G4VBT3_SCHMA Loading...

Secreted protein

AlphaFold DB , UniProt , Accession G4VBT3, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 93 aa.

						>G4VBT3_SCHMA|G4VBT3
MVPQGGCGVNEINMLLLRLFAHKSQTSTSRWTTHKSSSTTFDTRNDYNSNLSITVSLHHTNSQHDGRVSPFIAKVAHIGSQPTLPWALLSGCF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	30.6	Very low	38	Very low	240 Å²	240	118.5 Å²	118.5	100%	1.182	74%	0.737	S	S	*	*				0	102.9	0	-77.7	153.8	73.6	0	0	107.5
2	V	31.8	Very low	39.4	Very low	129 Å²	129	111.1 Å²	111.1	78%	0.782	69%	0.688	S	S	*	*			trans	-117.9	114.2	170.2	-171.2	0	0	0	0	105.5	Q4	V2-Q4 PolarHBondContact O-N 3Å
3	P	35.4	Very low	40.1	Very low	121 Å²	121	107.2 Å²	107.2	79%	0.786	66%	0.66	S	S	*	*			trans	-70.6	103.3	-179.4	23.8	-24.1	0	0	0	108.2	G5	P3-G5 PolarHBondContact O-N 3.04Å
4	Q	32	Very low	41	Very low	193 Å²	193	105.1 Å²	105.1	90%	0.902	64%	0.641	S	S	*	*			trans	-75.4	52.3	165.8	-67	177.3	-29	0	0	109.2	V2 G6	V2-Q4 PolarHBondContact O-N 3Å; Q4-G6 PolarHBondContact O-N 3.24Å
5	G	31.4	Very low	41.8	Very low	69 Å²	69	102.9 Å²	102.9	71%	0.711	62%	0.623	S	S	*	*			trans	-87.7	50.6	167.5	0	0	0	0	0	109.1	P3 C7	P3-G5 PolarHBondContact O-N 3.04Å; G5-C7 PolarHBondContact O-N 2.92Å
6	G	31.9	Very low	42.7	Very low	71 Å²	71	100.7 Å²	100.7	73%	0.732	61%	0.606	S	S	*	*			trans	-62.2	109.6	170.3	0	0	0	0	0	106.4	Q4 G8	Q4-G6 PolarHBondContact O-N 3.24Å; G6-G8 PolarHBondContact O-N 3.37Å
7	C	38	Very low	43.5	Very low	107 Å²	107	101.8 Å²	101.8	72%	0.723	61%	0.607	S	S	*	*			trans	-56.3	85.8	176.2	-176.6	0	0	0	0	108.2	G5 V9	G5-C7 PolarHBondContact O-N 2.92Å; C7-V9 PolarHBondContact O-N 3.41Å
8	G	39.9	Very low	43.9	Very low	65 Å²	65	102.7 Å²	102.7	67%	0.67	60%	0.598	S	S	*	*			trans	-65.8	91.4	172.3	0	0	0	0	0	105.6	G6 N10	G6-G8 PolarHBondContact O-N 3.37Å; G8-N10 PolarHBondContact O-N 3.31Å
9	V	47.5	Very low	44.4	Very low	98 Å²	98	100.5 Å²	100.5	59%	0.594	58%	0.584	S	S	*	*			trans	-52	95.9	152	-76.7	0	0	0	0	104.5	C7 E11 M14	C7-V9 PolarHBondContact O-N 3.41Å; V9-E11 PolarHBondContact O-N 2.93Å; V9-M14 HydrophobicContact CG2-CG 4.41Å
10	N	50.7	Low	44.9	Very low	62 Å²	62	101.7 Å²	101.7	33%	0.332	58%	0.582	S	S	.	*			trans	-52.3	137.8	-174.7	56.2	3.7	0	0	0	106.6	G8 I12 N13 M14	G8-N10 PolarHBondContact O-N 3.31Å; N10-I12 CarbonylContact O-C 3.51Å; N10-I12 PolarHBondContact O-N 2.65Å; N10-N13 PolarHBondContact O-N 2.81Å; N10-N13 WeakPolarHBondContact OD1-CA 3.2Å; N10-N13 WeakPolarHBondContact OD1-CB 3.45Å; N10-N13 PolarHBondContact OD1-N 2.68Å; N10-N13 PolarHBondContact OD1-ND2 2.9Å; N10-N13 VanDerWaalsContact OD1-ND2 3.1Å; N10-N13 PolarHBondContact OD1-OD1 3Å; N10-M14 PolarHBondContact O-N 2.85Å; N10-M14 VanDerWaalsContact O-N 3.15Å
11	E	48.6	Very low	45.1	Very low	149 Å²	149	99.2 Å²	99.2	70%	0.696	57%	0.574	S	S	*	*	H	α-helix	trans	-52.9	-25.5	-177.5	-63.4	172.9	139.7	0	0	111	V9 M14 L15	V9-E11 PolarHBondContact O-N 2.93Å; E11-M14 PolarHBondContact O-N 3.31Å; E11-L15 WeakPolarHBondContact O-CB 3.32Å; E11-L15 PolarHBondContact O-N 2.97Å
12	I	54.4	Low	45.8	Very low	29 Å²	29	92.6 Å²	92.6	15%	0.149	54%	0.539	C	S	.	.	H	α-helix	trans	-60.2	-52.9	170.2	-51.4	179.4	0	0	0	112.8	N10 M14 L15 L16 L57	N10-I12 CarbonylContact O-C 3.51Å; N10-I12 PolarHBondContact O-N 2.65Å; I12-M14 PolarHBondContact O-N 2.97Å; I12-L15 PolarHBondContact O-N 3.26Å; I12-L16 WeakPolarHBondContact O-CB 3.4Å; I12-L16 PolarHBondContact O-N 2.83Å; I12-L57 HydrophobicContact CD1-CD1 3.7Å; I12-L57 HydrophobicContact CD1-CD2 3.99Å; I12-L57 HydrophobicContact CD1-CG 4.48Å; I12-L57 HydrophobicContact CG1-CD1 3.66Å; I12-L57 HydrophobicContact CG1-CD2 3.65Å; I12-L57 HydrophobicContact CG1-CG 4.32Å
