G4VB92_SCHMA Loading...

DUF1330 domain-containing protein

AlphaFold DB , UniProt , Accession G4VB92, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 51 aa.

						>G4VB92_SCHMA|G4VB92
MTWMHFVVRGSKVDREKTESAVQANTYPYYETVMLTFIGEISSDLSHNFFA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.5	Very low	52.8	Low	224 Å²	224	149.8 Å²	149.8	100%	1.103	76%	0.764	S	S	*	*				0	98.6	0	-164.4	106.7	174	0	0	107.3	W3	M1-W3 PolarHBondContact O-N 2.72Å
2	T	51.7	Low	53.5	Low	120 Å²	120	153.5 Å²	153.5	74%	0.736	77%	0.771	S	S	*	*			trans	-58.2	129.4	178.9	-48.3	0	0	0	0	108.3	M4	T2-M4 PolarHBondContact O-N 3.13Å; T2-M4 VanDerWaalsContact O-N 3.08Å
3	W	41	Very low	54.3	Low	231 Å²	231	147.1 Å²	147.1	88%	0.875	74%	0.744	S	S	*	*			trans	-54	120.5	-176.6	-62.1	16.5	0	0	0	106.3	M1 H5	M1-W3 PolarHBondContact O-N 2.72Å; W3-H5 VanDerWaalsContact C-N 3.32Å; W3-H5 PolarHBondContact O-CD2 2.98Å; W3-H5 PolarHBondContact O-N 3.34Å
4	M	52.3	Low	55.3	Low	166 Å²	166	142.7 Å²	142.7	82%	0.818	72%	0.724	S	S	*	*			trans	-53.7	104.9	176.7	-93.5	178.4	174.6	0	0	106.9	T2 F6	T2-M4 PolarHBondContact O-N 3.13Å; T2-M4 VanDerWaalsContact O-N 3.08Å; M4-F6 PolarHBondContact O-N 2.74Å
5	H	57.6	Low	56.1	Low	154 Å²	154	145.3 Å²	145.3	71%	0.713	72%	0.721	S	S	*	*			trans	-65.2	94.8	170.9	-71.6	-111.3	0	0	0	104.8	W3 V7	W3-H5 VanDerWaalsContact C-N 3.32Å; W3-H5 PolarHBondContact O-CD2 2.98Å; W3-H5 PolarHBondContact O-N 3.34Å; H5-V7 HydrophobicContact CB-CG2 4.33Å; H5-V7 PolarHBondContact O-N 2.74Å
6	F	54.5	Low	56.9	Low	154 Å²	154	146.4 Å²	146.4	68%	0.675	72%	0.723	S	S	*	*			trans	-68.4	70.1	164.4	-109.7	-88.3	0	0	0	107.9	M4 V8	M4-F6 PolarHBondContact O-N 2.74Å; F6-V8 HydrophobicContact CD1-CB 4.36Å; F6-V8 HydrophobicContact CD1-CG2 3.64Å; F6-V8 HydrophobicContact CE1-CG2 3.89Å; F6-V8 PolarHBondContact O-N 2.84Å
7	V	50.9	Low	57.8	Low	124 Å²	124	146.2 Å²	146.2	75%	0.752	72%	0.718	S	S	*	*			trans	-87.9	74.7	158.4	-179.2	0	0	0	0	105.7	H5	H5-V7 HydrophobicContact CB-CG2 4.33Å; H5-V7 PolarHBondContact O-N 2.74Å
8	V	57.5	Low	58.7	Low	76 Å²	76	141.2 Å²	141.2	46%	0.461	70%	0.697	S	S	.	*			trans	-93.5	96.1	164.8	174.1	0	0	0	0	106.8	F6 G10 V13	F6-V8 HydrophobicContact CD1-CB 4.36Å; F6-V8 HydrophobicContact CD1-CG2 3.64Å; F6-V8 HydrophobicContact CE1-CG2 3.89Å; F6-V8 PolarHBondContact O-N 2.84Å; V8-G10 PolarHBondContact O-N 2.76Å; V8-G10 VanDerWaalsContact O-N 3.13Å; V8-V13 HydrophobicContact CG1-CG2 4.5Å
9	R	58.6	Low	59.7	Low	244 Å²	244	138.2 Å²	138.2	92%	0.921	68%	0.681	S	S	*	*			trans	-60	103.9	175.2	-178.3	175.1	176.6	179.8	-1.4	109.9
10	G	53.6	Low	60.3	Low	80 Å²	80	135.1 Å²	135.1	83%	0.825	67%	0.673	S	S	*	*	S	Bend	trans	106.9	-15	150.1	0	0	0	0	0	119.6	V8	V8-G10 PolarHBondContact O-N 2.76Å; V8-G10 VanDerWaalsContact O-N 3.13Å
11	S	61.1	Low	61.1	Low	75 Å²	75	131 Å²	131	52%	0.524	66%	0.66	S	S	.	*	S	Bend	trans	-97.6	120.2	169.8	44.6	0	0	0	0	108.1	V13	S11-V13 PolarHBondContact O-N 3.03Å
