G4VBV1_SCHMA Loading...

40S ribosomal protein S30

AlphaFold DB , UniProt , Accession G4VBV1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 135 aa.

						>G4VBV1_SCHMA|G4VBV1
MKVFVKSFDTRVIDTNDCPTAADLKILLANKDNLPLDSLQLYNCGSLISDSQSLASLSSDTSIDVVVPALGGKVHGSLARAGKVRGQTPKVEKQEKKKSPRGRAKRRMQYNKRFVAVVQQPGGRRRGPNSNVKSS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	83.7	Confident	90.2	Very high	62 Å²	62	73.5 Å²	73.5	31%	0.305	35%	0.353	S	S	.	.				0	145.5	0	159.2	-150.7	169.9	0	0	105.9	V3 D14 T15 L57 S58	M1-V3 HydrophobicContact CE-CG1 4.03Å; M1-D14 PolarHBondContact N-OD1 2.73Å; M1-D14 CarbonylContact O-C 3.59Å; M1-D14 WeakPolarHBondContact O-CA 3.42Å; M1-T15 HydrophobicContact CB-CG2 4.07Å; M1-T15 WeakPolarHBondContact CB-OG1 3.27Å; M1-T15 HydrophobicContact CG-CG2 4.14Å; M1-T15 PolarHBondContact N-OG1 3.38Å; M1-T15 WeakPolarHBondContact O-CB 3.38Å; M1-T15 VanDerWaalsContact O-CG2 3.28Å; M1-T15 WeakPolarHBondContact O-CG2 3.49Å; M1-T15 PolarHBondContact O-N 3.03Å; M1-T15 PolarHBondContact O-OG1 3.46Å; M1-T15 VanDerWaalsContact O-OG1 3.09Å; M1-T15 HydrophobicContact SD-CG2 3.86Å; M1-L57 HydrophobicContact CE-CB 4.17Å; M1-L57 WeakPolarHBondContact CE-O 3Å; M1-S58 WeakPolarHBondContact CE-O 3.42Å
2	K	88.2	Confident	90.4	Very high	133 Å²	133	74.2 Å²	74.2	58%	0.578	37%	0.365	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101.1	137.4	-175.7	-65.3	-177.1	-178.7	-177.5	0	110.3	V12 I13 S59	K2-V12 HydrophobicContact CB-CG1 3.8Å; K2-V12 HydrophobicContact CD-CG1 3.84Å; K2-V12 HydrophobicContact CG-CG1 4.11Å; K2-I13 WeakPolarHBondContact CA-O 3.44Å; K2-S59 VanDerWaalsContact O-O 3.05Å
3	V	90.8	Very high	90.4	Very high	0 Å²	0	69.5 Å²	69.5	0%	0	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.9	142	172.2	-68.5	0	0	0	0	109.7	M1 V5 I13 T15 L24 I63	M1-V3 HydrophobicContact CE-CG1 4.03Å; V3-V5 HydrophobicContact CG2-CG2 4.21Å; V3-I13 HydrophobicContact CG2-CB 4.19Å; V3-I13 WeakPolarHBondContact CG2-O 3.43Å; V3-I13 PolarHBondContact N-O 2.72Å; V3-I13 PolarHBondContact O-N 3.33Å; V3-T15 HydrophobicContact CG1-CG2 3.92Å; V3-T15 HydrophobicContact CG2-CG2 4.5Å; V3-L24 HydrophobicContact CG2-CD1 4.5Å; V3-I63 HydrophobicContact CB-CD1 4.26Å; V3-I63 HydrophobicContact CG2-CD1 4.27Å
4	F	92.6	Very high	90.4	Very high	81 Å²	81	68.1 Å²	68.1	36%	0.355	34%	0.337	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.8	119.5	175.5	-65.6	-86.5	0	0	0	108.7	T10 V12 T61 S62 I63	F4-T10 HydrophobicContact CD1-CG2 4.46Å; F4-V12 HydrophobicContact CD1-CG2 3.77Å; F4-V12 HydrophobicContact CE1-CG2 3.61Å; F4-T61 PolarHBondContact N-O 3.26Å; F4-T61 VanDerWaalsContact N-O 3.15Å; F4-S62 CarbonylContact O-C 3.5Å; F4-S62 VanDerWaalsContact O-CA 3.29Å; F4-S62 WeakPolarHBondContact O-CA 2.98Å; F4-I63 PolarHBondContact O-N 3Å