13	N	48.4	Very low	46.4	Very low	61 Å²	61	94.2 Å²	94.2	33%	0.326	54%	0.536	S	S	.	.	H	α-helix	trans	-64.4	-35.4	177.4	-73.9	-7.2	0	0	0	110.2	N10 L16 L17	N10-N13 PolarHBondContact O-N 2.81Å; N10-N13 WeakPolarHBondContact OD1-CA 3.2Å; N10-N13 WeakPolarHBondContact OD1-CB 3.45Å; N10-N13 PolarHBondContact OD1-N 2.68Å; N10-N13 PolarHBondContact OD1-ND2 2.9Å; N10-N13 VanDerWaalsContact OD1-ND2 3.1Å; N10-N13 PolarHBondContact OD1-OD1 3Å; N13-L16 PolarHBondContact O-N 3.09Å; N13-L17 WeakPolarHBondContact O-CA 3.26Å; N13-L17 WeakPolarHBondContact O-CB 3.35Å; N13-L17 PolarHBondContact O-N 3.42Å
14	M	53.4	Low	46.8	Very low	78 Å²	78	93.2 Å²	93.2	38%	0.384	53%	0.532	S	S	.	.	H	α-helix	trans	-64.4	-43.9	174	-96.2	-95.4	-81.6	0	0	111.9	V9 N10 E11 I12 R18	V9-M14 HydrophobicContact CG2-CG 4.41Å; N10-M14 PolarHBondContact O-N 2.85Å; N10-M14 VanDerWaalsContact O-N 3.15Å; E11-M14 PolarHBondContact O-N 3.31Å; I12-M14 PolarHBondContact O-N 2.97Å; M14-R18 VanDerWaalsContact O-CB 3.26Å; M14-R18 WeakPolarHBondContact O-CB 3.15Å; M14-R18 WeakPolarHBondContact O-CG 2.89Å; M14-R18 PolarHBondContact O-N 3.21Å
15	L	53.1	Low	47	Very low	72 Å²	72	90.7 Å²	90.7	38%	0.377	52%	0.52	S	S	.	.	H	α-helix	trans	-64.1	-47.1	174.2	-101.2	151.7	0	0	0	111.4	E11 I12 L17 R18 L19	E11-L15 WeakPolarHBondContact O-CB 3.32Å; E11-L15 PolarHBondContact O-N 2.97Å; I12-L15 PolarHBondContact O-N 3.26Å; L15-L17 PolarHBondContact O-N 2.83Å; L15-R18 PolarHBondContact O-N 3.17Å; L15-L19 WeakPolarHBondContact O-CB 3.48Å; L15-L19 VanDerWaalsContact O-CG 3.23Å; L15-L19 WeakPolarHBondContact O-CG 3.41Å; L15-L19 PolarHBondContact O-N 3.1Å
16	L	56	Low	47.4	Very low	67 Å²	67	94.2 Å²	94.2	35%	0.351	53%	0.528	S	S	.	.	H	α-helix	trans	-61.7	-45.3	177.7	-124.9	86.4	0	0	0	111	I12 N13 L19 F20 A76	I12-L16 WeakPolarHBondContact O-CB 3.4Å; I12-L16 PolarHBondContact O-N 2.83Å; N13-L16 PolarHBondContact O-N 3.09Å; L16-L19 PolarHBondContact O-N 3.14Å; L16-F20 WeakPolarHBondContact O-CB 3.12Å; L16-F20 PolarHBondContact O-N 2.9Å; L16-A76 HydrophobicContact CD1-CB 4.44Å
17	L	55.5	Low	47.5	Very low	120 Å²	120	94.7 Å²	94.7	63%	0.628	52%	0.52	S	S	*	.	H	α-helix	trans	-64.2	-42.5	178.1	-176.9	66.3	0	0	0	110.8	N13 L15 L19 F20 A21	N13-L17 WeakPolarHBondContact O-CA 3.26Å; N13-L17 WeakPolarHBondContact O-CB 3.35Å; N13-L17 PolarHBondContact O-N 3.42Å; L15-L17 PolarHBondContact O-N 2.83Å; L17-L19 VanDerWaalsContact C-N 3.33Å; L17-L19 PolarHBondContact O-N 2.73Å; L17-F20 PolarHBondContact O-N 2.84Å; L17-A21 VanDerWaalsContact O-CB 3.3Å; L17-A21 WeakPolarHBondContact O-CB 3.3Å; L17-A21 PolarHBondContact O-N 2.82Å
18	R	51.8	Low	47.3	Very low	117 Å²	117	96.1 Å²	96.1	44%	0.442	53%	0.526	S	S	.	.	H	α-helix	trans	-63.7	-39.1	175.1	-75.1	173.4	-173.9	-153.3	2.6	111.7	M14 L15 A21 H22 W31	M14-R18 VanDerWaalsContact O-CB 3.26Å; M14-R18 WeakPolarHBondContact O-CB 3.15Å; M14-R18 WeakPolarHBondContact O-CG 2.89Å; M14-R18 PolarHBondContact O-N 3.21Å; L15-R18 PolarHBondContact O-N 3.17Å; R18-A21 PolarHBondContact O-N 3.49Å; R18-H22 VanDerWaalsContact O-CB 3.28Å; R18-H22 WeakPolarHBondContact O-CB 3.03Å; R18-H22 PolarHBondContact O-N 3.41Å; R18-W31 HydrophobicContact CB-CH2 4.05Å; R18-W31 HydrophobicContact CG-CH2 4.46Å