12	K	60.7	Low	62.7	Low	194 Å²	194	124.5 Å²	124.5	84%	0.843	63%	0.633	S	S	*	*			trans	-52.6	97.1	166.1	-66.8	175.4	179.9	178.9	0	106.3	D14	K12-D14 PolarHBondContact O-N 2.97Å
13	V	64.2	Low	63.7	Low	70 Å²	70	123.9 Å²	123.9	42%	0.424	62%	0.622	S	S	.	*			trans	-66.2	107	172.3	173.9	0	0	0	0	103.1	V8 S11 R15 T18	V8-V13 HydrophobicContact CG1-CG2 4.5Å; S11-V13 PolarHBondContact O-N 3.03Å; V13-R15 VanDerWaalsContact C-N 3.26Å; V13-R15 PolarHBondContact O-N 2.74Å; V13-T18 HydrophobicContact CG1-CG2 3.99Å; V13-T18 WeakPolarHBondContact CG1-OG1 3.41Å
14	D	68.1	Low	65.4	Low	86 Å²	86	116 Å²	116	46%	0.46	61%	0.606	S	S	.	*			trans	-53.8	95.9	176.4	-70.4	-53.5	0	0	0	107.4	K12 E16 K17 T18	K12-D14 PolarHBondContact O-N 2.97Å; D14-E16 PolarHBondContact O-N 3.07Å; D14-E16 VanDerWaalsContact O-N 3.07Å; D14-K17 HydrophobicContact CB-CB 4.16Å; D14-K17 HydrophobicContact CB-CD 3.78Å; D14-K17 HydrophobicContact CB-CG 3.83Å; D14-K17 WeakPolarHBondContact O-CB 3.5Å; D14-K17 PolarHBondContact O-N 3.42Å; D14-K17 WeakPolarHBondContact OD2-CE 3.33Å; D14-K17 IonicContact OD2-NZ 2.74Å; D14-K17 PolarHBondContact OD2-NZ 3.25Å; D14-T18 PolarHBondContact O-N 3.19Å; D14-T18 PolarHBondContact O-OG1 3.08Å
15	R	67	Low	66.6	Low	182 Å²	182	114 Å²	114	69%	0.687	60%	0.599	S	S	*	*	H	α-helix	trans	-54.3	-33.6	-171	179	173	165.8	98.1	12.2	111.7	V13 T18 E19	V13-R15 VanDerWaalsContact C-N 3.26Å; V13-R15 PolarHBondContact O-N 2.74Å; R15-T18 PolarHBondContact O-N 2.94Å; R15-T18 PolarHBondContact O-OG1 3.39Å; R15-E19 HydrophobicContact CG-CG 4.43Å; R15-E19 WeakPolarHBondContact CG-OE1 3.46Å; R15-E19 IonicContact CZ-OE1 3.08Å; R15-E19 IonicContact NE-OE1 2.89Å; R15-E19 PolarHBondContact NE-OE1 2.75Å; R15-E19 IonicContact NH2-OE1 2.75Å; R15-E19 PolarHBondContact NH2-OE1 3.22Å; R15-E19 WeakPolarHBondContact O-CB 3.49Å; R15-E19 WeakPolarHBondContact O-CG 3.23Å; R15-E19 PolarHBondContact O-N 2.87Å
16	E	70	Confident	67.8	Low	162 Å²	162	108.9 Å²	108.9	76%	0.757	58%	0.578	S	S	*	*	H	α-helix	trans	-63.4	-40.6	175.8	-60.5	178.2	164.5	0	0	112.8	D14 S20	D14-E16 PolarHBondContact O-N 3.07Å; D14-E16 VanDerWaalsContact O-N 3.07Å; E16-S20 VanDerWaalsContact O-CB 3.3Å; E16-S20 WeakPolarHBondContact O-CB 3.46Å; E16-S20 PolarHBondContact O-N 3.18Å
17	K	72	Confident	69.1	Low	144 Å²	144	109.6 Å²	109.6	63%	0.626	58%	0.578	S	S	*	*	H	α-helix	trans	-68.6	-39.8	178.4	-64.9	-178.3	-172.7	156.5	0	110.9	D14 A21	D14-K17 HydrophobicContact CB-CB 4.16Å; D14-K17 HydrophobicContact CB-CD 3.78Å; D14-K17 HydrophobicContact CB-CG 3.83Å; D14-K17 WeakPolarHBondContact O-CB 3.5Å; D14-K17 PolarHBondContact O-N 3.42Å; D14-K17 WeakPolarHBondContact OD2-CE 3.33Å; D14-K17 IonicContact OD2-NZ 2.74Å; D14-K17 PolarHBondContact OD2-NZ 3.25Å; K17-A21 VanDerWaalsContact O-CB 3.23Å; K17-A21 WeakPolarHBondContact O-CB 3.3Å; K17-A21 PolarHBondContact O-N 3.28Å
