G4VBU0_SCHMA Loading...

Smp_201470

AlphaFold DB , UniProt , Accession G4VBU0, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 61 aa.

						>G4VBU0_SCHMA|G4VBU0
MRKLRGGTTKETKKDKLQRRKDMQEIPDQVKRIVLPTLAAVVAGLVVLLFFVTRPSSIPTS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.5	Very low	55.7	Low	243 Å²	243	156.7 Å²	156.7	100%	1.197	79%	0.788	S	S	*	*				0	121.8	0	-82	-171.7	168.1	0	0	109.9	K3	M1-K3 PolarHBondContact O-N 3.06Å
2	R	56	Low	56.7	Low	239 Å²	239	150.8 Å²	150.8	90%	0.902	77%	0.767	S	S	*	*			trans	-67.9	118.3	176.9	-161.4	176	-169.4	179.1	2.8	107.4	L4	R2-L4 VanDerWaalsContact C-N 3.35Å; R2-L4 PolarHBondContact O-N 2.64Å
3	K	61.5	Low	57.5	Low	200 Å²	200	153.8 Å²	153.8	87%	0.87	77%	0.771	S	S	*	*			trans	-58.1	103.7	171.4	-69.8	-170.6	-179.6	-171.5	0	106.6	M1 R5	M1-K3 PolarHBondContact O-N 3.06Å; K3-R5 PolarHBondContact O-N 2.88Å; K3-R5 VanDerWaalsContact O-N 3.12Å
4	L	59.2	Low	58.5	Low	147 Å²	147	154.9 Å²	154.9	77%	0.77	77%	0.768	S	S	*	*			trans	-53	121.5	178.3	-69.3	165.1	0	0	0	106.4	R2 G6 G7	R2-L4 VanDerWaalsContact C-N 3.35Å; R2-L4 PolarHBondContact O-N 2.64Å; L4-G6 PolarHBondContact O-N 2.96Å; L4-G7 PolarHBondContact O-N 3.4Å
5	R	56.5	Low	59.4	Low	263 Å²	263	148.9 Å²	148.9	99%	0.992	74%	0.74	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.2	18.3	178.9	-84.9	178.1	135.5	-139.8	0.6	114.3	K3	K3-R5 PolarHBondContact O-N 2.88Å; K3-R5 VanDerWaalsContact O-N 3.12Å
6	G	53.5	Low	60.4	Low	67 Å²	67	147.2 Å²	147.2	69%	0.691	73%	0.727	S	S	*	*	T	Hydrogen-bonded Turn	trans	-129.1	0.1	172.7	0	0	0	0	0	114	L4 T8	L4-G6 PolarHBondContact O-N 2.96Å; G6-T8 PolarHBondContact O-N 2.71Å
7	G	50.2	Low	61.4	Low	54 Å²	54	144 Å²	144	56%	0.557	71%	0.713	S	S	*	*	S	Bend	trans	-77.3	87.8	-178.4	0	0	0	0	0	111.4	L4	L4-G7 PolarHBondContact O-N 3.4Å
8	T	55.2	Low	62.1	Low	118 Å²	118	141.4 Å²	141.4	72%	0.724	70%	0.699	S	S	*	*			trans	52.4	76.6	173.4	62.6	0	0	0	0	111.8	G6 K10	G6-T8 PolarHBondContact O-N 2.71Å; T8-K10 PolarHBondContact O-N 2.91Å
9	T	57.4	Low	62.7	Low	130 Å²	130	140.9 Å²	140.9	80%	0.798	69%	0.688	S	S	*	*			trans	-50.8	101.1	144	-59	0	0	0	0	103.3	E11	T9-E11 PolarHBondContact O-N 3.1Å
10	K	58.6	Low	63.2	Low	176 Å²	176	143.1 Å²	143.1	77%	0.765	69%	0.688	S	S	*	*			trans	-53.8	104.8	179.1	-88.9	-176.6	175	-179.3	0	103	T8 T12	T8-K10 PolarHBondContact O-N 2.91Å; K10-T12 VanDerWaalsContact C-N 3.26Å; K10-T12 PolarHBondContact O-N 2.96Å; K10-T12 PolarHBondContact O-OG1 3.31Å
11	E	58.1	Low	63.6	Low	87 Å²	87	141.3 Å²	141.3	41%	0.407	68%	0.678	S	S	.	*			trans	-51	108.5	169.9	-76.5	-163.6	151.7	0	0	103.6	T9 D15 K16 R19	T9-E11 PolarHBondContact O-N 3.1Å; E11-D15 HydrophobicContact CB-CB 4.21Å; E11-K16 HydrophobicContact CB-CG 4.27Å; E11-R19 IonicContact OE1-CZ 3.38Å; E11-R19 IonicContact OE1-NE 3.27Å; E11-R19 PolarHBondContact OE1-NE 2.87Å; E11-R19 IonicContact OE1-NH2 3.84Å; E11-R19 PolarHBondContact OE1-NH2 2.83Å; E11-R19 IonicContact OE2-NE 3.96Å