19	L	53.4	Low	47	Very low	62 Å²	62	97.3 Å²	97.3	33%	0.325	52%	0.524	S	S	.	.	H	α-helix	trans	-66.3	-40.8	173.8	-71.9	166.9	0	0	0	111.4	L15 L16 L17 H22 K23 I53	L15-L19 WeakPolarHBondContact O-CB 3.48Å; L15-L19 VanDerWaalsContact O-CG 3.23Å; L15-L19 WeakPolarHBondContact O-CG 3.41Å; L15-L19 PolarHBondContact O-N 3.1Å; L16-L19 PolarHBondContact O-N 3.14Å; L17-L19 VanDerWaalsContact C-N 3.33Å; L17-L19 PolarHBondContact O-N 2.73Å; L19-H22 PolarHBondContact O-N 3.41Å; L19-K23 PolarHBondContact O-N 2.87Å; L19-I53 HydrophobicContact CD1-CD1 4.13Å; L19-I53 HydrophobicContact CD2-CD1 4.49Å
20	F	53.3	Low	46.2	Very low	124 Å²	124	103.4 Å²	103.4	54%	0.544	54%	0.536	S	S	.	.	H	α-helix	trans	-65	-42.9	176.5	-138.5	-85.7	0	0	0	111.4	L16 L17 H22 K23 S24 P82	L16-F20 WeakPolarHBondContact O-CB 3.12Å; L16-F20 PolarHBondContact O-N 2.9Å; L17-F20 PolarHBondContact O-N 2.84Å; F20-H22 VanDerWaalsContact C-N 3.35Å; F20-K23 WeakPolarHBondContact O-CB 3.4Å; F20-K23 PolarHBondContact O-N 3.15Å; F20-S24 PolarHBondContact O-N 3.23Å; F20-P82 HydrophobicContact CE2-CG 4.36Å; F20-P82 HydrophobicContact CZ-CG 4.35Å
21	A	50	Low	45.6	Very low	50 Å²	50	107.4 Å²	107.4	41%	0.413	55%	0.547	S	S	.	.	H	α-helix	trans	-64.5	-38.7	174.1	0	0	0	0	0	111.6	L17 R18 K23 S24 Q25	L17-A21 VanDerWaalsContact O-CB 3.3Å; L17-A21 WeakPolarHBondContact O-CB 3.3Å; L17-A21 PolarHBondContact O-N 2.82Å; R18-A21 PolarHBondContact O-N 3.49Å; A21-K23 VanDerWaalsContact C-N 3.3Å; A21-K23 PolarHBondContact O-N 3.24Å; A21-S24 CarbonylContact O-C 3.55Å; A21-S24 WeakPolarHBondContact O-CA 3.38Å; A21-S24 WeakPolarHBondContact O-CB 3.38Å; A21-S24 PolarHBondContact O-N 2.78Å; A21-Q25 PolarHBondContact O-N 2.86Å
22	H	45.1	Very low	44.7	Very low	100 Å²	100	106.1 Å²	106.1	46%	0.463	55%	0.549	S	S	.	.	H	α-helix	trans	-65.3	-31.7	175.9	-167.9	-86.6	0	0	0	112.4	R18 L19 F20 S24 Q25	R18-H22 VanDerWaalsContact O-CB 3.28Å; R18-H22 WeakPolarHBondContact O-CB 3.03Å; R18-H22 PolarHBondContact O-N 3.41Å; L19-H22 PolarHBondContact O-N 3.41Å; F20-H22 VanDerWaalsContact C-N 3.35Å; H22-S24 PolarHBondContact O-N 3.09Å; H22-Q25 CarbonylContact O-C 3.58Å; H22-Q25 PolarHBondContact O-N 3.11Å; H22-Q25 VanDerWaalsContact O-O 3.12Å
23	K	44.3	Very low	43.8	Very low	163 Å²	163	109.4 Å²	109.4	71%	0.709	57%	0.571	S	S	*	*	H	α-helix	trans	-65.5	-31.3	169.4	-164.5	-173.9	177.8	-166.3	0	111.8	L19 F20 A21	L19-K23 PolarHBondContact O-N 2.87Å; F20-K23 WeakPolarHBondContact O-CB 3.4Å; F20-K23 PolarHBondContact O-N 3.15Å; A21-K23 VanDerWaalsContact C-N 3.3Å; A21-K23 PolarHBondContact O-N 3.24Å
24	S	44.6	Very low	42.9	Very low	101 Å²	101	114.4 Å²	114.4	71%	0.706	59%	0.592	S	S	*	*	H	α-helix	trans	-82.2	-19.1	-179.9	-168.2	0	0	0	0	114	F20 A21 H22	F20-S24 PolarHBondContact O-N 3.23Å; A21-S24 CarbonylContact O-C 3.55Å; A21-S24 WeakPolarHBondContact O-CA 3.38Å; A21-S24 WeakPolarHBondContact O-CB 3.38Å; A21-S24 PolarHBondContact O-N 2.78Å; H22-S24 PolarHBondContact O-N 3.09Å
25	Q	36.1	Very low	41.9	Very low	139 Å²	139	121.2 Å²	121.2	65%	0.65	62%	0.62	S	S	*	*			trans	-132.3	103.5	-179.2	-74.2	-179	-11.4	0	0	109.9	A21 H22 S27	A21-Q25 PolarHBondContact O-N 2.86Å; H22-Q25 CarbonylContact O-C 3.58Å; H22-Q25 PolarHBondContact O-N 3.11Å; H22-Q25 VanDerWaalsContact O-O 3.12Å; Q25-S27 PolarHBondContact O-N 3.24Å
26	T	39.8	Very low	41.1	Very low	143 Å²	143	123 Å²	123	88%	0.877	64%	0.638	S	S	*	*			trans	-65	53.7	170.4	38.9	0	0	0	0	112.3
27	S	32.9	Very low	40	Very low	81 Å²	81	125.4 Å²	125.4	57%	0.566	66%	0.66	S	S	*	*			trans	-140.9	89.4	-177.8	-63.5	0	0	0	0	111.4	Q25 S29	Q25-S27 PolarHBondContact O-N 3.24Å; S27-S29 PolarHBondContact O-N 3.17Å; S27-S29 VanDerWaalsContact O-N 3.09Å
28	T	34.4	Very low	39	Very low	137 Å²	137	124.9 Å²	124.9	84%	0.84	67%	0.667	S	S	*	*			trans	15.9	80.7	144.4	15.1	0	0	0	0	116.5