18	T	74.2	Confident	70.8	Confident	56 Å²	56	107 Å²	107	34%	0.344	56%	0.563	S	S	.	*	H	α-helix	trans	-67.5	-45.3	176.6	6.2	0	0	0	0	111.6	V13 D14 R15 A21 V22	V13-T18 HydrophobicContact CG1-CG2 3.99Å; V13-T18 WeakPolarHBondContact CG1-OG1 3.41Å; D14-T18 PolarHBondContact O-N 3.19Å; D14-T18 PolarHBondContact O-OG1 3.08Å; R15-T18 PolarHBondContact O-N 2.94Å; R15-T18 PolarHBondContact O-OG1 3.39Å; T18-A21 PolarHBondContact O-N 2.92Å; T18-V22 VanDerWaalsContact O-CG2 3.25Å; T18-V22 WeakPolarHBondContact O-CG2 3.3Å; T18-V22 PolarHBondContact O-N 3.36Å
19	E	76.9	Confident	72.3	Confident	84 Å²	84	110.7 Å²	110.7	39%	0.393	57%	0.57	S	S	.	*	H	α-helix	trans	-62.4	-44	178.1	-74	176.7	-176.4	0	0	111.9	R15 V22 Q23	R15-E19 HydrophobicContact CG-CG 4.43Å; R15-E19 WeakPolarHBondContact CG-OE1 3.46Å; R15-E19 IonicContact CZ-OE1 3.08Å; R15-E19 IonicContact NE-OE1 2.89Å; R15-E19 PolarHBondContact NE-OE1 2.75Å; R15-E19 IonicContact NH2-OE1 2.75Å; R15-E19 PolarHBondContact NH2-OE1 3.22Å; R15-E19 WeakPolarHBondContact O-CB 3.49Å; R15-E19 WeakPolarHBondContact O-CG 3.23Å; R15-E19 PolarHBondContact O-N 2.87Å; E19-V22 PolarHBondContact O-N 3.34Å; E19-Q23 WeakPolarHBondContact O-CG 3.28Å; E19-Q23 PolarHBondContact O-N 3.02Å
20	S	71.6	Confident	73.7	Confident	76 Å²	76	106.4 Å²	106.4	53%	0.531	56%	0.555	S	S	.	*	H	α-helix	trans	-63.1	-43.9	175.7	-178.4	0	0	0	0	112	E16 V22 Q23 A24	E16-S20 VanDerWaalsContact O-CB 3.3Å; E16-S20 WeakPolarHBondContact O-CB 3.46Å; E16-S20 PolarHBondContact O-N 3.18Å; S20-V22 PolarHBondContact O-N 3.24Å; S20-Q23 PolarHBondContact O-N 3.48Å; S20-A24 WeakPolarHBondContact O-CB 3.25Å; S20-A24 PolarHBondContact O-N 3.35Å
21	A	77.4	Confident	75.4	Confident	48 Å²	48	108.6 Å²	108.6	40%	0.397	54%	0.544	S	S	.	.	H	α-helix	trans	-64.3	-39.2	176.6	0	0	0	0	0	112.2	K17 T18 N25	K17-A21 VanDerWaalsContact O-CB 3.23Å; K17-A21 WeakPolarHBondContact O-CB 3.3Å; K17-A21 PolarHBondContact O-N 3.28Å; T18-A21 PolarHBondContact O-N 2.92Å; A21-N25 PolarHBondContact O-N 2.75Å; A21-N25 PolarHBondContact O-ND2 2.81Å
22	V	76.5	Confident	77	Confident	88 Å²	88	109 Å²	109	53%	0.533	54%	0.543	S	S	.	.	H	α-helix	trans	-62.3	-48.6	175.4	170.4	0	0	0	0	109.9	T18 E19 S20 A24 N25 T26	T18-V22 VanDerWaalsContact O-CG2 3.25Å; T18-V22 WeakPolarHBondContact O-CG2 3.3Å; T18-V22 PolarHBondContact O-N 3.36Å; E19-V22 PolarHBondContact O-N 3.34Å; S20-V22 PolarHBondContact O-N 3.24Å; V22-A24 PolarHBondContact O-N 2.89Å; V22-N25 PolarHBondContact O-N 2.89Å; V22-T26 VanDerWaalsContact O-CB 3.28Å; V22-T26 WeakPolarHBondContact O-CB 3.39Å; V22-T26 PolarHBondContact O-N 3.49Å; V22-T26 PolarHBondContact O-OG1 2.98Å
23	Q	73	Confident	78.6	Confident	108 Å²	108	103.2 Å²	103.2	51%	0.505	52%	0.524	S	S	.	.	H	α-helix	trans	-61.5	-46.1	179	-70.5	179	21.2	0	0	112.5	E19 S20 N25 T26 Y27	E19-Q23 WeakPolarHBondContact O-CG 3.28Å; E19-Q23 PolarHBondContact O-N 3.02Å; S20-Q23 PolarHBondContact O-N 3.48Å; Q23-N25 PolarHBondContact O-N 2.97Å; Q23-T26 PolarHBondContact O-N 2.6Å; Q23-Y27 HydrophobicContact CB-CD2 4.41Å; Q23-Y27 HydrophobicContact CB-CE2 4.28Å; Q23-Y27 VanDerWaalsContact O-CD2 3.31Å; Q23-Y27 WeakPolarHBondContact O-CD2 3.43Å; Q23-Y27 PolarHBondContact O-N 2.94Å; Q23-Y27 VanDerWaalsContact O-N 3.16Å
