G4VBK8_SCHMA Loading...

Transcriptional regulator

AlphaFold DB , UniProt , Accession G4VBK8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 40 aa.

						>G4VBK8_SCHMA|G4VBK8
MEITFGNRGVMNEYFLLDLNSSIVYIHDFAKDLIQDTQSK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.1	Very low	60.7	Low	222 Å²	222	113.8 Å²	113.8	100%	1.094	60%	0.599	S	S	*	*				0	92.3	0	179.3	-179.4	-83	0	0	106.7	I3	M1-I3 HydrophobicContact CG-CG1 4.26Å; M1-I3 PolarHBondContact O-N 2.74Å
2	E	46.5	Very low	62.1	Low	176 Å²	176	111.8 Å²	111.8	82%	0.822	59%	0.589	S	S	*	*			trans	-70.8	110.5	167.9	-167.1	174.1	-170.7	0	0	105.8	T4	E2-T4 PolarHBondContact O-N 3.44Å
3	I	52.8	Low	63.2	Low	90 Å²	90	112.5 Å²	112.5	46%	0.462	59%	0.587	S	S	.	*			trans	-76.2	90.7	173.3	-58.1	172.5	0	0	0	104.8	M1 F5	M1-I3 HydrophobicContact CG-CG1 4.26Å; M1-I3 PolarHBondContact O-N 2.74Å; I3-F5 WeakPolarHBondContact O-CD2 3.42Å; I3-F5 PolarHBondContact O-N 3.31Å
4	T	56.3	Low	64.2	Low	70 Å²	70	115.4 Å²	115.4	43%	0.429	59%	0.588	S	S	.	*			trans	-58.6	102.7	-176.6	-44.7	0	0	0	0	109.1	E2 G6 N7	E2-T4 PolarHBondContact O-N 3.44Å; T4-G6 PolarHBondContact O-N 3.07Å; T4-G6 VanDerWaalsContact O-N 3.13Å; T4-N7 PolarHBondContact O-N 2.97Å
5	F	57.2	Low	65.3	Low	160 Å²	160	116.3 Å²	116.3	70%	0.702	59%	0.586	S	S	*	*	H	α-helix	trans	-56.2	-27.2	176	-75.3	-95.7	0	0	0	111.9	I3 N7 R8 G9	I3-F5 WeakPolarHBondContact O-CD2 3.42Å; I3-F5 PolarHBondContact O-N 3.31Å; F5-N7 VanDerWaalsContact C-N 3.29Å; F5-N7 PolarHBondContact O-N 3.27Å; F5-R8 WeakPolarHBondContact O-CB 3.28Å; F5-R8 PolarHBondContact O-N 3.01Å; F5-R8 VanDerWaalsContact O-N 3.1Å; F5-G9 PolarHBondContact O-N 3.09Å
6	G	61.5	Low	66.3	Low	52 Å²	52	114.1 Å²	114.1	54%	0.536	58%	0.576	S	S	.	*	H	α-helix	trans	-57.9	-37.1	173.9	0	0	0	0	0	113.8	T4	T4-G6 PolarHBondContact O-N 3.07Å; T4-G6 VanDerWaalsContact O-N 3.13Å
7	N	65.6	Low	67.3	Low	108 Å²	108	114.1 Å²	114.1	58%	0.578	58%	0.577	S	S	*	*	H	α-helix	trans	-75.3	-26.2	177.7	-68.8	-9.5	0	0	0	112.2	T4 F5 M11	T4-N7 PolarHBondContact O-N 2.97Å; F5-N7 VanDerWaalsContact C-N 3.29Å; F5-N7 PolarHBondContact O-N 3.27Å; N7-M11 WeakPolarHBondContact O-CB 3.41Å; N7-M11 VanDerWaalsContact O-CG 3.23Å; N7-M11 WeakPolarHBondContact O-CG 3.41Å; N7-M11 PolarHBondContact O-N 3.38Å
8	R	62.9	Low	68.3	Low	135 Å²	135	113.3 Å²	113.3	51%	0.509	58%	0.575	S	S	.	*	H	α-helix	trans	-68.8	-38.3	177.5	-69.8	-179.6	168.9	179.2	-6.9	112	F5 M11 N12	F5-R8 WeakPolarHBondContact O-CB 3.28Å; F5-R8 PolarHBondContact O-N 3.01Å; F5-R8 VanDerWaalsContact O-N 3.1Å; R8-M11 PolarHBondContact O-N 3.2Å; R8-N12 VanDerWaalsContact O-CB 3.27Å; R8-N12 WeakPolarHBondContact O-CB 3.31Å; R8-N12 PolarHBondContact O-N 3.45Å