29	S	34.6	Very low	38.3	Very low	91 Å²	91	125.4 Å²	125.4	64%	0.636	68%	0.683	S	S	*	*			trans	-94.8	103.3	158.3	-103	0	0	0	0	109.4	S27 W31	S27-S29 PolarHBondContact O-N 3.17Å; S27-S29 VanDerWaalsContact O-N 3.09Å; S29-W31 VanDerWaalsContact C-N 3.32Å; S29-W31 PolarHBondContact O-N 3.28Å
30	R	30.1	Very low	37.4	Very low	225 Å²	225	128.5 Å²	128.5	85%	0.849	71%	0.705	S	S	*	*			trans	-63.2	90.4	170.6	-83.7	168.9	61.2	121.6	-5.3	109.1	T32	R30-T32 PolarHBondContact O-N 3.25Å; R30-T32 VanDerWaalsContact O-N 3.09Å
31	W	38.7	Very low	36.7	Very low	147 Å²	147	129 Å²	129	56%	0.557	71%	0.707	S	S	*	*			trans	-73.5	96.5	170.9	-119.2	-53.9	0	0	0	109.3	R18 S29 T33	R18-W31 HydrophobicContact CB-CH2 4.05Å; R18-W31 HydrophobicContact CG-CH2 4.46Å; S29-W31 VanDerWaalsContact C-N 3.32Å; S29-W31 PolarHBondContact O-N 3.28Å; W31-T33 VanDerWaalsContact C-N 3.25Å; W31-T33 PolarHBondContact O-N 2.79Å; W31-T33 VanDerWaalsContact O-N 3.14Å
32	T	29.5	Very low	35.9	Very low	121 Å²	121	132.2 Å²	132.2	74%	0.742	72%	0.717	S	S	*	*			trans	-82.3	75.1	165.7	54.9	0	0	0	0	108.8	R30	R30-T32 PolarHBondContact O-N 3.25Å; R30-T32 VanDerWaalsContact O-N 3.09Å
33	T	34	Very low	35.7	Very low	98 Å²	98	133 Å²	133	60%	0.601	73%	0.729	S	S	*	*			trans	-122.4	98	167	-52.5	0	0	0	0	109	W31	W31-T33 VanDerWaalsContact C-N 3.25Å; W31-T33 PolarHBondContact O-N 2.79Å; W31-T33 VanDerWaalsContact O-N 3.14Å
34	H	30.2	Very low	35.2	Very low	167 Å²	167	135.2 Å²	135.2	77%	0.773	73%	0.733	S	S	*	*	S	Bend	trans	44.2	81.8	149.7	-67.9	-129.5	0	0	0	116	S36	H34-S36 VanDerWaalsContact C-N 3.29Å; H34-S36 PolarHBondContact O-N 3.5Å; H34-S36 PolarHBondContact O-OG 3.49Å
35	K	32.4	Very low	34.9	Very low	221 Å²	221	136.3 Å²	136.3	96%	0.961	73%	0.731	S	S	*	*			trans	33.5	52.4	145.4	-134.7	-177.4	-168.3	-171.7	0	115.7
36	S	36.4	Very low	34.9	Very low	109 Å²	109	136.2 Å²	136.2	76%	0.762	74%	0.735	S	S	*	*	S	Bend	trans	-121.8	108.4	163.3	-62.9	0	0	0	0	106.4	H34 S38	H34-S36 VanDerWaalsContact C-N 3.29Å; H34-S36 PolarHBondContact O-N 3.5Å; H34-S36 PolarHBondContact O-OG 3.49Å; S36-S38 PolarHBondContact O-N 2.76Å
37	S	33.2	Very low	35.1	Very low	117 Å²	117	140 Å²	140	82%	0.818	74%	0.735	S	S	*	*			trans	-6.4	101.8	-180	-59.1	0	0	0	0	115.6	T39	S37-T39 PolarHBondContact O-N 2.81Å; S37-T39 VanDerWaalsContact O-N 3.11Å
38	S	34.6	Very low	35.6	Very low	109 Å²	109	142.3 Å²	142.3	76%	0.762	74%	0.741	S	S	*	*			trans	-66	104.2	169.4	169	0	0	0	0	109.1	S36 T40	S36-S38 PolarHBondContact O-N 2.76Å; S38-T40 PolarHBondContact O-N 3.49Å
39	T	36.2	Very low	36.1	Very low	129 Å²	129	139.4 Å²	139.4	79%	0.791	73%	0.726	S	S	*	*			trans	-86.4	102.9	165.4	50.8	0	0	0	0	108.2	S37 F41	S37-T39 PolarHBondContact O-N 2.81Å; S37-T39 VanDerWaalsContact O-N 3.11Å; T39-F41 PolarHBondContact O-N 3.28Å
40	T	34.4	Very low	36.5	Very low	127 Å²	127	139.8 Å²	139.8	78%	0.779	72%	0.721	S	S	*	*			trans	-69.1	110.9	172.5	-45.1	0	0	0	0	108	S38 D42	S38-T40 PolarHBondContact O-N 3.49Å; T40-D42 PolarHBondContact O-N 2.85Å
41	F	39.1	Very low	37.2	Very low	134 Å²	134	132 Å²	132	59%	0.588	70%	0.696	S	S	*	*			trans	-82.5	96.1	177.2	-156.8	-98	0	0	0	108.7	T39 T43 L51	T39-F41 PolarHBondContact O-N 3.28Å; F41-T43 HydrophobicContact CD1-CG2 4.12Å; F41-T43 HydrophobicContact CE1-CG2 4.35Å; F41-T43 PolarHBondContact O-N 2.77Å; F41-T43 VanDerWaalsContact O-N 3.13Å; F41-L51 HydrophobicContact CE1-CD1 4.24Å; F41-L51 HydrophobicContact CE2-CD1 3.99Å; F41-L51 HydrophobicContact CZ-CD1 3.84Å
42	D	33.4	Very low	37.6	Very low	118 Å²	118	128.6 Å²	128.6	63%	0.631	70%	0.695	S	S	*	*			trans	-69.8	104.2	175.8	-159.5	-22.9	0	0	0	108.6	T40 R44	T40-D42 PolarHBondContact O-N 2.85Å; D42-R44 PolarHBondContact O-N 2.94Å