24	A	76.3	Confident	80.1	Confident	66 Å²	66	105 Å²	105	55%	0.545	53%	0.529	S	S	.	.	H	α-helix	trans	-56.6	-33.3	178.4	0	0	0	0	0	112.7	S20 V22 P28	S20-A24 WeakPolarHBondContact O-CB 3.25Å; S20-A24 PolarHBondContact O-N 3.35Å; V22-A24 PolarHBondContact O-N 2.89Å; A24-P28 VanDerWaalsContact O-CD 3.3Å; A24-P28 WeakPolarHBondContact O-CD 3.44Å
25	N	77.6	Confident	81.4	Confident	123 Å²	123	105.6 Å²	105.6	66%	0.658	53%	0.532	S	S	*	.	H	α-helix	trans	-88.1	-23	177.7	-70.4	-60.9	0	0	0	113.7	A21 V22 Q23	A21-N25 PolarHBondContact O-N 2.75Å; A21-N25 PolarHBondContact O-ND2 2.81Å; V22-N25 PolarHBondContact O-N 2.89Å; Q23-N25 PolarHBondContact O-N 2.97Å
26	T	82.7	Confident	82.8	Confident	46 Å²	46	101.1 Å²	101.1	28%	0.282	53%	0.525	S	S	.	.	H	α-helix	trans	-86.9	-37.2	-171.8	-54.3	0	0	0	0	112.1	V22 Q23 Y29 Y30	V22-T26 VanDerWaalsContact O-CB 3.28Å; V22-T26 WeakPolarHBondContact O-CB 3.39Å; V22-T26 PolarHBondContact O-N 3.49Å; V22-T26 PolarHBondContact O-OG1 2.98Å; Q23-T26 PolarHBondContact O-N 2.6Å; T26-Y29 WeakPolarHBondContact O-CB 3.36Å; T26-Y29 PolarHBondContact O-N 3.27Å; T26-Y30 HydrophobicContact CG2-CD2 3.68Å; T26-Y30 HydrophobicContact CG2-CE2 3.19Å; T26-Y30 WeakPolarHBondContact O-CD2 3.31Å; T26-Y30 PolarHBondContact O-N 3.46Å; T26-Y30 VanDerWaalsContact O-N 3.14Å
27	Y	80.8	Confident	84.1	Confident	170 Å²	170	99.4 Å²	99.4	67%	0.667	52%	0.515	S	S	*	.	H	α-helix	trans	-58.4	-50.4	179.4	-83.9	-72.8	0	0	0	113.5	Q23 Y29 Y30 E31	Q23-Y27 HydrophobicContact CB-CD2 4.41Å; Q23-Y27 HydrophobicContact CB-CE2 4.28Å; Q23-Y27 VanDerWaalsContact O-CD2 3.31Å; Q23-Y27 WeakPolarHBondContact O-CD2 3.43Å; Q23-Y27 PolarHBondContact O-N 2.94Å; Q23-Y27 VanDerWaalsContact O-N 3.16Å; Y27-Y29 PolarHBondContact O-N 3.16Å; Y27-Y30 PolarHBondContact O-N 3.06Å; Y27-E31 PolarHBondContact O-N 3.25Å; Y27-E31 VanDerWaalsContact O-N 3.1Å
28	P	86.9	Confident	85.2	Confident	68 Å²	68	96.6 Å²	96.6	44%	0.442	51%	0.506	S	S	.	.	H	α-helix	trans	-61.7	-32.5	178.2	-22.7	34	0	0	0	113.1	A24 E31 T32	A24-P28 VanDerWaalsContact O-CD 3.3Å; A24-P28 WeakPolarHBondContact O-CD 3.44Å; P28-E31 PolarHBondContact O-N 3.14Å; P28-T32 WeakPolarHBondContact O-CB 3.45Å; P28-T32 PolarHBondContact O-N 3.1Å; P28-T32 PolarHBondContact O-OG1 3.25Å
29	Y	88.4	Confident	86.2	Confident	154 Å²	154	95.8 Å²	95.8	60%	0.604	51%	0.509	S	S	*	.	H	α-helix	trans	-64.6	-47.7	177.3	179.6	-95.4	0	0	0	111.3	T26 Y27 E31 T32 V33	T26-Y29 WeakPolarHBondContact O-CB 3.36Å; T26-Y29 PolarHBondContact O-N 3.27Å; Y27-Y29 PolarHBondContact O-N 3.16Å; Y29-E31 VanDerWaalsContact C-N 3.33Å; Y29-E31 PolarHBondContact O-N 2.76Å; Y29-T32 PolarHBondContact O-N 2.97Å; Y29-V33 HydrophobicContact CD1-CG2 4.24Å; Y29-V33 HydrophobicContact CE1-CG2 3.83Å; Y29-V33 HydrophobicContact CE2-CG2 4.32Å; Y29-V33 WeakPolarHBondContact O-CG2 3.39Å; Y29-V33 PolarHBondContact O-N 3.43Å
