWaalsContact O-CG 3.3Å; N95-K99 WeakPolarHBondContact O-CG 3.45Å; N95-K99 PolarHBondContact O-N 3.39Å; N95-K99 VanDerWaalsContact O-N 3.08Å; K96-K99 PolarHBondContact O-N 3.44Å; S97-K99 VanDerWaalsContact C-N 3.29Å; S97-K99 PolarHBondContact O-N 3.2Å; K99-K102 PolarHBondContact O-N 3.47Å; K99-V103 WeakPolarHBondContact O-CG2 3.48Å
100	Q	64.2	Low	71.9	Confident	141 Å²	141	119.4 Å²	119.4	66%	0.659	62%	0.618	S	S	*	*	H	α-helix	trans	-66.4	-40.7	177.1	-72.4	-179.3	-27.7	0	0	112	K96 S97 K102 V103	K96-Q100 PolarHBondContact O-N 3.19Å; K96-Q100 VanDerWaalsContact O-N 3.11Å; S97-Q100 PolarHBondContact O-N 3.14Å; Q100-K102 PolarHBondContact O-N 3.27Å; Q100-K102 VanDerWaalsContact O-N 3.12Å; Q100-V103 PolarHBondContact O-N 2.89Å; Q100-V103 VanDerWaalsContact O-N 3.11Å
101	V	63.4	Low	71.6	Confident	114 Å²	114	116.7 Å²	116.7	69%	0.691	62%	0.619	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.8	-14.5	177.8	175.5	0	0	0	0	113.9	S97	S97-V101 WeakPolarHBondContact O-CG2 3.38Å; S97-V101 PolarHBondContact O-N 3.4Å; S97-V101 VanDerWaalsContact O-N 3.11Å
102	K	63.1	Low	70.8	Confident	186 Å²	186	118.4 Å²	118.4	81%	0.809	62%	0.622	S	S	*	*	T	Hydrogen-bonded Turn	trans	-97.3	-5.4	176.2	-75	-171.5	175.6	-167.2	0	113.9	K99 Q100	K99-K102 PolarHBondContact O-N 3.47Å; Q100-K102 PolarHBondContact O-N 3.27Å; Q100-K102 VanDerWaalsContact O-N 3.12Å
103	V	65.2	Low	70.1	Confident	128 Å²	128	124.2 Å²	124.2	78%	0.776	64%	0.64	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.1	-16.1	-176.3	175.9	0	0	0	0	111.9	K99 Q100	K99-V103 WeakPolarHBondContact O-CG2 3.48Å; Q100-V103 PolarHBondContact O-N 2.89Å; Q100-V103 VanDerWaalsContact O-N 3.11Å
104	D	51.7	Low	69.2	Low	204 Å²	204	130.2 Å²	130.2	100%	1.091	66%	0.655	S	S	*	*			trans	-89.6	0	161.1	-78.6	-77.3	0	0	0	110.8

Retrieved 104 of 104 residues in 212.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).