43	T	41.2	Very low	38.5	Very low	116 Å²	116	125 Å²	125	71%	0.712	67%	0.67	S	S	*	*			trans	-80.6	51.8	179.7	14.2	0	0	0	0	110.1	F41 N45	F41-T43 HydrophobicContact CD1-CG2 4.12Å; F41-T43 HydrophobicContact CE1-CG2 4.35Å; F41-T43 PolarHBondContact O-N 2.77Å; F41-T43 VanDerWaalsContact O-N 3.13Å; T43-N45 VanDerWaalsContact C-N 3.33Å; T43-N45 PolarHBondContact O-N 3.29Å; T43-N45 VanDerWaalsContact O-N 3.09Å
44	R	34.4	Very low	39.2	Very low	209 Å²	209	124.7 Å²	124.7	79%	0.789	67%	0.668	S	S	*	*			trans	-79.8	89	165.7	-87.5	-178.6	179	179.6	1.9	109.3	D42 D46	D42-R44 PolarHBondContact O-N 2.94Å; R44-D46 PolarHBondContact O-N 3.41Å
45	N	36.5	Very low	40	Very low	124 Å²	124	118.6 Å²	118.6	66%	0.663	64%	0.643	S	S	*	*	S	Bend	trans	54.1	56.8	135.9	-161.2	51.7	0	0	0	117.3	T43 Y47	T43-N45 VanDerWaalsContact C-N 3.33Å; T43-N45 PolarHBondContact O-N 3.29Å; T43-N45 VanDerWaalsContact O-N 3.09Å; N45-Y47 WeakPolarHBondContact OD1-CE2 3.28Å
46	D	38	Very low	40.5	Very low	137 Å²	137	112.5 Å²	112.5	73%	0.733	63%	0.628	S	S	*	*			trans	-122.4	113	149.7	-98	-44	0	0	0	108.5	R44 N48 S49	R44-D46 PolarHBondContact O-N 3.41Å; D46-N48 PolarHBondContact O-N 3.03Å; D46-S49 PolarHBondContact O-N 3.49Å
47	Y	43	Very low	40.9	Very low	223 Å²	223	109.7 Å²	109.7	88%	0.875	60%	0.604	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.4	21.3	-176.5	-91.3	-94.2	0	0	0	114.3	N45	N45-Y47 WeakPolarHBondContact OD1-CE2 3.28Å
48	N	43.1	Very low	41.3	Very low	129 Å²	129	111.7 Å²	111.7	69%	0.69	60%	0.6	S	S	*	*	T	Hydrogen-bonded Turn	trans	-145.3	44.9	177.9	-157.4	1.8	0	0	0	111.1	D46 N50	D46-N48 PolarHBondContact O-N 3.03Å; N48-N50 VanDerWaalsContact C-N 3.27Å; N48-N50 PolarHBondContact O-N 3.03Å; N48-N50 PolarHBondContact OD1-ND2 2.86Å
49	S	45.1	Very low	41.7	Very low	76 Å²	76	112.9 Å²	112.9	53%	0.531	59%	0.594	S	S	.	*			trans	-77.1	80.4	176	39.2	0	0	0	0	109.8	D46 L51	D46-S49 PolarHBondContact O-N 3.49Å; S49-L51 PolarHBondContact O-N 3.33Å
50	N	42.9	Very low	41.9	Very low	100 Å²	100	111.2 Å²	111.2	54%	0.535	58%	0.583	S	S	.	*			trans	-61.7	89.7	160.8	-75.5	-56.8	0	0	0	107.8	N48 S52 G79	N48-N50 VanDerWaalsContact C-N 3.27Å; N48-N50 PolarHBondContact O-N 3.03Å; N48-N50 PolarHBondContact OD1-ND2 2.86Å; N50-S52 PolarHBondContact O-N 2.77Å; N50-G79 VanDerWaalsContact OD1-CA 3.3Å; N50-G79 WeakPolarHBondContact OD1-CA 3.3Å
51	L	45.8	Very low	42.1	Very low	62 Å²	62	108.8 Å²	108.8	33%	0.325	57%	0.566	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-79	103.8	177.5	-177.3	65.3	0	0	0	107.7	F41 S49 I53 I78	F41-L51 HydrophobicContact CE1-CD1 4.24Å; F41-L51 HydrophobicContact CE2-CD1 3.99Å; F41-L51 HydrophobicContact CZ-CD1 3.84Å; S49-L51 PolarHBondContact O-N 3.33Å; L51-I53 HydrophobicContact CD2-CD1 4.07Å; L51-I53 HydrophobicContact CD2-CG1 4.29Å; L51-I53 HydrophobicContact CG-CD1 4.32Å; L51-I53 HydrophobicContact CG-CG1 3.98Å; L51-I78 HydrophobicContact CD2-CD1 4.48Å; L51-I78 PolarHBondContact O-N 2.79Å; L51-I78 VanDerWaalsContact O-N 3.16Å
52	S	47.2	Very low	42.2	Very low	75 Å²	75	107.3 Å²	107.3	52%	0.524	57%	0.572	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-91.8	121.5	168.3	55.2	0	0	0	0	109.2	N50	N50-S52 PolarHBondContact O-N 2.77Å