5	V	93.6	Very high	90.3	Very high	1 Å²	1	64 Å²	64	1%	0.006	32%	0.317	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.6	120.8	-178.9	-177.1	0	0	0	0	108.7	V3 T10 R11 I13 L24 L28 I63 V65	V3-V5 HydrophobicContact CG2-CG2 4.21Å; V5-T10 CarbonylContact O-C 3.6Å; V5-T10 WeakPolarHBondContact O-CA 3.19Å; V5-R11 PolarHBondContact N-O 2.97Å; V5-R11 PolarHBondContact O-N 3.35Å; V5-I13 HydrophobicContact CB-CD1 4.23Å; V5-I13 HydrophobicContact CG2-CB 4.4Å; V5-I13 HydrophobicContact CG2-CD1 3.82Å; V5-I13 HydrophobicContact CG2-CG1 4.38Å; V5-L24 HydrophobicContact CG2-CD1 3.81Å; V5-L28 HydrophobicContact CG1-CD1 3.96Å; V5-L28 HydrophobicContact CG1-CD2 4.09Å; V5-I63 WeakPolarHBondContact CA-O 3.5Å; V5-I63 HydrophobicContact CG2-CB 4.41Å; V5-V65 HydrophobicContact CG1-CG2 3.51Å
6	K	92.2	Very high	90.2	Very high	86 Å²	86	67.6 Å²	67.6	37%	0.374	34%	0.338	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103	100	179.7	-65.9	169.9	178.8	168.2	0	108.5	T10 S62 I63 D64 V65	K6-T10 HydrophobicContact CG-CG2 4.35Å; K6-S62 PolarHBondContact NZ-OG 3.39Å; K6-I63 PolarHBondContact N-O 3.19Å; K6-D64 VanDerWaalsContact CD-OD1 3.27Å; K6-D64 WeakPolarHBondContact CD-OD1 3.28Å; K6-V65 PolarHBondContact O-N 3.5Å
7	S	89	Confident	90.1	Very high	33 Å²	33	71.4 Å²	71.4	23%	0.231	36%	0.36	C	S	.	.	S	Bend	trans	-109.8	-119.5	169.3	68	0	0	0	0	109.7	D9 D32	S7-D9 VanDerWaalsContact C-N 3.35Å; S7-D9 PolarHBondContact N-O 3.06Å; S7-D9 VanDerWaalsContact N-O 3.12Å; S7-D32 WeakPolarHBondContact CB-OD2 3.49Å; S7-D32 PolarHBondContact OG-OD2 3.24Å
8	F	88.1	Confident	90.1	Very high	149 Å²	149	67.8 Å²	67.8	65%	0.654	34%	0.342	S	S	*	.	S	Bend	trans	-68.4	-37.2	167.2	-67.1	-65.6	0	0	0	111.6	D32 L34	F8-D32 HydrophobicContact CD2-CB 3.88Å; F8-D32 HydrophobicContact CE2-CB 3.93Å; F8-L34 HydrophobicContact CE2-CD2 3.74Å; F8-L34 HydrophobicContact CE2-CG 4.36Å; F8-L34 HydrophobicContact CZ-CD2 3.94Å
9	D	90.7	Very high	90.1	Very high	106 Å²	106	67.7 Å²	67.7	57%	0.567	35%	0.346	S	S	*	.	S	Bend	trans	-124.2	163.3	174.1	-63.7	-48.4	0	0	0	109.8	S7	S7-D9 VanDerWaalsContact C-N 3.35Å; S7-D9 PolarHBondContact N-O 3.06Å; S7-D9 VanDerWaalsContact N-O 3.12Å
10	T	92.1	Very high	90.3	Very high	93 Å²	93	66.3 Å²	66.3	57%	0.571	34%	0.341	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-86	120.3	169.8	-56.9	0	0	0	0	109.6	F4 V5 K6	F4-T10 HydrophobicContact CD1-CG2 4.46Å; V5-T10 CarbonylContact O-C 3.6Å; V5-T10 WeakPolarHBondContact O-CA 3.19Å; K6-T10 HydrophobicContact CG-CG2 4.35Å