9	G	69.4	Low	69.3	Low	38 Å²	38	111.5 Å²	111.5	39%	0.392	57%	0.566	S	S	.	*	H	α-helix	trans	-59.5	-50.8	175.7	0	0	0	0	0	111.4	F5 N12 E13	F5-G9 PolarHBondContact O-N 3.09Å; G9-N12 WeakPolarHBondContact O-CB 3.46Å; G9-N12 PolarHBondContact O-N 2.89Å; G9-E13 WeakPolarHBondContact O-CG 3.4Å; G9-E13 PolarHBondContact O-N 3.42Å
10	V	72.9	Confident	70.3	Confident	64 Å²	64	110.7 Å²	110.7	39%	0.388	56%	0.564	S	S	.	*	H	α-helix	trans	-62.6	-44.4	177.3	174.2	0	0	0	0	112	N12 E13 Y14	V10-N12 VanDerWaalsContact C-N 3.29Å; V10-N12 PolarHBondContact O-N 2.81Å; V10-E13 PolarHBondContact O-N 2.96Å; V10-Y14 HydrophobicContact CG1-CD2 3.69Å; V10-Y14 HydrophobicContact CG1-CE2 3.22Å; V10-Y14 WeakPolarHBondContact O-CD2 3.47Å; V10-Y14 PolarHBondContact O-N 3.03Å
11	M	74.1	Confident	71.2	Confident	137 Å²	137	108.5 Å²	108.5	68%	0.675	56%	0.558	S	S	*	*	H	α-helix	trans	-61.4	-37.3	174.7	-76.7	-69	-162.8	0	0	112.5	N7 R8 Y14 F15	N7-M11 WeakPolarHBondContact O-CB 3.41Å; N7-M11 VanDerWaalsContact O-CG 3.23Å; N7-M11 WeakPolarHBondContact O-CG 3.41Å; N7-M11 PolarHBondContact O-N 3.38Å; R8-M11 PolarHBondContact O-N 3.2Å; M11-Y14 PolarHBondContact O-N 3.49Å; M11-F15 VanDerWaalsContact O-CB 3.3Å; M11-F15 WeakPolarHBondContact O-CB 3.29Å; M11-F15 PolarHBondContact O-N 3.41Å
12	N	77.9	Confident	73.3	Confident	89 Å²	89	100.3 Å²	100.3	48%	0.476	52%	0.523	S	S	.	.	H	α-helix	trans	-67.7	-38.2	176.5	-171.8	66.3	0	0	0	111.5	R8 G9 V10 F15 L16	R8-N12 VanDerWaalsContact O-CB 3.27Å; R8-N12 WeakPolarHBondContact O-CB 3.31Å; R8-N12 PolarHBondContact O-N 3.45Å; G9-N12 WeakPolarHBondContact O-CB 3.46Å; G9-N12 PolarHBondContact O-N 2.89Å; V10-N12 VanDerWaalsContact C-N 3.29Å; V10-N12 PolarHBondContact O-N 2.81Å; N12-F15 PolarHBondContact O-N 3.28Å; N12-L16 WeakPolarHBondContact O-CB 3.43Å; N12-L16 VanDerWaalsContact O-CG 3.23Å; N12-L16 WeakPolarHBondContact O-CG 3.31Å; N12-L16 PolarHBondContact O-N 3.28Å
13	E	76	Confident	75.6	Confident	121 Å²	121	96.3 Å²	96.3	57%	0.565	51%	0.506	S	S	*	.	H	α-helix	trans	-63.6	-45.8	173.7	-69.9	176	132.7	0	0	111.7	G9 V10 F15 L16 L17	G9-E13 WeakPolarHBondContact O-CG 3.4Å; G9-E13 PolarHBondContact O-N 3.42Å; V10-E13 PolarHBondContact O-N 2.96Å; E13-F15 VanDerWaalsContact C-N 3.35Å; E13-F15 PolarHBondContact O-N 3.33Å; E13-L16 PolarHBondContact O-N 3.45Å; E13-L17 WeakPolarHBondContact O-CG 3.36Å; E13-L17 PolarHBondContact O-N 2.91Å