53	I	47.4	Very low	42.6	Very low	46 Å²	46	108.6 Å²	108.6	24%	0.236	57%	0.574	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-110.5	115.1	175	-53.4	177	0	0	0	107.1	L19 L51 V55 A76 I78	L19-I53 HydrophobicContact CD1-CD1 4.13Å; L19-I53 HydrophobicContact CD2-CD1 4.49Å; L51-I53 HydrophobicContact CD2-CD1 4.07Å; L51-I53 HydrophobicContact CD2-CG1 4.29Å; L51-I53 HydrophobicContact CG-CD1 4.32Å; L51-I53 HydrophobicContact CG-CG1 3.98Å; I53-V55 HydrophobicContact CG2-CG2 3.89Å; I53-A76 PolarHBondContact N-O 3.48Å; I53-A76 PolarHBondContact O-N 3.07Å; I53-I78 HydrophobicContact CD1-CD1 3.86Å; I53-I78 HydrophobicContact CG1-CD1 4.43Å
54	T	48.4	Very low	42.7	Very low	91 Å²	91	112.2 Å²	112.2	56%	0.558	58%	0.582	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-94.4	108.6	172.1	-57	0	0	0	0	108.3
55	V	46.6	Very low	43.3	Very low	39 Å²	39	108.7 Å²	108.7	24%	0.236	58%	0.579	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-99.7	119.6	173.5	-170.8	0	0	0	0	108.5	I53 L57	I53-V55 HydrophobicContact CG2-CG2 3.89Å; V55-L57 HydrophobicContact CG1-CD1 3.86Å
56	S	43.9	Very low	43.6	Very low	93 Å²	93	106.6 Å²	106.6	65%	0.65	59%	0.586	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-103.8	112.1	174.5	-63.2	0	0	0	0	109.2
57	L	45.4	Very low	43.7	Very low	50 Å²	50	110.4 Å²	110.4	26%	0.262	59%	0.591	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-90.3	113.7	173.2	-76	88.7	0	0	0	109.2	I12 V55 H59	I12-L57 HydrophobicContact CD1-CD1 3.7Å; I12-L57 HydrophobicContact CD1-CD2 3.99Å; I12-L57 HydrophobicContact CD1-CG 4.48Å; I12-L57 HydrophobicContact CG1-CD1 3.66Å; I12-L57 HydrophobicContact CG1-CD2 3.65Å; I12-L57 HydrophobicContact CG1-CG 4.32Å; V55-L57 HydrophobicContact CG1-CD1 3.86Å; L57-H59 PolarHBondContact O-N 3.19Å
58	H	41.6	Very low	43.7	Very low	158 Å²	158	106.3 Å²	106.3	73%	0.731	59%	0.588	S	S	*	*			trans	-82.8	95.1	167.4	-167.8	-101.3	0	0	0	108	T60	H58-T60 VanDerWaalsContact C-N 3.3Å; H58-T60 VanDerWaalsContact CE1-CG2 3.45Å; H58-T60 WeakPolarHBondContact CE1-CG2 3.42Å; H58-T60 WeakPolarHBondContact ND1-CG2 3.23Å; H58-T60 PolarHBondContact O-N 3.46Å
59	H	42.2	Very low	43.8	Very low	135 Å²	135	102.2 Å²	102.2	63%	0.625	57%	0.57	S	S	*	*			trans	-73.1	91.9	170	-147.1	126.4	0	0	0	106.9	L57 N61	L57-H59 PolarHBondContact O-N 3.19Å; H59-N61 PolarHBondContact O-N 3.23Å
60	T	39.5	Very low	43.7	Very low	93 Å²	93	103.6 Å²	103.6	57%	0.571	58%	0.577	S	S	*	*			trans	-68.3	82.2	164.9	49.4	0	0	0	0	107	H58 S62	H58-T60 VanDerWaalsContact C-N 3.3Å; H58-T60 VanDerWaalsContact CE1-CG2 3.45Å; H58-T60 WeakPolarHBondContact CE1-CG2 3.42Å; H58-T60 WeakPolarHBondContact ND1-CG2 3.23Å; H58-T60 PolarHBondContact O-N 3.46Å; T60-S62 PolarHBondContact O-N 3.4Å
61	N	38.5	Very low	43.8	Very low	77 Å²	77	107.1 Å²	107.1	41%	0.412	59%	0.588	S	S	.	*			trans	-71.6	88.2	165.3	-163.7	-5.5	0	0	0	106.4	H59 Q63	H59-N61 PolarHBondContact O-N 3.23Å; N61-Q63 PolarHBondContact ND2-OE1 2.9Å; N61-Q63 PolarHBondContact O-N 3.17Å; N61-Q63 VanDerWaalsContact OD1-CB 3.32Å; N61-Q63 WeakPolarHBondContact OD1-CB 3.49Å; N61-Q63 WeakPolarHBondContact OD1-CG 3.16Å; N61-Q63 PolarHBondContact OD1-N 2.76Å; N61-Q63 PolarHBondContact OD1-OE1 3.43Å
62	S	41.8	Very low	43.8	Very low	102 Å²	102	109.8 Å²	109.8	71%	0.713	60%	0.601	S	S	*	*			trans	-71.2	23.7	175.8	-51.1	0	0	0	0	112.2	T60 H64	T60-S62 PolarHBondContact O-N 3.4Å; S62-H64 VanDerWaalsContact C-N 3.26Å; S62-H64 PolarHBondContact O-N 3.13Å
63	Q	41.7	Very low	43.7	Very low	145 Å²	145	108.8 Å²	108.8	68%	0.678	60%	0.598	S	S	*	*			trans	-78.1	84.8	165.8	-72.8	179.5	-25.8	0	0	108	N61 D65	N61-Q63 PolarHBondContact ND2-OE1 2.9Å; N61-Q63 PolarHBondContact O-N 3.17Å; N61-Q63 VanDerWaalsContact OD1-CB 3.32Å; N61-Q63 WeakPolarHBondContact OD1-CB 3.49Å; N61-Q63 WeakPolarHBondContact OD1-CG 3.16Å; N61-Q63 PolarHBondContact OD1-N 2.76Å; N61-Q63 PolarHBondContact OD1-OE1 3.43Å; Q63-D65 PolarHBondContact O-N 3.31Å