30	Y	88.3	Confident	87.1	Confident	154 Å²	154	97.3 Å²	97.3	60%	0.604	52%	0.516	S	S	*	.	H	α-helix	trans	-63.1	-39.1	176.7	-73.8	-55	0	0	0	112.7	T26 Y27 V33 M34	T26-Y30 HydrophobicContact CG2-CD2 3.68Å; T26-Y30 HydrophobicContact CG2-CE2 3.19Å; T26-Y30 WeakPolarHBondContact O-CD2 3.31Å; T26-Y30 PolarHBondContact O-N 3.46Å; T26-Y30 VanDerWaalsContact O-N 3.14Å; Y27-Y30 PolarHBondContact O-N 3.06Å; Y30-V33 PolarHBondContact O-N 3.49Å; Y30-M34 WeakPolarHBondContact O-CB 3.33Å; Y30-M34 PolarHBondContact O-N 3.3Å
31	E	90.8	Very high	88.2	Confident	126 Å²	126	96.9 Å²	96.9	59%	0.589	51%	0.507	S	S	*	.	H	α-helix	trans	-61.6	-45.6	176	-168.8	176.5	100	0	0	111.3	Y27 P28 Y29 V33 M34 L35	Y27-E31 PolarHBondContact O-N 3.25Å; Y27-E31 VanDerWaalsContact O-N 3.1Å; P28-E31 PolarHBondContact O-N 3.14Å; Y29-E31 VanDerWaalsContact C-N 3.33Å; Y29-E31 PolarHBondContact O-N 2.76Å; E31-V33 PolarHBondContact O-N 2.98Å; E31-M34 PolarHBondContact O-N 2.94Å; E31-L35 HydrophobicContact CG-CD1 4.19Å; E31-L35 WeakPolarHBondContact O-CB 3.37Å; E31-L35 WeakPolarHBondContact O-CG 3.31Å; E31-L35 PolarHBondContact O-N 3.32Å
32	T	94.5	Very high	88.9	Confident	84 Å²	84	97.7 Å²	97.7	52%	0.515	51%	0.51	S	S	.	.	H	α-helix	trans	-61.9	-45	178	-57	0	0	0	0	111.9	P28 Y29 L35 T36	P28-T32 WeakPolarHBondContact O-CB 3.45Å; P28-T32 PolarHBondContact O-N 3.1Å; P28-T32 PolarHBondContact O-OG1 3.25Å; Y29-T32 PolarHBondContact O-N 2.97Å; T32-L35 PolarHBondContact O-N 3.48Å; T32-T36 WeakPolarHBondContact O-CB 3.46Å; T32-T36 PolarHBondContact O-N 2.99Å; T32-T36 PolarHBondContact O-OG1 2.88Å
33	V	94.2	Very high	89.6	Confident	73 Å²	73	96.8 Å²	96.8	44%	0.442	51%	0.507	S	S	.	.	H	α-helix	trans	-63	-44	178.1	173.2	0	0	0	0	110.9	Y29 Y30 E31 T36 F37	Y29-V33 HydrophobicContact CD1-CG2 4.24Å; Y29-V33 HydrophobicContact CE1-CG2 3.83Å; Y29-V33 HydrophobicContact CE2-CG2 4.32Å; Y29-V33 WeakPolarHBondContact O-CG2 3.39Å; Y29-V33 PolarHBondContact O-N 3.43Å; Y30-V33 PolarHBondContact O-N 3.49Å; E31-V33 PolarHBondContact O-N 2.98Å; V33-T36 PolarHBondContact O-N 3.44Å; V33-F37 WeakPolarHBondContact O-CB 3.4Å; V33-F37 PolarHBondContact O-N 3.22Å
34	M	96.1	Very high	90.6	Very high	106 Å²	106	95.9 Å²	95.9	52%	0.522	51%	0.506	S	S	.	.	H	α-helix	trans	-63.5	-47	178.8	-173.9	-167.9	77.8	0	0	111.8	Y30 E31 T36 F37 I38	Y30-M34 WeakPolarHBondContact O-CB 3.33Å; Y30-M34 PolarHBondContact O-N 3.3Å; E31-M34 PolarHBondContact O-N 2.94Å; M34-T36 VanDerWaalsContact C-N 3.31Å; M34-T36 PolarHBondContact O-N 3.37Å; M34-F37 PolarHBondContact O-N 2.88Å; M34-I38 HydrophobicContact CE-CD1 4.08Å; M34-I38 HydrophobicContact CG-CD1 3.89Å; M34-I38 VanDerWaalsContact O-CG1 3.31Å; M34-I38 WeakPolarHBondContact O-CG1 3.49Å; M34-I38 PolarHBondContact O-N 3.48Å; M34-I38 HydrophobicContact SD-CD1 4.4Å