14	Y	77.6	Confident	77.5	Confident	154 Å²	154	96 Å²	96	60%	0.604	51%	0.509	S	S	*	.	H	α-helix	trans	-62.6	-40.9	174.9	-70.9	-58.6	0	0	0	112.4	V10 M11 L17 D18	V10-Y14 HydrophobicContact CG1-CD2 3.69Å; V10-Y14 HydrophobicContact CG1-CE2 3.22Å; V10-Y14 WeakPolarHBondContact O-CD2 3.47Å; V10-Y14 PolarHBondContact O-N 3.03Å; M11-Y14 PolarHBondContact O-N 3.49Å; Y14-L17 PolarHBondContact O-N 2.96Å; Y14-D18 WeakPolarHBondContact O-CB 3.45Å; Y14-D18 PolarHBondContact O-N 2.92Å
15	F	80.1	Confident	79.2	Confident	128 Å²	128	100.8 Å²	100.8	56%	0.561	52%	0.52	S	S	*	.	H	α-helix	trans	-62.3	-41.9	175.7	179.6	-100.9	0	0	0	112.1	M11 N12 E13 D18 L19	M11-F15 VanDerWaalsContact O-CB 3.3Å; M11-F15 WeakPolarHBondContact O-CB 3.29Å; M11-F15 PolarHBondContact O-N 3.41Å; N12-F15 PolarHBondContact O-N 3.28Å; E13-F15 VanDerWaalsContact C-N 3.35Å; E13-F15 PolarHBondContact O-N 3.33Å; F15-D18 PolarHBondContact O-N 3.41Å; F15-L19 WeakPolarHBondContact O-CB 3.33Å; F15-L19 PolarHBondContact O-N 2.96Å
16	L	82	Confident	80.9	Confident	81 Å²	81	98.4 Å²	98.4	42%	0.424	51%	0.513	S	S	.	.	H	α-helix	trans	-67.8	-36.7	176.6	-72.2	172.4	0	0	0	112.5	N12 E13 N20	N12-L16 WeakPolarHBondContact O-CB 3.43Å; N12-L16 VanDerWaalsContact O-CG 3.23Å; N12-L16 WeakPolarHBondContact O-CG 3.31Å; N12-L16 PolarHBondContact O-N 3.28Å; E13-L16 PolarHBondContact O-N 3.45Å; L16-N20 WeakPolarHBondContact O-CB 3.27Å; L16-N20 PolarHBondContact O-N 2.96Å; L16-N20 PolarHBondContact O-ND2 2.83Å
17	L	83.5	Confident	82.5	Confident	114 Å²	114	101.6 Å²	101.6	60%	0.597	51%	0.514	S	S	*	.	H	α-helix	trans	-65.2	-43	174.3	-73	170.4	0	0	0	111.7	E13 Y14 N20 S21	E13-L17 WeakPolarHBondContact O-CG 3.36Å; E13-L17 PolarHBondContact O-N 2.91Å; Y14-L17 PolarHBondContact O-N 2.96Å; L17-N20 PolarHBondContact O-N 3.35Å; L17-S21 PolarHBondContact O-N 3.19Å; L17-S21 PolarHBondContact O-OG 2.95Å
18	D	85.4	Confident	83.8	Confident	101 Å²	101	100.3 Å²	100.3	54%	0.54	51%	0.507	S	S	.	.	H	α-helix	trans	-66.2	-36.8	176.7	-170.1	69.5	0	0	0	112.5	Y14 F15 S21 S22	Y14-D18 WeakPolarHBondContact O-CB 3.45Å; Y14-D18 PolarHBondContact O-N 2.92Å; F15-D18 PolarHBondContact O-N 3.41Å; D18-S21 WeakPolarHBondContact CA-OG 3.5Å; D18-S21 PolarHBondContact O-OG 3.48Å; D18-S22 WeakPolarHBondContact O-CB 3.23Å; D18-S22 PolarHBondContact O-N 2.95Å; D18-S22 PolarHBondContact O-OG 2.87Å