12	T	67.9	Low	64.7	Low	86 Å²	86	133 Å²	133	53%	0.528	64%	0.638	S	S	.	*			trans	-60.6	151.8	-170.2	-65.4	0	0	0	0	105.6	K10 K14 D15 K16	K10-T12 VanDerWaalsContact C-N 3.26Å; K10-T12 PolarHBondContact O-N 2.96Å; K10-T12 PolarHBondContact O-OG1 3.31Å; T12-K14 HydrophobicContact CG2-CB 4.1Å; T12-K14 HydrophobicContact CG2-CG 4.09Å; T12-K14 CarbonylContact O-C 3.59Å; T12-K14 PolarHBondContact O-N 2.95Å; T12-D15 WeakPolarHBondContact O-CA 3.48Å; T12-D15 WeakPolarHBondContact O-CB 3.21Å; T12-D15 PolarHBondContact O-N 3.22Å; T12-K16 PolarHBondContact O-N 3.45Å
13	K	66.3	Low	65.3	Low	189 Å²	189	128.5 Å²	128.5	82%	0.822	63%	0.629	S	S	*	*	H	α-helix	trans	-48.6	-29.4	176.5	-65.5	-174.4	178.1	-171.3	0	112.2	L17	K13-L17 WeakPolarHBondContact O-CB 3.27Å; K13-L17 PolarHBondContact O-N 2.8Å; K13-L17 VanDerWaalsContact O-N 3.08Å
14	K	71.4	Confident	65.6	Low	169 Å²	169	125.7 Å²	125.7	74%	0.735	62%	0.619	S	S	*	*	H	α-helix	trans	-60.9	-45	171.1	-61.7	-172.8	178.1	-172.9	0	113.9	T12 L17 Q18	T12-K14 HydrophobicContact CG2-CB 4.1Å; T12-K14 HydrophobicContact CG2-CG 4.09Å; T12-K14 CarbonylContact O-C 3.59Å; T12-K14 PolarHBondContact O-N 2.95Å; K14-L17 PolarHBondContact O-N 3.49Å; K14-Q18 WeakPolarHBondContact O-CB 3.31Å; K14-Q18 PolarHBondContact O-N 3.31Å
15	D	72.2	Confident	66	Low	65 Å²	65	124 Å²	124	35%	0.348	61%	0.607	S	S	.	*	H	α-helix	trans	-65.9	-46.1	179.5	-165.7	-87.4	0	0	0	111.4	E11 T12 L17 Q18 R19	E11-D15 HydrophobicContact CB-CB 4.21Å; T12-D15 WeakPolarHBondContact O-CA 3.48Å; T12-D15 WeakPolarHBondContact O-CB 3.21Å; T12-D15 PolarHBondContact O-N 3.22Å; D15-L17 VanDerWaalsContact C-N 3.26Å; D15-L17 PolarHBondContact O-N 2.81Å; D15-Q18 PolarHBondContact O-N 3.22Å; D15-Q18 VanDerWaalsContact O-N 3.14Å; D15-R19 WeakPolarHBondContact O-CG 3.47Å; D15-R19 PolarHBondContact O-N 3.45Å; D15-R19 IonicContact OD1-CZ 3.78Å; D15-R19 IonicContact OD1-NE 2.91Å; D15-R19 PolarHBondContact OD1-NE 3.41Å; D15-R19 IonicContact OD1-NH2 2.77Å
16	K	76.2	Confident	66.6	Low	122 Å²	122	115.9 Å²	115.9	53%	0.53	58%	0.583	S	S	.	*	H	α-helix	trans	-61	-34.9	173.8	-66.8	-169.6	-179.6	-170	0	112.7	E11 T12 R20	E11-K16 HydrophobicContact CB-CG 4.27Å; T12-K16 PolarHBondContact O-N 3.45Å; K16-R20 VanDerWaalsContact O-CG 3.31Å; K16-R20 WeakPolarHBondContact O-CG 3.33Å; K16-R20 PolarHBondContact O-N 2.93Å
17	L	76.8	Confident	67.6	Low	93 Å²	93	116.3 Å²	116.3	49%	0.487	57%	0.573	S	S	.	*	H	α-helix	trans	-71.2	-41.3	175.4	-177.4	63.3	0	0	0	111.3	K13 K14 D15 R20 K21	K13-L17 WeakPolarHBondContact O-CB 3.27Å; K13-L17 PolarHBondContact O-N 2.8Å; K13-L17 VanDerWaalsContact O-N 3.08Å; K14-L17 PolarHBondContact O-N 3.49Å; D15-L17 VanDerWaalsContact C-N 3.26Å; D15-L17 PolarHBondContact O-N 2.81Å; L17-R20 PolarHBondContact O-N 2.91Å; L17-K21 WeakPolarHBondContact O-CG 3.21Å; L17-K21 PolarHBondContact O-N 3.45Å
18	Q	74.7	Confident	68.9	Low	98 Å²	98	118.9 Å²	118.9	46%	0.458	57%	0.574	S	S	.	*	H	α-helix	trans	-61.3	-48.5	177.9	-164.9	67.3	10.6	0	0	110.6	K14 D15 R20 K21 D22	K14-Q18 WeakPolarHBondContact O-CB 3.31Å; K14-Q18 PolarHBondContact O-N 3.31Å; D15-Q18 PolarHBondContact O-N 3.22Å; D15-Q18 VanDerWaalsContact O-N 3.14Å; Q18-R20 VanDerWaalsContact C-N 3.27Å; Q18-R20 PolarHBondContact O-N 3.27Å; Q18-K21 WeakPolarHBondContact O-CB 3.31Å; Q18-K21 PolarHBondContact O-N 3.25Å; Q18-D22 PolarHBondContact O-N 2.95Å