64	H	44.4	Very low	43.7	Very low	193 Å²	193	111.4 Å²	111.4	89%	0.894	61%	0.608	S	S	*	*	S	Bend	trans	21.6	14	144.2	-106.5	67.6	0	0	0	123	S62	S62-H64 VanDerWaalsContact C-N 3.26Å; S62-H64 PolarHBondContact O-N 3.13Å
65	D	47.5	Very low	43.5	Very low	135 Å²	135	110.6 Å²	110.6	72%	0.722	60%	0.602	S	S	*	*	S	Bend	trans	-137.7	27.3	-168.2	-140.3	7.7	0	0	0	113.6	Q63 R67	Q63-D65 PolarHBondContact O-N 3.31Å; D65-R67 PolarHBondContact O-N 3.45Å
66	G	42.6	Very low	43.5	Very low	79 Å²	79	110.1 Å²	110.1	81%	0.814	60%	0.602	S	S	*	*			trans	64.8	3.8	164.8	0	0	0	0	0	116.4	V68	G66-V68 PolarHBondContact O-N 3.27Å
67	R	39.6	Very low	43.3	Very low	217 Å²	217	112.5 Å²	112.5	82%	0.819	60%	0.603	S	S	*	*			trans	-86.9	93.4	178.4	-69.5	-175.6	173.2	-158	-2.9	109.5	D65 S69	D65-R67 PolarHBondContact O-N 3.45Å; R67-S69 PolarHBondContact O-N 3.41Å
68	V	42.4	Very low	43.2	Very low	137 Å²	137	113.1 Å²	113.1	83%	0.83	61%	0.606	S	S	*	*			trans	-52.8	109.2	168.1	179.4	0	0	0	0	107.7	G66	G66-V68 PolarHBondContact O-N 3.27Å
69	S	44.6	Very low	43.1	Very low	44 Å²	44	107.8 Å²	107.8	31%	0.308	59%	0.593	S	S	.	*	P	Polyproline II helix	trans	-61.5	129.9	179.4	-175.7	0	0	0	0	108.6	R67 F71	R67-S69 PolarHBondContact O-N 3.41Å; S69-F71 PolarHBondContact O-N 3.13Å
70	P	44.9	Very low	43	Very low	105 Å²	105	106 Å²	106	68%	0.682	60%	0.596	S	S	*	*	P	Polyproline II helix	trans	-57.4	129.1	178.6	22.1	-31.1	0	0	0	109.7	I72	P70-I72 PolarHBondContact O-N 3.23Å
71	F	44.9	Very low	43	Very low	174 Å²	174	110.2 Å²	110.2	76%	0.763	61%	0.609	S	S	*	*	P	Polyproline II helix	trans	-66.5	129.3	175.9	58.2	-85.6	0	0	0	108.8	S69	S69-F71 PolarHBondContact O-N 3.13Å
72	I	45.5	Very low	43.1	Very low	117 Å²	117	110.3 Å²	110.3	60%	0.6	61%	0.614	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-101.5	100.9	171.6	-56.7	177	0	0	0	106.8	P70	P70-I72 PolarHBondContact O-N 3.23Å
73	A	44.6	Very low	42.8	Very low	54 Å²	54	111.7 Å²	111.7	45%	0.446	62%	0.619	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-84	118.3	168.3	0	0	0	0	0	108.3
74	K	46.8	Very low	42.8	Very low	102 Å²	102	109.8 Å²	109.8	44%	0.443	61%	0.613	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-113.5	112.5	176	-146.1	171.6	-173.1	172.9	0	108.2
75	V	44.4	Very low	42.5	Very low	74 Å²	74	104.6 Å²	104.6	45%	0.448	60%	0.596	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-91.8	118.8	178.3	-176	0	0	0	0	107.9	H77	V75-H77 WeakPolarHBondContact CG1-NE2 3.36Å
76	A	46.1	Very low	41.8	Very low	29 Å²	29	107.7 Å²	107.7	24%	0.24	60%	0.597	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-101.4	118.9	170.6	0	0	0	0	0	108.7	L16 I53	L16-A76 HydrophobicContact CD1-CB 4.44Å; I53-A76 PolarHBondContact N-O 3.48Å; I53-A76 PolarHBondContact O-N 3.07Å
77	H	40.9	Very low	41.6	Very low	143 Å²	143	107.9 Å²	107.9	66%	0.662	59%	0.591	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-89.4	110.4	172.3	-60.9	151	0	0	0	109	V75 G79	V75-H77 WeakPolarHBondContact CG1-NE2 3.36Å; H77-G79 PolarHBondContact O-N 2.8Å
78	I	43	Very low	41.7	Very low	63 Å²	63	101.2 Å²	101.2	32%	0.323	57%	0.572	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-99.5	77	177.1	-44.5	173.2	0	0	0	107.3	L51 I53	L51-I78 HydrophobicContact CD2-CD1 4.48Å; L51-I78 PolarHBondContact O-N 2.79Å; L51-I78 VanDerWaalsContact O-N 3.16Å; I53-I78 HydrophobicContact CD1-CD1 3.86Å; I53-I78 HydrophobicContact CG1-CD1 4.43Å
79	G	39.9	Very low	41.5	Very low	45 Å²	45	100.7 Å²	100.7	46%	0.464	56%	0.563	S	S	.	*	S	Bend	trans	-155.4	-16.8	-174.9	0	0	0	0	0	115.3	N50 H77	N50-G79 VanDerWaalsContact OD1-CA 3.3Å; N50-G79 WeakPolarHBondContact OD1-CA 3.3Å; H77-G79 PolarHBondContact O-N 2.8Å