19	L	87.4	Confident	85.3	Confident	78 Å²	78	99.7 Å²	99.7	41%	0.408	51%	0.508	S	S	.	.	H	α-helix	trans	-64.5	-45.5	172.9	-168.5	82.5	0	0	0	111.1	F15 S22 I23	F15-L19 WeakPolarHBondContact O-CB 3.33Å; F15-L19 PolarHBondContact O-N 2.96Å; L19-S22 WeakPolarHBondContact O-CB 3.43Å; L19-S22 PolarHBondContact O-N 3.48Å; L19-I23 HydrophobicContact CD2-CD1 4.23Å; L19-I23 HydrophobicContact CG-CD1 4.05Å; L19-I23 VanDerWaalsContact O-CG1 3.27Å; L19-I23 WeakPolarHBondContact O-CG1 3.46Å; L19-I23 PolarHBondContact O-N 3.36Å
20	N	87.9	Confident	86.5	Confident	95 Å²	95	99.8 Å²	99.8	51%	0.508	51%	0.505	S	S	.	.	H	α-helix	trans	-64.1	-41.7	179.7	-80.5	-20.8	0	0	0	112.1	L16 L17 S22 I23 V24	L16-N20 WeakPolarHBondContact O-CB 3.27Å; L16-N20 PolarHBondContact O-N 2.96Å; L16-N20 PolarHBondContact O-ND2 2.83Å; L17-N20 PolarHBondContact O-N 3.35Å; N20-S22 VanDerWaalsContact C-N 3.34Å; N20-I23 PolarHBondContact O-N 3.01Å; N20-V24 WeakPolarHBondContact O-CG2 3.42Å; N20-V24 PolarHBondContact O-N 3.35Å; N20-V24 VanDerWaalsContact O-N 3.08Å
21	S	90.7	Very high	87.5	Confident	65 Å²	65	102 Å²	102	46%	0.455	51%	0.51	S	S	.	.	H	α-helix	trans	-64.3	-40	175.2	62.6	0	0	0	0	111.6	L17 D18 V24 Y25	L17-S21 PolarHBondContact O-N 3.19Å; L17-S21 PolarHBondContact O-OG 2.95Å; D18-S21 WeakPolarHBondContact CA-OG 3.5Å; D18-S21 PolarHBondContact O-OG 3.48Å; S21-V24 PolarHBondContact O-N 3.36Å; S21-Y25 PolarHBondContact O-N 2.88Å
22	S	92.6	Very high	88.5	Confident	50 Å²	50	99.8 Å²	99.8	35%	0.35	50%	0.501	S	S	.	.	H	α-helix	trans	-63.4	-40.6	175.1	-63	0	0	0	0	112.4	D18 L19 N20 Y25 I26	D18-S22 WeakPolarHBondContact O-CB 3.23Å; D18-S22 PolarHBondContact O-N 2.95Å; D18-S22 PolarHBondContact O-OG 2.87Å; L19-S22 WeakPolarHBondContact O-CB 3.43Å; L19-S22 PolarHBondContact O-N 3.48Å; N20-S22 VanDerWaalsContact C-N 3.34Å; S22-Y25 PolarHBondContact O-N 3.28Å; S22-I26 VanDerWaalsContact O-CG1 3.29Å; S22-I26 WeakPolarHBondContact O-CG1 3.38Å; S22-I26 PolarHBondContact O-N 3.03Å
23	I	93	Very high	89.2	Confident	92 Å²	92	100.1 Å²	100.1	47%	0.472	50%	0.502	S	S	.	.	H	α-helix	trans	-62.9	-44.9	176.3	-71.6	165	0	0	0	110.9	L19 N20 Y25 I26 H27	L19-I23 HydrophobicContact CD2-CD1 4.23Å; L19-I23 HydrophobicContact CG-CD1 4.05Å; L19-I23 VanDerWaalsContact O-CG1 3.27Å; L19-I23 WeakPolarHBondContact O-CG1 3.46Å; L19-I23 PolarHBondContact O-N 3.36Å; N20-I23 PolarHBondContact O-N 3.01Å; I23-Y25 VanDerWaalsContact C-N 3.33Å; I23-Y25 PolarHBondContact O-N 3.37Å; I23-I26 PolarHBondContact O-N 3.08Å; I23-H27 VanDerWaalsContact O-CB 3.31Å; I23-H27 WeakPolarHBondContact O-CB 3.3Å; I23-H27 PolarHBondContact O-N 2.91Å