19	R	72.2	Confident	70	Confident	131 Å²	131	119.2 Å²	119.2	49%	0.494	57%	0.567	S	S	.	*	H	α-helix	trans	-56.7	-39.1	174.5	-67.9	177.7	-176.7	-90.3	14.4	112.8	E11 D15 M23	E11-R19 IonicContact OE1-CZ 3.38Å; E11-R19 IonicContact OE1-NE 3.27Å; E11-R19 PolarHBondContact OE1-NE 2.87Å; E11-R19 IonicContact OE1-NH2 3.84Å; E11-R19 PolarHBondContact OE1-NH2 2.83Å; E11-R19 IonicContact OE2-NE 3.96Å; D15-R19 WeakPolarHBondContact O-CG 3.47Å; D15-R19 PolarHBondContact O-N 3.45Å; D15-R19 IonicContact OD1-CZ 3.78Å; D15-R19 IonicContact OD1-NE 2.91Å; D15-R19 PolarHBondContact OD1-NE 3.41Å; D15-R19 IonicContact OD1-NH2 2.77Å; R19-M23 WeakPolarHBondContact O-CB 3.25Å; R19-M23 WeakPolarHBondContact O-CG 3.31Å; R19-M23 PolarHBondContact O-N 3.47Å; R19-M23 VanDerWaalsContact O-N 3.07Å
20	R	74.1	Confident	71.1	Confident	184 Å²	184	116.8 Å²	116.8	69%	0.694	55%	0.552	S	S	*	*	H	α-helix	trans	-68.7	-34.4	176.8	-75.3	176.4	-179	-115.7	0.3	112.9	K16 L17 Q18 Q24	K16-R20 VanDerWaalsContact O-CG 3.31Å; K16-R20 WeakPolarHBondContact O-CG 3.33Å; K16-R20 PolarHBondContact O-N 2.93Å; L17-R20 PolarHBondContact O-N 2.91Å; Q18-R20 VanDerWaalsContact C-N 3.27Å; Q18-R20 PolarHBondContact O-N 3.27Å; R20-Q24 PolarHBondContact O-N 3.3Å
21	K	70.8	Confident	72.2	Confident	107 Å²	107	115.1 Å²	115.1	47%	0.465	55%	0.545	S	S	.	.	H	α-helix	trans	-70	-49.2	174.8	-72.9	-179	176.1	-172.3	0	110.6	L17 Q18 M23 Q24 E25	L17-K21 WeakPolarHBondContact O-CG 3.21Å; L17-K21 PolarHBondContact O-N 3.45Å; Q18-K21 WeakPolarHBondContact O-CB 3.31Å; Q18-K21 PolarHBondContact O-N 3.25Å; K21-M23 PolarHBondContact O-N 3.5Å; K21-Q24 CarbonylContact O-C 3.54Å; K21-Q24 WeakPolarHBondContact O-CA 3.2Å; K21-Q24 WeakPolarHBondContact O-CB 3.35Å; K21-Q24 PolarHBondContact O-N 2.88Å; K21-E25 WeakPolarHBondContact O-CG 3.21Å; K21-E25 PolarHBondContact O-N 3.39Å
22	D	69.7	Low	73.5	Confident	69 Å²	69	121 Å²	121	37%	0.369	56%	0.564	S	S	.	*	H	α-helix	trans	-55.4	-43.7	178.2	-61	-19.5	0	0	0	110.2	Q18 Q24 E25 I26	Q18-D22 PolarHBondContact O-N 2.95Å; D22-Q24 PolarHBondContact O-N 2.99Å; D22-E25 PolarHBondContact O-N 3.31Å; D22-I26 VanDerWaalsContact O-CG1 3.29Å; D22-I26 WeakPolarHBondContact O-CG1 3.28Å; D22-I26 PolarHBondContact O-N 3.02Å
23	M	69.1	Low	74.4	Confident	143 Å²	143	121.9 Å²	121.9	70%	0.704	56%	0.564	S	S	*	*	H	α-helix	trans	-62	-27.5	177	-67.2	-75.9	156.6	0	0	114	R19 K21 P27	R19-M23 WeakPolarHBondContact O-CB 3.25Å; R19-M23 WeakPolarHBondContact O-CG 3.31Å; R19-M23 PolarHBondContact O-N 3.47Å; R19-M23 VanDerWaalsContact O-N 3.07Å; K21-M23 PolarHBondContact O-N 3.5Å; M23-P27 WeakPolarHBondContact O-CD 3.41Å
24	Q	66.9	Low	75.5	Confident	141 Å²	141	116.6 Å²	116.6	66%	0.659	55%	0.547	S	S	*	.	H	α-helix	trans	-84.1	-26.6	174.2	-70.4	177	42.5	0	0	112.3	R20 K21 D22 P27	R20-Q24 PolarHBondContact O-N 3.3Å; K21-Q24 CarbonylContact O-C 3.54Å; K21-Q24 WeakPolarHBondContact O-CA 3.2Å; K21-Q24 WeakPolarHBondContact O-CB 3.35Å; K21-Q24 PolarHBondContact O-N 2.88Å; D22-Q24 PolarHBondContact O-N 2.99Å; Q24-P27 VanDerWaalsContact O-CD 3.22Å; Q24-P27 WeakPolarHBondContact O-CD 3.35Å; Q24-P27 WeakPolarHBondContact O-CG 3.42Å