35	L	94.8	Very high	91.4	Very high	100 Å²	100	97 Å²	97	52%	0.524	50%	0.502	S	S	.	.	H	α-helix	trans	-62.7	-39.1	178.4	-72.8	173.5	0	0	0	112	E31 T32 I38 G39	E31-L35 HydrophobicContact CG-CD1 4.19Å; E31-L35 WeakPolarHBondContact O-CB 3.37Å; E31-L35 WeakPolarHBondContact O-CG 3.31Å; E31-L35 PolarHBondContact O-N 3.32Å; T32-L35 PolarHBondContact O-N 3.48Å; L35-I38 PolarHBondContact O-N 2.93Å; L35-G39 PolarHBondContact O-N 3.29Å
36	T	96.3	Very high	92	Very high	88 Å²	88	93.8 Å²	93.8	54%	0.54	49%	0.489	S	S	.	.	H	α-helix	trans	-62.3	-46.9	175.7	-57.1	0	0	0	0	110.8	T32 V33 M34 G39 E40	T32-T36 WeakPolarHBondContact O-CB 3.46Å; T32-T36 PolarHBondContact O-N 2.99Å; T32-T36 PolarHBondContact O-OG1 2.88Å; V33-T36 PolarHBondContact O-N 3.44Å; M34-T36 VanDerWaalsContact C-N 3.31Å; M34-T36 PolarHBondContact O-N 3.37Å; T36-G39 PolarHBondContact O-N 3Å; T36-E40 PolarHBondContact O-N 3.41Å
37	F	96.2	Very high	92.2	Very high	126 Å²	126	97.6 Å²	97.6	55%	0.553	50%	0.503	S	S	*	.	H	α-helix	trans	-62.9	-44	178.4	-174.9	-107.5	0	0	0	112.6	V33 M34 G39 E40 I41	V33-F37 WeakPolarHBondContact O-CB 3.4Å; V33-F37 PolarHBondContact O-N 3.22Å; M34-F37 PolarHBondContact O-N 2.88Å; F37-G39 VanDerWaalsContact C-N 3.31Å; F37-G39 PolarHBondContact O-N 3.44Å; F37-E40 PolarHBondContact O-N 3.03Å; F37-I41 HydrophobicContact CD1-CD1 3.71Å; F37-I41 HydrophobicContact CD2-CD1 4.5Å; F37-I41 HydrophobicContact CE1-CD1 3.24Å; F37-I41 HydrophobicContact CE1-CG1 4.42Å; F37-I41 HydrophobicContact CE2-CD1 4.1Å; F37-I41 HydrophobicContact CG-CD1 4.34Å; F37-I41 HydrophobicContact CZ-CD1 3.48Å; F37-I41 VanDerWaalsContact CZ-CD1 3.48Å; F37-I41 HydrophobicContact CZ-CG1 4.39Å; F37-I41 WeakPolarHBondContact O-CG1 3.43Å; F37-I41 PolarHBondContact O-N 3.47Å
38	I	96.1	Very high	92.4	Very high	84 Å²	84	95 Å²	95	43%	0.431	50%	0.502	S	S	.	.	H	α-helix	trans	-61.5	-42.3	174.5	-67.8	167.2	0	0	0	110.5	M34 L35 S42	M34-I38 HydrophobicContact CE-CD1 4.08Å; M34-I38 HydrophobicContact CG-CD1 3.89Å; M34-I38 VanDerWaalsContact O-CG1 3.31Å; M34-I38 WeakPolarHBondContact O-CG1 3.49Å; M34-I38 PolarHBondContact O-N 3.48Å; M34-I38 HydrophobicContact SD-CD1 4.4Å; L35-I38 PolarHBondContact O-N 2.93Å; I38-S42 VanDerWaalsContact O-CB 3.25Å; I38-S42 WeakPolarHBondContact O-CB 3.4Å; I38-S42 PolarHBondContact O-N 3.42Å; I38-S42 PolarHBondContact O-OG 2.68Å
39	G	95.3	Very high	92.3	Very high	40 Å²	40	100 Å²	100	41%	0.412	52%	0.516	S	S	.	.	H	α-helix	trans	-62.1	-43.6	177.2	0	0	0	0	0	112.9	L35 T36 F37 S42 S43	L35-G39 PolarHBondContact O-N 3.29Å; T36-G39 PolarHBondContact O-N 3Å; F37-G39 VanDerWaalsContact C-N 3.31Å; F37-G39 PolarHBondContact O-N 3.44Å; G39-S42 PolarHBondContact O-N 2.88Å; G39-S43 WeakPolarHBondContact O-CB 3.2Å; G39-S43 PolarHBondContact O-N 2.97Å
40	E	95.5	Very high	92	Very high	116 Å²	116	101.4 Å²	101.4	54%	0.542	53%	0.526	S	S	.	.	H	α-helix	trans	-62.7	-50.7	177.4	-172.7	173.4	100.8	0	0	111.3	T36 F37 S42 S43 D44	T36-E40 PolarHBondContact O-N 3.41Å; F37-E40 PolarHBondContact O-N 3.03Å; E40-S42 VanDerWaalsContact C-N 3.33Å; E40-S42 PolarHBondContact O-N 3.36Å; E40-S43 WeakPolarHBondContact O-CB 3.36Å; E40-S43 PolarHBondContact O-N 3.38Å; E40-S43 VanDerWaalsContact O-N 3.14Å; E40-D44 PolarHBondContact O-N 3.42Å