24	V	92.7	Very high	90	Very high	85 Å²	85	99 Å²	99	52%	0.515	50%	0.499	S	S	.	.	H	α-helix	trans	-59.8	-45.9	176.7	172.7	0	0	0	0	110.4	N20 S21 I26 H27 D28	N20-V24 WeakPolarHBondContact O-CG2 3.42Å; N20-V24 PolarHBondContact O-N 3.35Å; N20-V24 VanDerWaalsContact O-N 3.08Å; S21-V24 PolarHBondContact O-N 3.36Å; V24-I26 PolarHBondContact O-N 3.3Å; V24-H27 PolarHBondContact O-N 3.43Å; V24-D28 PolarHBondContact O-N 3Å
25	Y	92.5	Very high	90.5	Very high	170 Å²	170	96 Å²	96	67%	0.667	49%	0.491	S	S	*	.	H	α-helix	trans	-60.3	-46.6	177.4	179.7	-99	0	0	0	112.9	S21 S22 I23 H27 D28 F29	S21-Y25 PolarHBondContact O-N 2.88Å; S22-Y25 PolarHBondContact O-N 3.28Å; I23-Y25 VanDerWaalsContact C-N 3.33Å; I23-Y25 PolarHBondContact O-N 3.37Å; Y25-H27 VanDerWaalsContact C-N 3.3Å; Y25-H27 PolarHBondContact O-N 2.92Å; Y25-D28 PolarHBondContact O-N 3.4Å; Y25-F29 WeakPolarHBondContact O-CB 3.34Å; Y25-F29 PolarHBondContact O-N 2.99Å
26	I	94.1	Very high	90.9	Very high	109 Å²	109	94.8 Å²	94.8	56%	0.559	49%	0.49	S	S	*	.	H	α-helix	trans	-63.7	-39.3	178.6	-69.2	166.3	0	0	0	110.8	S22 I23 V24 A30	S22-I26 VanDerWaalsContact O-CG1 3.29Å; S22-I26 WeakPolarHBondContact O-CG1 3.38Å; S22-I26 PolarHBondContact O-N 3.03Å; I23-I26 PolarHBondContact O-N 3.08Å; V24-I26 PolarHBondContact O-N 3.3Å; I26-A30 VanDerWaalsContact O-CB 3.31Å; I26-A30 WeakPolarHBondContact O-CB 3.43Å; I26-A30 PolarHBondContact O-N 3.47Å
27	H	93.5	Very high	91.1	Very high	120 Å²	120	95.3 Å²	95.3	56%	0.556	50%	0.496	S	S	*	.	H	α-helix	trans	-63.1	-46.1	177.1	176.3	-85.9	0	0	0	111.7	I23 V24 Y25 A30 K31	I23-H27 VanDerWaalsContact O-CB 3.31Å; I23-H27 WeakPolarHBondContact O-CB 3.3Å; I23-H27 PolarHBondContact O-N 2.91Å; V24-H27 PolarHBondContact O-N 3.43Å; Y25-H27 VanDerWaalsContact C-N 3.3Å; Y25-H27 PolarHBondContact O-N 2.92Å; H27-A30 PolarHBondContact O-N 2.9Å; H27-K31 WeakPolarHBondContact O-CB 3.23Å; H27-K31 PolarHBondContact O-N 3.33Å
28	D	94.5	Very high	91.1	Very high	81 Å²	81	97.2 Å²	97.2	43%	0.433	50%	0.502	S	S	.	.	H	α-helix	trans	-64.4	-44.6	178.2	-71	-13.8	0	0	0	111.3	V24 Y25 A30 K31 D32	V24-D28 PolarHBondContact O-N 3Å; Y25-D28 PolarHBondContact O-N 3.4Å; D28-A30 PolarHBondContact O-N 2.95Å; D28-K31 WeakPolarHBondContact O-CB 3.49Å; D28-K31 PolarHBondContact O-N 3.49Å; D28-D32 PolarHBondContact O-N 3.35Å