25	E	68.4	Low	76.4	Confident	113 Å²	113	114.3 Å²	114.3	53%	0.528	54%	0.542	S	S	.	.	H	α-helix	trans	-81.5	-25.2	179.9	-68.8	-176	111.1	0	0	113.1	K21 D22 D28 Q29	K21-E25 WeakPolarHBondContact O-CG 3.21Å; K21-E25 PolarHBondContact O-N 3.39Å; D22-E25 PolarHBondContact O-N 3.31Å; E25-D28 PolarHBondContact O-N 2.95Å; E25-Q29 WeakPolarHBondContact O-CB 3.34Å; E25-Q29 PolarHBondContact O-N 2.89Å
26	I	69.4	Low	77.4	Confident	92 Å²	92	114.8 Å²	114.8	47%	0.472	55%	0.549	S	S	.	.	H	α-helix	trans	-52.5	-52.3	175.3	-64.8	-75	0	0	0	112.7	D22 D28 Q29 V30	D22-I26 VanDerWaalsContact O-CG1 3.29Å; D22-I26 WeakPolarHBondContact O-CG1 3.28Å; D22-I26 PolarHBondContact O-N 3.02Å; I26-D28 VanDerWaalsContact C-N 3.29Å; I26-D28 PolarHBondContact O-N 3.46Å; I26-Q29 PolarHBondContact O-N 3.48Å; I26-V30 HydrophobicContact CG2-CG2 4.42Å; I26-V30 VanDerWaalsContact O-CG2 3.31Å; I26-V30 WeakPolarHBondContact O-CG2 3.33Å; I26-V30 PolarHBondContact O-N 3.29Å
27	P	73.6	Confident	78.4	Confident	75 Å²	75	112.9 Å²	112.9	49%	0.487	55%	0.548	S	S	.	.	H	α-helix	trans	-62.2	-35.9	-179.8	23.9	-35.2	0	0	0	112.8	M23 Q24 K31	M23-P27 WeakPolarHBondContact O-CD 3.41Å; Q24-P27 VanDerWaalsContact O-CD 3.22Å; Q24-P27 WeakPolarHBondContact O-CD 3.35Å; Q24-P27 WeakPolarHBondContact O-CG 3.42Å; P27-K31 WeakPolarHBondContact O-CB 3.43Å; P27-K31 PolarHBondContact O-N 3.46Å
28	D	77.5	Confident	79.3	Confident	109 Å²	109	113.8 Å²	113.8	58%	0.583	55%	0.553	S	S	*	*	H	α-helix	trans	-69.9	-39.6	177.9	-75.3	-31.6	0	0	0	111.9	E25 I26 K31 R32	E25-D28 PolarHBondContact O-N 2.95Å; I26-D28 VanDerWaalsContact C-N 3.29Å; I26-D28 PolarHBondContact O-N 3.46Å; D28-K31 PolarHBondContact O-N 2.91Å; D28-R32 WeakPolarHBondContact O-CB 3.35Å; D28-R32 PolarHBondContact O-N 3.46Å
29	Q	78.3	Confident	80.3	Confident	124 Å²	124	112 Å²	112	58%	0.579	55%	0.554	S	S	*	*	H	α-helix	trans	-64.2	-43.5	175.6	-168.8	175.6	32.8	0	0	111.4	E25 I26 R32 I33	E25-Q29 WeakPolarHBondContact O-CB 3.34Å; E25-Q29 PolarHBondContact O-N 2.89Å; I26-Q29 PolarHBondContact O-N 3.48Å; Q29-R32 PolarHBondContact O-N 3.03Å; Q29-I33 PolarHBondContact O-N 3.44Å
30	V	80.1	Confident	81.5	Confident	80 Å²	80	108.9 Å²	108.9	49%	0.485	56%	0.557	S	S	.	*	H	α-helix	trans	-60.5	-47.6	174.5	174.1	0	0	0	0	110	I26 R32 I33 V34	I26-V30 HydrophobicContact CG2-CG2 4.42Å; I26-V30 VanDerWaalsContact O-CG2 3.31Å; I26-V30 WeakPolarHBondContact O-CG2 3.33Å; I26-V30 PolarHBondContact O-N 3.29Å; V30-R32 VanDerWaalsContact C-N 3.28Å; V30-R32 PolarHBondContact O-N 3.1Å; V30-I33 PolarHBondContact O-N 3.42Å; V30-I33 VanDerWaalsContact O-N 3.14Å; V30-V34 HydrophobicContact CG1-CG2 3.85Å; V30-V34 WeakPolarHBondContact O-CB 3.21Å; V30-V34 WeakPolarHBondContact O-CG2 3.4Å; V30-V34 PolarHBondContact O-N 3.42Å
31	K	82.3	Confident	82.6	Confident	141 Å²	141	104.2 Å²	104.2	61%	0.613	55%	0.548	S	S	*	.	H	α-helix	trans	-58.1	-39.9	178.1	-172.6	178	-179.6	-179.1	0	112.4	P27 D28 I33 V34 L35	P27-K31 WeakPolarHBondContact O-CB 3.43Å; P27-K31 PolarHBondContact O-N 3.46Å; D28-K31 PolarHBondContact O-N 2.91Å; K31-I33 VanDerWaalsContact C-N 3.29Å; K31-I33 PolarHBondContact O-N 3.32Å; K31-V34 PolarHBondContact O-N 3.14Å; K31-L35 WeakPolarHBondContact O-CB 3.21Å; K31-L35 PolarHBondContact O-N 3.02Å