41	I	94.8	Very high	91.4	Very high	67 Å²	67	99.9 Å²	99.9	34%	0.344	55%	0.545	S	S	.	.	H	α-helix	trans	-60	-44.6	175.8	-67.1	170.7	0	0	0	110.8	F37 S43 D44 L45	F37-I41 HydrophobicContact CD1-CD1 3.71Å; F37-I41 HydrophobicContact CD2-CD1 4.5Å; F37-I41 HydrophobicContact CE1-CD1 3.24Å; F37-I41 HydrophobicContact CE1-CG1 4.42Å; F37-I41 HydrophobicContact CE2-CD1 4.1Å; F37-I41 HydrophobicContact CG-CD1 4.34Å; F37-I41 HydrophobicContact CZ-CD1 3.48Å; F37-I41 VanDerWaalsContact CZ-CD1 3.48Å; F37-I41 HydrophobicContact CZ-CG1 4.39Å; F37-I41 WeakPolarHBondContact O-CG1 3.43Å; F37-I41 PolarHBondContact O-N 3.47Å; I41-S43 VanDerWaalsContact C-N 3.25Å; I41-S43 PolarHBondContact O-N 3.38Å; I41-D44 PolarHBondContact O-N 3.3Å; I41-L45 HydrophobicContact CG2-CD1 3.75Å; I41-L45 HydrophobicContact CG2-CG 4.07Å; I41-L45 WeakPolarHBondContact O-CB 3.35Å; I41-L45 WeakPolarHBondContact O-CG 3.34Å; I41-L45 PolarHBondContact O-N 2.74Å
42	S	91.1	Very high	91.4	Very high	64 Å²	64	98.6 Å²	98.6	45%	0.448	54%	0.543	S	S	.	.	H	α-helix	trans	-61.9	-37.6	179.3	-58.3	0	0	0	0	111.4	I38 G39 E40 S46	I38-S42 VanDerWaalsContact O-CB 3.25Å; I38-S42 WeakPolarHBondContact O-CB 3.4Å; I38-S42 PolarHBondContact O-N 3.42Å; I38-S42 PolarHBondContact O-OG 2.68Å; G39-S42 PolarHBondContact O-N 2.88Å; E40-S42 VanDerWaalsContact C-N 3.33Å; E40-S42 PolarHBondContact O-N 3.36Å; S42-S46 WeakPolarHBondContact O-CB 3.25Å; S42-S46 PolarHBondContact O-N 3.14Å; S42-S46 PolarHBondContact O-OG 3.04Å
43	S	92.5	Very high	91.2	Very high	69 Å²	69	99.4 Å²	99.4	48%	0.483	55%	0.545	S	S	.	.	H	α-helix	trans	-64	-51.1	175	-174.3	0	0	0	0	111.2	G39 E40 I41 L45 S46 H47	G39-S43 WeakPolarHBondContact O-CB 3.2Å; G39-S43 PolarHBondContact O-N 2.97Å; E40-S43 WeakPolarHBondContact O-CB 3.36Å; E40-S43 PolarHBondContact O-N 3.38Å; E40-S43 VanDerWaalsContact O-N 3.14Å; I41-S43 VanDerWaalsContact C-N 3.25Å; I41-S43 PolarHBondContact O-N 3.38Å; S43-L45 VanDerWaalsContact C-N 3.34Å; S43-L45 PolarHBondContact O-N 2.88Å; S43-S46 PolarHBondContact O-N 3.15Å; S43-S46 PolarHBondContact O-OG 3.42Å; S43-H47 PolarHBondContact O-N 2.93Å
44	D	93.4	Very high	91.1	Very high	89 Å²	89	100.8 Å²	100.8	48%	0.476	55%	0.55	S	S	.	*	H	α-helix	trans	-61.8	-40.8	179.2	-72.4	-20.9	0	0	0	112.4	E40 I41 H47 N48	E40-D44 PolarHBondContact O-N 3.42Å; I41-D44 PolarHBondContact O-N 3.3Å; D44-H47 PolarHBondContact O-N 3.37Å; D44-N48 PolarHBondContact O-N 3.35Å; D44-N48 VanDerWaalsContact O-N 3.08Å; D44-N48 PolarHBondContact O-ND2 2.91Å
45	L	92.2	Very high	90.8	Very high	91 Å²	91	100.5 Å²	100.5	48%	0.476	55%	0.552	S	S	.	*	H	α-helix	trans	-62.7	-48.5	175	-70.8	177.1	0	0	0	110.6	I41 S43 H47 N48 F49	I41-L45 HydrophobicContact CG2-CD1 3.75Å; I41-L45 HydrophobicContact CG2-CG 4.07Å; I41-L45 WeakPolarHBondContact O-CB 3.35Å; I41-L45 WeakPolarHBondContact O-CG 3.34Å; I41-L45 PolarHBondContact O-N 2.74Å; S43-L45 VanDerWaalsContact C-N 3.34Å; S43-L45 PolarHBondContact O-N 2.88Å; L45-H47 VanDerWaalsContact C-N 3.28Å; L45-H47 PolarHBondContact O-N 3.2Å; L45-N48 PolarHBondContact O-N 3.4Å; L45-F49 VanDerWaalsContact O-CD2 3.22Å; L45-F49 WeakPolarHBondContact O-CD2 3.09Å; L45-F49 PolarHBondContact O-N 2.87Å; L45-F49 VanDerWaalsContact O-N 3.16Å