29	F	94.2	Very high	90.8	Very high	121 Å²	121	97.4 Å²	97.4	53%	0.531	51%	0.511	S	S	.	.	H	α-helix	trans	-58.7	-44.4	174	175	-99.9	0	0	0	112.7	Y25 K31 D32 L33	Y25-F29 WeakPolarHBondContact O-CB 3.34Å; Y25-F29 PolarHBondContact O-N 2.99Å; F29-K31 VanDerWaalsContact C-N 3.3Å; F29-K31 PolarHBondContact O-N 2.95Å; F29-D32 PolarHBondContact O-N 3.33Å; F29-L33 WeakPolarHBondContact O-CB 3.45Å; F29-L33 PolarHBondContact O-N 3.18Å
30	A	94.7	Very high	89.7	Confident	40 Å²	40	104.6 Å²	104.6	33%	0.331	54%	0.54	S	S	.	.	H	α-helix	trans	-64.6	-37.1	178.4	0	0	0	0	0	111.9	I26 H27 D28 L33 I34	I26-A30 VanDerWaalsContact O-CB 3.31Å; I26-A30 WeakPolarHBondContact O-CB 3.43Å; I26-A30 PolarHBondContact O-N 3.47Å; H27-A30 PolarHBondContact O-N 2.9Å; D28-A30 PolarHBondContact O-N 2.95Å; A30-L33 PolarHBondContact O-N 2.88Å; A30-I34 VanDerWaalsContact O-CG1 3.28Å; A30-I34 WeakPolarHBondContact O-CG1 3.44Å; A30-I34 PolarHBondContact O-N 2.98Å; A30-I34 VanDerWaalsContact O-N 3.09Å
31	K	93.7	Very high	89.8	Confident	110 Å²	110	105.1 Å²	105.1	48%	0.478	54%	0.541	S	S	.	.	H	α-helix	trans	-64.7	-48.4	176	-176	-174.5	170.8	-168.4	0	111.2	H27 D28 F29 L33 I34 Q35	H27-K31 WeakPolarHBondContact O-CB 3.23Å; H27-K31 PolarHBondContact O-N 3.33Å; D28-K31 WeakPolarHBondContact O-CB 3.49Å; D28-K31 PolarHBondContact O-N 3.49Å; F29-K31 VanDerWaalsContact C-N 3.3Å; F29-K31 PolarHBondContact O-N 2.95Å; K31-L33 VanDerWaalsContact C-N 3.28Å; K31-L33 PolarHBondContact O-N 3.39Å; K31-I34 PolarHBondContact O-N 3.46Å; K31-Q35 WeakPolarHBondContact O-CG 3.34Å; K31-Q35 PolarHBondContact O-N 3.41Å
32	D	93.7	Very high	89.7	Confident	92 Å²	92	107.2 Å²	107.2	49%	0.492	55%	0.546	S	S	.	.	H	α-helix	trans	-57.8	-43.7	177.3	-70.3	-14.3	0	0	0	110.8	D28 F29 I34 Q35 D36	D28-D32 PolarHBondContact O-N 3.35Å; F29-D32 PolarHBondContact O-N 3.33Å; D32-I34 PolarHBondContact O-N 3.47Å; D32-Q35 PolarHBondContact O-N 3.22Å; D32-D36 WeakPolarHBondContact O-CB 3.47Å; D32-D36 PolarHBondContact O-N 3.13Å
33	L	92.6	Very high	89.6	Confident	96 Å²	96	110.4 Å²	110.4	50%	0.503	56%	0.557	S	S	.	*	H	α-helix	trans	-61	-42.4	177.6	-175.4	67.9	0	0	0	112.9	F29 A30 K31 T37	F29-L33 WeakPolarHBondContact O-CB 3.45Å; F29-L33 PolarHBondContact O-N 3.18Å; A30-L33 PolarHBondContact O-N 2.88Å; K31-L33 VanDerWaalsContact C-N 3.28Å; K31-L33 PolarHBondContact O-N 3.39Å; L33-T37 WeakPolarHBondContact O-CB 3.34Å; L33-T37 PolarHBondContact O-N 3.02Å; L33-T37 VanDerWaalsContact O-N 3.07Å; L33-T37 PolarHBondContact O-OG1 3.1Å