32	R	86.2	Confident	83.9	Confident	211 Å²	211	103 Å²	103	80%	0.796	55%	0.55	S	S	*	.	H	α-helix	trans	-64.5	-31.2	179.3	-168.4	173.1	-178.2	171.7	0.5	113.2	D28 Q29 V30 P36	D28-R32 WeakPolarHBondContact O-CB 3.35Å; D28-R32 PolarHBondContact O-N 3.46Å; Q29-R32 PolarHBondContact O-N 3.03Å; V30-R32 VanDerWaalsContact C-N 3.28Å; V30-R32 PolarHBondContact O-N 3.1Å; R32-P36 WeakPolarHBondContact O-CD 3.36Å; R32-P36 WeakPolarHBondContact O-CG 3.43Å
33	I	86.4	Confident	85.2	Confident	104 Å²	104	102.2 Å²	102.2	53%	0.533	55%	0.553	S	S	.	*	H	α-helix	trans	-85.5	-40.2	177	-60.7	167.2	0	0	0	110.7	Q29 V30 K31 L35 P36 T37	Q29-I33 PolarHBondContact O-N 3.44Å; V30-I33 PolarHBondContact O-N 3.42Å; V30-I33 VanDerWaalsContact O-N 3.14Å; K31-I33 VanDerWaalsContact C-N 3.29Å; K31-I33 PolarHBondContact O-N 3.32Å; I33-L35 PolarHBondContact O-N 3.49Å; I33-P36 WeakPolarHBondContact O-CD 3.19Å; I33-P36 WeakPolarHBondContact O-CG 3.43Å; I33-T37 PolarHBondContact O-N 2.88Å; I33-T37 PolarHBondContact O-OG1 3.28Å
34	V	90	Very high	86.5	Confident	77 Å²	77	97.4 Å²	97.4	47%	0.467	54%	0.54	S	S	.	.	H	α-helix	trans	-68.3	-37.1	-176.7	173.1	0	0	0	0	111.9	V30 K31 T37 L38	V30-V34 HydrophobicContact CG1-CG2 3.85Å; V30-V34 WeakPolarHBondContact O-CB 3.21Å; V30-V34 WeakPolarHBondContact O-CG2 3.4Å; V30-V34 PolarHBondContact O-N 3.42Å; K31-V34 PolarHBondContact O-N 3.14Å; V34-T37 PolarHBondContact O-N 3.3Å; V34-L38 WeakPolarHBondContact O-CB 3.01Å; V34-L38 PolarHBondContact O-N 3.35Å
35	L	88.7	Confident	87.9	Confident	121 Å²	121	95.3 Å²	95.3	63%	0.634	53%	0.532	S	S	*	.	H	α-helix	trans	-57.7	-52.4	-179.7	-163.3	76.6	0	0	0	113.5	K31 I33 L38 A39	K31-L35 WeakPolarHBondContact O-CB 3.21Å; K31-L35 PolarHBondContact O-N 3.02Å; I33-L35 PolarHBondContact O-N 3.49Å; L35-L38 PolarHBondContact O-N 3.28Å; L35-A39 PolarHBondContact O-N 2.98Å; L35-A39 VanDerWaalsContact O-N 3.1Å
36	P	94.4	Very high	89.2	Confident	76 Å²	76	94.1 Å²	94.1	49%	0.494	53%	0.533	S	S	.	.	H	α-helix	trans	-66.9	-34.2	176.8	25.5	-34.4	0	0	0	112.9	R32 I33 A39 A40	R32-P36 WeakPolarHBondContact O-CD 3.36Å; R32-P36 WeakPolarHBondContact O-CG 3.43Å; I33-P36 WeakPolarHBondContact O-CD 3.19Å; I33-P36 WeakPolarHBondContact O-CG 3.43Å; P36-A39 PolarHBondContact O-N 3.33Å; P36-A40 WeakPolarHBondContact O-CB 3.31Å; P36-A40 PolarHBondContact O-N 2.94Å
37	T	95.9	Very high	90.4	Very high	81 Å²	81	93.4 Å²	93.4	50%	0.497	53%	0.533	S	S	.	.	H	α-helix	trans	-63.2	-46.4	176.1	-54.7	0	0	0	0	111.2	I33 V34 A39 A40 V41	I33-T37 PolarHBondContact O-N 2.88Å; I33-T37 PolarHBondContact O-OG1 3.28Å; V34-T37 PolarHBondContact O-N 3.3Å; T37-A39 VanDerWaalsContact C-N 3.33Å; T37-A39 PolarHBondContact O-N 3.39Å; T37-A40 PolarHBondContact O-N 2.95Å; T37-V41 WeakPolarHBondContact O-CG2 3.38Å; T37-V41 PolarHBondContact O-N 3.05Å
38	L	96.4	Very high	91.3	Very high	113 Å²	113	94.8 Å²	94.8	59%	0.592	54%	0.535	S	S	*	.	H	α-helix	trans	-62.3	-43	178.3	-156.3	84.4	0	0	0	111.1	V34 L35 A40 V41 V42	V34-L38 WeakPolarHBondContact O-CB 3.01Å; V34-L38 PolarHBondContact O-N 3.35Å; L35-L38 PolarHBondContact O-N 3.28Å; L38-A40 PolarHBondContact O-N 3.3Å; L38-V41 PolarHBondContact O-N 2.96Å; L38-V42 WeakPolarHBondContact O-CG2 3.48Å; L38-V42 PolarHBondContact O-N 3.45Å