80	S	38.8	Very low	41	Very low	99 Å²	99	102 Å²	102	69%	0.692	57%	0.573	S	S	*	*	S	Bend	trans	-139	128.2	173.5	-40.8	0	0	0	0	106
81	Q	39.9	Very low	40.5	Very low	181 Å²	181	100.1 Å²	100.1	85%	0.846	57%	0.573	S	S	*	*			trans	-19.4	108.7	175.4	-173.9	167.5	-5.8	0	0	112	T83	Q81-T83 PolarHBondContact O-N 3.43Å
82	P	41.4	Very low	39.8	Very low	78 Å²	78	96.5 Å²	96.5	51%	0.506	57%	0.567	S	S	.	*			trans	-65.4	101.2	-172.9	25.1	-32.6	0	0	0	107.9	F20 L84	F20-P82 HydrophobicContact CE2-CG 4.36Å; F20-P82 HydrophobicContact CZ-CG 4.35Å; P82-L84 HydrophobicContact CB-CG 4.44Å; P82-L84 PolarHBondContact O-N 3.16Å
83	T	35.5	Very low	39.4	Very low	132 Å²	132	104.2 Å²	104.2	81%	0.81	60%	0.597	S	S	*	*			trans	-64.8	76.5	151.6	36.2	0	0	0	0	105.7	Q81 P85	Q81-T83 PolarHBondContact O-N 3.43Å; T83-P85 WeakPolarHBondContact O-CD 3.5Å
84	L	41.7	Very low	39.2	Very low	105 Å²	105	106.8 Å²	106.8	55%	0.55	61%	0.605	S	S	.	*			trans	-50.1	113.1	162.4	-79.9	162	0	0	0	104.9	P82 W86 L88	P82-L84 HydrophobicContact CB-CG 4.44Å; P82-L84 PolarHBondContact O-N 3.16Å; L84-W86 PolarHBondContact O-N 2.81Å; L84-L88 HydrophobicContact CD2-CD1 3.96Å
85	P	36.7	Very low	38.8	Very low	84 Å²	84	107 Å²	107	55%	0.545	61%	0.613	S	S	.	*			trans	-57.6	126.3	175.5	21.7	-28.5	0	0	0	105.5	T83 A87 L88	T83-P85 WeakPolarHBondContact O-CD 3.5Å; P85-A87 HydrophobicContact CB-CB 4.34Å; P85-A87 PolarHBondContact O-N 3.39Å; P85-L88 PolarHBondContact O-N 3.22Å
86	W	33.5	Very low	38.4	Very low	199 Å²	199	108.8 Å²	108.8	75%	0.754	62%	0.622	S	S	*	*	G	3₁₀ helix	trans	-45.2	-19.7	179.1	-169.9	-96.4	0	0	0	113.4	L84 L88 L89 S90	L84-W86 PolarHBondContact O-N 2.81Å; W86-L88 PolarHBondContact O-N 3.09Å; W86-L89 PolarHBondContact O-N 2.95Å; W86-L89 VanDerWaalsContact O-N 3.13Å; W86-S90 PolarHBondContact NE1-OG 2.95Å; W86-S90 PolarHBondContact O-N 3.49Å
87	A	37.9	Very low	38	Very low	83 Å²	83	113.5 Å²	113.5	69%	0.686	65%	0.645	S	S	*	*	G	3₁₀ helix	trans	-49.8	-26.2	166.7	0	0	0	0	0	116	P85	P85-A87 HydrophobicContact CB-CB 4.34Å; P85-A87 PolarHBondContact O-N 3.39Å
88	L	41.8	Very low	37.8	Very low	77 Å²	77	111.7 Å²	111.7	40%	0.403	64%	0.644	S	S	.	*	G	3₁₀ helix	trans	-87.3	-17.7	177.7	-72.4	174.6	0	0	0	114.3	L84 P85 W86	L84-L88 HydrophobicContact CD2-CD1 3.96Å; P85-L88 PolarHBondContact O-N 3.22Å; W86-L88 PolarHBondContact O-N 3.09Å
89	L	38.3	Very low	37.5	Very low	126 Å²	126	114.9 Å²	114.9	66%	0.66	67%	0.665	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.1	-22.7	176.6	-76.6	167	0	0	0	112.9	W86 G91	W86-L89 PolarHBondContact O-N 2.95Å; W86-L89 VanDerWaalsContact O-N 3.13Å; L89-G91 PolarHBondContact O-N 2.77Å
90	S	33.8	Very low	37.3	Very low	73 Å²	73	119.9 Å²	119.9	51%	0.51	68%	0.68	S	S	.	*	T	Hydrogen-bonded Turn	trans	-81.7	12.5	176.2	-66.9	0	0	0	0	114.5	W86 C92	W86-S90 PolarHBondContact NE1-OG 2.95Å; W86-S90 PolarHBondContact O-N 3.49Å; S90-C92 PolarHBondContact O-N 3.33Å
91	G	35	Very low	37.2	Very low	65 Å²	65	121.5 Å²	121.5	67%	0.67	68%	0.679	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.1	7.2	170	0	0	0	0	0	114.7	L89	L89-G91 PolarHBondContact O-N 2.77Å
92	C	29.9	Very low	37	Very low	97 Å²	97	116.6 Å²	116.6	66%	0.655	67%	0.665	S	S	*	*			trans	-130.4	64.8	-178.6	-67.7	0	0	0	0	111.3	S90	S90-C92 PolarHBondContact O-N 3.33Å
93	F	37.8	Very low	36.6	Very low	280 Å²	280	120.1 Å²	120.1	100%	1.228	68%	0.679	S	S	*	*			trans	-157.6	0	150.1	-94.2	-74.9	0	0	0	108

Retrieved 93 of 93 residues in 29.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).