34	I	93.2	Very high	89.4	Confident	97 Å²	97	111.5 Å²	111.5	50%	0.497	56%	0.562	S	S	.	*	H	α-helix	trans	-67.8	-41.9	178.3	-68.5	165.4	0	0	0	110.4	A30 K31 D32 T37 Q38	A30-I34 VanDerWaalsContact O-CG1 3.28Å; A30-I34 WeakPolarHBondContact O-CG1 3.44Å; A30-I34 PolarHBondContact O-N 2.98Å; A30-I34 VanDerWaalsContact O-N 3.09Å; K31-I34 PolarHBondContact O-N 3.46Å; D32-I34 PolarHBondContact O-N 3.47Å; I34-T37 PolarHBondContact O-N 3.23Å; I34-Q38 WeakPolarHBondContact O-CG 3.1Å; I34-Q38 PolarHBondContact O-N 3.35Å
35	Q	88.5	Confident	89.2	Confident	92 Å²	92	113.1 Å²	113.1	43%	0.43	57%	0.565	S	S	.	*	H	α-helix	trans	-66.5	-40.7	179.1	-69.4	-174.1	-70.9	0	0	112.1	K31 D32 T37 Q38 S39	K31-Q35 WeakPolarHBondContact O-CG 3.34Å; K31-Q35 PolarHBondContact O-N 3.41Å; D32-Q35 PolarHBondContact O-N 3.22Å; Q35-T37 VanDerWaalsContact C-N 3.28Å; Q35-T37 PolarHBondContact O-N 2.97Å; Q35-Q38 PolarHBondContact O-N 2.93Å; Q35-S39 WeakPolarHBondContact O-CB 3.27Å; Q35-S39 PolarHBondContact O-N 3Å; Q35-S39 PolarHBondContact O-OG 2.88Å
36	D	87.8	Confident	89	Confident	102 Å²	102	109.3 Å²	109.3	55%	0.545	56%	0.558	S	S	.	*	H	α-helix	trans	-63.4	-35.3	173.5	-86.9	6.4	0	0	0	112.2	D32	D32-D36 WeakPolarHBondContact O-CB 3.47Å; D32-D36 PolarHBondContact O-N 3.13Å
37	T	87.1	Confident	88.6	Confident	91 Å²	91	109.4 Å²	109.4	56%	0.558	56%	0.558	S	S	*	*	H	α-helix	trans	-73	-34.3	177.5	-55.9	0	0	0	0	111.9	L33 I34 Q35	L33-T37 WeakPolarHBondContact O-CB 3.34Å; L33-T37 PolarHBondContact O-N 3.02Å; L33-T37 VanDerWaalsContact O-N 3.07Å; L33-T37 PolarHBondContact O-OG1 3.1Å; I34-T37 PolarHBondContact O-N 3.23Å; Q35-T37 VanDerWaalsContact C-N 3.28Å; Q35-T37 PolarHBondContact O-N 2.97Å
38	Q	82.5	Confident	88.2	Confident	154 Å²	154	108.5 Å²	108.5	72%	0.72	56%	0.558	S	S	*	*	H	α-helix	trans	-79.3	-19.7	176.7	-71.4	-179.1	-8.7	0	0	113.7	I34 Q35 K40	I34-Q38 WeakPolarHBondContact O-CG 3.1Å; I34-Q38 PolarHBondContact O-N 3.35Å; Q35-Q38 PolarHBondContact O-N 2.93Å; Q38-K40 VanDerWaalsContact C-N 3.34Å
39	S	79.2	Confident	87.7	Confident	105 Å²	105	110.8 Å²	110.8	73%	0.734	57%	0.568	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.4	-2.4	178.8	-56.6	0	0	0	0	113.4	Q35	Q35-S39 WeakPolarHBondContact O-CB 3.27Å; Q35-S39 PolarHBondContact O-N 3Å; Q35-S39 PolarHBondContact O-OG 2.88Å
40	K	65.1	Low	87.1	Confident	230 Å²	230	109.9 Å²	109.9	100%	1	57%	0.572	S	S	*	*			trans	-108.6	0	176.6	-74.3	177.4	179.7	171.1	0	110.7	Q38	Q38-K40 VanDerWaalsContact C-N 3.34Å

Retrieved 40 of 40 residues in 43 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).