39	A	96.3	Very high	92	Very high	60 Å²	60	94.6 Å²	94.6	50%	0.496	53%	0.534	S	S	.	.	H	α-helix	trans	-61	-43.4	176.6	0	0	0	0	0	112.3	L35 P36 T37 V42 A43	L35-A39 PolarHBondContact O-N 2.98Å; L35-A39 VanDerWaalsContact O-N 3.1Å; P36-A39 PolarHBondContact O-N 3.33Å; T37-A39 VanDerWaalsContact C-N 3.33Å; T37-A39 PolarHBondContact O-N 3.39Å; A39-V42 PolarHBondContact O-N 2.88Å; A39-A43 WeakPolarHBondContact O-CB 3.47Å; A39-A43 PolarHBondContact O-N 3.07Å
40	A	97	Very high	92.5	Very high	66 Å²	66	93.1 Å²	93.1	55%	0.545	53%	0.526	S	S	.	.	H	α-helix	trans	-63.6	-40.6	177.1	0	0	0	0	0	112.2	P36 T37 L38 A43 G44	P36-A40 WeakPolarHBondContact O-CB 3.31Å; P36-A40 PolarHBondContact O-N 2.94Å; T37-A40 PolarHBondContact O-N 2.95Å; L38-A40 PolarHBondContact O-N 3.3Å; A40-A43 PolarHBondContact O-N 2.89Å; A40-G44 PolarHBondContact O-N 2.85Å
41	V	97.7	Very high	92.8	Very high	85 Å²	85	96.3 Å²	96.3	52%	0.515	53%	0.533	S	S	.	.	H	α-helix	trans	-63	-47.7	176	172	0	0	0	0	110.8	T37 L38 A43 G44 L45	T37-V41 WeakPolarHBondContact O-CG2 3.38Å; T37-V41 PolarHBondContact O-N 3.05Å; L38-V41 PolarHBondContact O-N 2.96Å; V41-A43 PolarHBondContact O-N 3.05Å; V41-G44 PolarHBondContact O-N 3.23Å; V41-L45 HydrophobicContact CG1-CD1 4.41Å; V41-L45 WeakPolarHBondContact O-CG 3.49Å; V41-L45 PolarHBondContact O-N 2.77Å
42	V	97.4	Very high	93	Very high	82 Å²	82	94.7 Å²	94.7	50%	0.497	54%	0.535	S	S	.	.	H	α-helix	trans	-62.1	-45.2	177.9	174	0	0	0	0	111	L38 A39 G44 L45 V46	L38-V42 WeakPolarHBondContact O-CG2 3.48Å; L38-V42 PolarHBondContact O-N 3.45Å; A39-V42 PolarHBondContact O-N 2.88Å; V42-G44 VanDerWaalsContact C-N 3.34Å; V42-G44 PolarHBondContact O-N 3.23Å; V42-L45 PolarHBondContact O-N 3.22Å; V42-V46 HydrophobicContact CG1-CG2 4.47Å; V42-V46 WeakPolarHBondContact O-CG2 3.16Å; V42-V46 PolarHBondContact O-N 2.92Å
43	A	97.4	Very high	92.8	Very high	53 Å²	53	89.5 Å²	89.5	44%	0.438	53%	0.527	S	S	.	.	H	α-helix	trans	-60.7	-43.3	176.7	0	0	0	0	0	111.9	A39 A40 V41 L45 V46 V47	A39-A43 WeakPolarHBondContact O-CB 3.47Å; A39-A43 PolarHBondContact O-N 3.07Å; A40-A43 PolarHBondContact O-N 2.89Å; V41-A43 PolarHBondContact O-N 3.05Å; A43-L45 VanDerWaalsContact C-N 3.35Å; A43-L45 PolarHBondContact O-N 3.25Å; A43-V46 PolarHBondContact O-N 3.3Å; A43-V47 VanDerWaalsContact O-CG2 3.28Å; A43-V47 WeakPolarHBondContact O-CG2 3.03Å; A43-V47 PolarHBondContact O-N 3.14Å
44	G	97.4	Very high	91.8	Very high	41 Å²	41	91.8 Å²	91.8	42%	0.423	53%	0.529	S	S	.	.	H	α-helix	trans	-60.4	-42.3	175.4	0	0	0	0	0	112.6	A40 V41 V42 V47 L48	A40-G44 PolarHBondContact O-N 2.85Å; V41-G44 PolarHBondContact O-N 3.23Å; V42-G44 VanDerWaalsContact C-N 3.34Å; V42-G44 PolarHBondContact O-N 3.23Å; G44-V47 PolarHBondContact O-N 3.27Å; G44-L48 WeakPolarHBondContact O-CB 3.47Å; G44-L48 PolarHBondContact O-N 2.91Å
45	L	96.2	Very high	90.4	Very high	97 Å²	97	92.5 Å²	92.5	51%	0.508	54%	0.535	S	S	.	.	H	α-helix	trans	-65.2	-42.6	174.7	-70.8	177.8	0	0	0	112.3	V41 V42 A43 V47 L48 L49	V41-L45 HydrophobicContact CG1-CD1 4.41Å; V41-L45 WeakPolarHBondContact O-CG 3.49Å; V41-L45 PolarHBondContact O-N 2.77Å; V42-L45 PolarHBondContact O-N 3.22Å; A43-L45 VanDerWaalsContact C-N 3.35Å; A43-L45 PolarHBondContact O-N 3.25Å; L45-V47 VanDerWaalsContact C-N 3.31Å; L45-V47 PolarHBondContact O-N 3.23Å; L45-L48 PolarHBondContact O-N 3.21Å; L45-L49 VanDerWaalsContact O-CB 3.31Å; L45-L49 WeakPolarHBondContact O-CB 3.45Å; L45-L49 VanDerWaalsContact O-CG 3.25Å; L45-L49 WeakPolarHBondContact O-CG 3.49Å; L45-L49 PolarHBondContact O-N 3.02Å