46	S	90.6	Very high	90.5	Very high	54 Å²	54	100.6 Å²	100.6	38%	0.378	55%	0.554	S	S	.	*	H	α-helix	trans	-59.2	-41.5	178.1	73.8	0	0	0	0	111.6	S42 S43 N48 F49 F50	S42-S46 WeakPolarHBondContact O-CB 3.25Å; S42-S46 PolarHBondContact O-N 3.14Å; S42-S46 PolarHBondContact O-OG 3.04Å; S43-S46 PolarHBondContact O-N 3.15Å; S43-S46 PolarHBondContact O-OG 3.42Å; S46-N48 PolarHBondContact O-N 3.41Å; S46-F49 PolarHBondContact O-N 3.14Å; S46-F49 VanDerWaalsContact O-N 3.15Å; S46-F50 WeakPolarHBondContact O-CD2 3.23Å; S46-F50 PolarHBondContact O-N 3.21Å; S46-F50 VanDerWaalsContact O-N 3.14Å
47	H	86.8	Confident	90.1	Very high	126 Å²	126	101.4 Å²	101.4	58%	0.583	56%	0.555	S	S	*	*	H	α-helix	trans	-60.6	-43.3	177.8	-176	-115.2	0	0	0	111.9	S43 D44 L45 F49 F50 A51	S43-H47 PolarHBondContact O-N 2.93Å; D44-H47 PolarHBondContact O-N 3.37Å; L45-H47 VanDerWaalsContact C-N 3.28Å; L45-H47 PolarHBondContact O-N 3.2Å; H47-F49 VanDerWaalsContact C-N 3.3Å; H47-F49 PolarHBondContact O-N 3.08Å; H47-F50 PolarHBondContact O-N 3.16Å; H47-A51 VanDerWaalsContact O-CB 3.23Å; H47-A51 WeakPolarHBondContact O-CB 3.22Å; H47-A51 PolarHBondContact O-N 3.21Å
48	N	85.4	Confident	89.7	Confident	117 Å²	117	99.6 Å²	99.6	63%	0.626	56%	0.555	S	S	*	*	H	α-helix	trans	-68.4	-23	177.2	-71.3	-35.5	0	0	0	114.4	D44 L45 S46	D44-N48 PolarHBondContact O-N 3.35Å; D44-N48 VanDerWaalsContact O-N 3.08Å; D44-N48 PolarHBondContact O-ND2 2.91Å; L45-N48 PolarHBondContact O-N 3.4Å; S46-N48 PolarHBondContact O-N 3.41Å
49	F	85.6	Confident	89.2	Confident	172 Å²	172	100.8 Å²	100.8	75%	0.754	56%	0.564	S	S	*	*	H	α-helix	trans	-84.7	-28.5	177.1	-85.6	-73.7	0	0	0	113.4	L45 S46 H47	L45-F49 VanDerWaalsContact O-CD2 3.22Å; L45-F49 WeakPolarHBondContact O-CD2 3.09Å; L45-F49 PolarHBondContact O-N 2.87Å; L45-F49 VanDerWaalsContact O-N 3.16Å; S46-F49 PolarHBondContact O-N 3.14Å; S46-F49 VanDerWaalsContact O-N 3.15Å; H47-F49 VanDerWaalsContact C-N 3.3Å; H47-F49 PolarHBondContact O-N 3.08Å
50	F	82.5	Confident	88.7	Confident	184 Å²	184	105.9 Å²	105.9	81%	0.807	58%	0.577	S	S	*	*	H	α-helix	trans	-101.7	-11.5	-176.7	-66.8	-67	0	0	0	114.4	S46 H47	S46-F50 WeakPolarHBondContact O-CD2 3.23Å; S46-F50 PolarHBondContact O-N 3.21Å; S46-F50 VanDerWaalsContact O-N 3.14Å; H47-F50 PolarHBondContact O-N 3.16Å
51	A	73.8	Confident	88.1	Confident	122 Å²	122	105 Å²	105	100%	1.008	58%	0.58	S	S	*	*			trans	-82	0	170.2	0	0	0	0	0	111.2	H47	H47-A51 VanDerWaalsContact O-CB 3.23Å; H47-A51 WeakPolarHBondContact O-CB 3.22Å; H47-A51 PolarHBondContact O-N 3.21Å

Retrieved 51 of 51 residues in 48 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).