46	V	95	Very high	89	Confident	89 Å²	89	92.6 Å²	92.6	54%	0.539	55%	0.545	S	S	.	.	H	α-helix	trans	-61.3	-42.4	176.4	170.7	0	0	0	0	110.8	V42 A43 F50	V42-V46 HydrophobicContact CG1-CG2 4.47Å; V42-V46 WeakPolarHBondContact O-CG2 3.16Å; V42-V46 PolarHBondContact O-N 2.92Å; A43-V46 PolarHBondContact O-N 3.3Å; V46-F50 WeakPolarHBondContact O-CB 3.22Å; V46-F50 PolarHBondContact O-N 3.08Å
47	V	94.1	Very high	87.3	Confident	77 Å²	77	93 Å²	93	47%	0.467	55%	0.551	S	S	.	*	H	α-helix	trans	-64.8	-46.2	176.2	171.6	0	0	0	0	110.9	A43 G44 L45 L49 F50 F51	A43-V47 VanDerWaalsContact O-CG2 3.28Å; A43-V47 WeakPolarHBondContact O-CG2 3.03Å; A43-V47 PolarHBondContact O-N 3.14Å; G44-V47 PolarHBondContact O-N 3.27Å; L45-V47 VanDerWaalsContact C-N 3.31Å; L45-V47 PolarHBondContact O-N 3.23Å; V47-L49 PolarHBondContact O-N 2.99Å; V47-F50 WeakPolarHBondContact O-CB 3.29Å; V47-F50 PolarHBondContact O-N 3.27Å; V47-F51 HydrophobicContact CG1-CD2 3.72Å; V47-F51 HydrophobicContact CG1-CE2 3.59Å; V47-F51 WeakPolarHBondContact O-CD2 3.31Å; V47-F51 PolarHBondContact O-N 2.75Å
48	L	93.1	Very high	85.6	Confident	104 Å²	104	96.5 Å²	96.5	55%	0.545	57%	0.565	S	S	.	*	H	α-helix	trans	-59.3	-49.1	177	-176.9	71	0	0	0	111	G44 L45 F50 F51 V52	G44-L48 WeakPolarHBondContact O-CB 3.47Å; G44-L48 PolarHBondContact O-N 2.91Å; L45-L48 PolarHBondContact O-N 3.21Å; L48-F50 VanDerWaalsContact C-N 3.32Å; L48-F50 PolarHBondContact O-N 2.88Å; L48-F51 PolarHBondContact O-N 2.99Å; L48-V52 HydrophobicContact CG-CG2 4.48Å; L48-V52 WeakPolarHBondContact O-CB 3.41Å; L48-V52 VanDerWaalsContact O-CG2 3.27Å; L48-V52 WeakPolarHBondContact O-CG2 3.47Å; L48-V52 PolarHBondContact O-N 2.98Å
49	L	91.7	Very high	83.7	Confident	104 Å²	104	96 Å²	96	55%	0.545	57%	0.568	S	S	.	*	H	α-helix	trans	-59.2	-45.7	175.6	-73.3	175.2	0	0	0	110.3	L45 V47 F51 V52 T53	L45-L49 VanDerWaalsContact O-CB 3.31Å; L45-L49 WeakPolarHBondContact O-CB 3.45Å; L45-L49 VanDerWaalsContact O-CG 3.25Å; L45-L49 WeakPolarHBondContact O-CG 3.49Å; L45-L49 PolarHBondContact O-N 3.02Å; V47-L49 PolarHBondContact O-N 2.99Å; L49-F51 VanDerWaalsContact C-N 3.3Å; L49-F51 PolarHBondContact O-N 2.86Å; L49-V52 PolarHBondContact O-N 2.71Å; L49-V52 VanDerWaalsContact O-N 3.1Å; L49-T53 WeakPolarHBondContact O-CB 3.43Å; L49-T53 VanDerWaalsContact O-CG2 3.31Å; L49-T53 WeakPolarHBondContact O-CG2 3.45Å; L49-T53 PolarHBondContact O-N 2.71Å; L49-T53 PolarHBondContact O-OG1 3.28Å
50	F	88.9	Confident	81.7	Confident	94 Å²	94	99.1 Å²	99.1	41%	0.412	58%	0.581	S	S	.	*	H	α-helix	trans	-57.3	-41.6	177.4	178.5	-93.5	0	0	0	112.6	V46 V47 L48 R54	V46-F50 WeakPolarHBondContact O-CB 3.22Å; V46-F50 PolarHBondContact O-N 3.08Å; V47-F50 WeakPolarHBondContact O-CB 3.29Å; V47-F50 PolarHBondContact O-N 3.27Å; L48-F50 VanDerWaalsContact C-N 3.32Å; L48-F50 PolarHBondContact O-N 2.88Å; F50-R54 WeakPolarHBondContact O-CB 3.47Å; F50-R54 VanDerWaalsContact O-CG 3.31Å; F50-R54 WeakPolarHBondContact O-CG 3.4Å; F50-R54 PolarHBondContact O-N 2.75Å
51	F	87.4	Confident	79.2	Confident	147 Å²	147	105.2 Å²	105.2	65%	0.645	62%	0.619	S	S	*	*	H	α-helix	trans	-69.1	-37.3	174.6	-82.5	-70	0	0	0	113.3	V47 L48 L49	V47-F51 HydrophobicContact CG1-CD2 3.72Å; V47-F51 HydrophobicContact CG1-CE2 3.59Å; V47-F51 WeakPolarHBondContact O-CD2 3.31Å; V47-F51 PolarHBondContact O-N 2.75Å; L48-F51 PolarHBondContact O-N 2.99Å; L49-F51 VanDerWaalsContact C-N 3.3Å; L49-F51 PolarHBondContact O-N 2.86Å
52	V	85.7	Confident	78.3	Confident	107 Å²	107	106.2 Å²	106.2	65%	0.648	63%	0.625	S	S	*	*	H	α-helix	trans	-76.5	-38.8	-179.5	171.3	0	0	0	0	111.9	L48 L49	L48-V52 HydrophobicContact CG-CG2 4.48Å; L48-V52 WeakPolarHBondContact O-CB 3.41Å; L48-V52 VanDerWaalsContact O-CG2 3.27Å; L48-V52 WeakPolarHBondContact O-CG2 3.47Å; L48-V52 PolarHBondContact O-N 2.98Å; L49-V52 PolarHBondContact O-N 2.71Å; L49-V52 VanDerWaalsContact O-N 3.1Å
53	T	81.5	Confident	77.3	Confident	102 Å²	102	107.5 Å²	107.5	63%	0.626	63%	0.631	S	S	*	*	H	α-helix	trans	-86.9	-23.3	-177.3	63.4	0	0	0	0	112.6	L49 P55	L49-T53 WeakPolarHBondContact O-CB 3.43Å; L49-T53 VanDerWaalsContact O-CG2 3.31Å; L49-T53 WeakPolarHBondContact O-CG2 3.45Å; L49-T53 PolarHBondContact O-N 2.71Å; L49-T53 PolarHBondContact O-OG1 3.28Å; T53-P55 WeakPolarHBondContact O-CD 3.41Å
54	R	66.2	Low	76.2	Confident	152 Å²	152	110.5 Å²	110.5	57%	0.574	64%	0.642	S	S	*	*	S	Bend	trans	-71.1	117	164.1	-79.8	-161.4	-174.1	-143.1	4.2	106.3	F50 S56	F50-R54 WeakPolarHBondContact O-CB 3.47Å; F50-R54 VanDerWaalsContact O-CG 3.31Å; F50-R54 WeakPolarHBondContact O-CG 3.4Å; F50-R54 PolarHBondContact O-N 2.75Å; R54-S56 PolarHBondContact O-N 3.43Å
55	P	59.4	Low	74.9	Confident	92 Å²	92	114.6 Å²	114.6	60%	0.597	66%	0.655	S	S	*	*			trans	-51.8	146.5	162.4	24	-31	0	0	0	106.5	T53 S57	T53-P55 WeakPolarHBondContact O-CD 3.41Å; P55-S57 PolarHBondContact O-N 2.73Å
56	S	60.6	Low	73.6	Confident	122 Å²	122	115.7 Å²	115.7	85%	0.853	66%	0.664	S	S	*	*			trans	-63.2	41.5	163.8	-55	0	0	0	0	111.1	R54 I58 P59	R54-S56 PolarHBondContact O-N 3.43Å; S56-I58 PolarHBondContact O-N 3.12Å; S56-P59 WeakPolarHBondContact O-CD 3.49Å
57	S	58.6	Low	72.2	Confident	86 Å²	86	117.5 Å²	117.5	60%	0.601	67%	0.673	S	S	*	*			trans	-73.2	41.6	172.8	72.8	0	0	0	0	110.8	P55	P55-S57 PolarHBondContact O-N 2.73Å
58	I	60.1	Low	70.6	Confident	154 Å²	154	120.4 Å²	120.4	79%	0.79	69%	0.687	S	S	*	*			trans	-112.1	57.2	147.4	-34.7	164.7	0	0	0	107.3	S56 T60	S56-I58 PolarHBondContact O-N 3.12Å; I58-T60 PolarHBondContact O-N 3.36Å
59	P	56.6	Low	68.9	Low	101 Å²	101	121.6 Å²	121.6	66%	0.656	70%	0.698	S	S	*	*			trans	-64.3	102.3	153.4	30.1	-31.4	0	0	0	104.9	S56 S61	S56-P59 WeakPolarHBondContact O-CD 3.49Å; P59-S61 PolarHBondContact O-N 2.84Å
60	T	53.7	Low	67	Low	126 Å²	126	123.1 Å²	123.1	77%	0.773	71%	0.711	S	S	*	*			trans	-37.2	103.3	148.3	46.3	0	0	0	0	110.8	I58	I58-T60 PolarHBondContact O-N 3.36Å
61	S	45.2	Very low	65	Low	194 Å²	194	125.7 Å²	125.7	100%	1.357	74%	0.738	S	S	*	*			trans	-166	0	149.5	-82.4	0	0	0	0	109.6	P59	P59-S61 PolarHBondContact O-N 2.84Å

Retrieved 61 of 61 residues in 12.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).