11	R	91.1	Very high	90.4	Very high	64 Å²	64	63.1 Å²	63.1	24%	0.242	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.7	146.9	179.7	-61.6	179.4	-179.3	163.8	3.9	110.2	V5 D32	V5-R11 PolarHBondContact N-O 2.97Å; V5-R11 PolarHBondContact O-N 3.35Å; R11-D32 IonicContact CZ-OD1 2.72Å; R11-D32 IonicContact NH1-OD1 3.55Å; R11-D32 PolarHBondContact NH1-OD1 3.19Å; R11-D32 IonicContact NH1-OD2 3.1Å; R11-D32 IonicContact NH2-OD1 2.73Å; R11-D32 PolarHBondContact NH2-OD1 2.9Å
12	V	92.1	Very high	90.9	Very high	82 Å²	82	61.7 Å²	61.7	50%	0.497	32%	0.323	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.9	117.5	172.5	-173.6	0	0	0	0	107.6	K2 F4	K2-V12 HydrophobicContact CB-CG1 3.8Å; K2-V12 HydrophobicContact CD-CG1 3.84Å; K2-V12 HydrophobicContact CG-CG1 4.11Å; F4-V12 HydrophobicContact CD1-CG2 3.77Å; F4-V12 HydrophobicContact CE1-CG2 3.61Å
13	I	90.7	Very high	91.2	Very high	14 Å²	14	58.1 Å²	58.1	7%	0.072	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.3	133.7	179.4	-70.5	170.4	0	0	0	108.3	K2 V3 V5 C18 L24 L27	K2-I13 WeakPolarHBondContact CA-O 3.44Å; V3-I13 HydrophobicContact CG2-CB 4.19Å; V3-I13 WeakPolarHBondContact CG2-O 3.43Å; V3-I13 PolarHBondContact N-O 2.72Å; V3-I13 PolarHBondContact O-N 3.33Å; V5-I13 HydrophobicContact CB-CD1 4.23Å; V5-I13 HydrophobicContact CG2-CB 4.4Å; V5-I13 HydrophobicContact CG2-CD1 3.82Å; V5-I13 HydrophobicContact CG2-CG1 4.38Å; I13-C18 HydrophobicContact CG2-CB 4.34Å; I13-L24 HydrophobicContact CD1-CD1 4.49Å; I13-L27 HydrophobicContact CD1-CD2 4.09Å
14	D	90.4	Very high	91.4	Very high	49 Å²	49	58.1 Å²	58.1	26%	0.262	31%	0.31	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.8	130.7	171.4	-158.2	-16.2	0	0	0	109.3	M1 N16 D17 C18	M1-D14 PolarHBondContact N-OD1 2.73Å; M1-D14 CarbonylContact O-C 3.59Å; M1-D14 WeakPolarHBondContact O-CA 3.42Å; D14-N16 PolarHBondContact O-N 2.92Å; D14-N16 VanDerWaalsContact O-N 3.12Å; D14-N16 PolarHBondContact OD1-N 3.33Å; D14-D17 PolarHBondContact O-N 3.46Å; D14-D17 VanDerWaalsContact O-N 3.12Å; D14-C18 PolarHBondContact O-N 3.12Å
15	T	88.8	Confident	91.4	Very high	7 Å²	7	55.3 Å²	55.3	4%	0.043	30%	0.298	C	S	.	.	T	Hydrogen-bonded Turn	trans	-63.7	-13.9	176.8	60.8	0	0	0	0	112.7	M1 V3 C18 P19 L54	M1-T15 HydrophobicContact CB-CG2 4.07Å; M1-T15 WeakPolarHBondContact CB-OG1 3.27Å; M1-T15 HydrophobicContact CG-CG2 4.14Å; M1-T15 PolarHBondContact N-OG1 3.38Å; M1-T15 WeakPolarHBondContact O-CB 3.38Å; M1-T15 VanDerWaalsContact O-CG2 3.28Å; M1-T15 WeakPolarHBondContact O-CG2 3.49Å; M1-T15 PolarHBondContact O-N 3.03Å; M1-T15 PolarHBondContact O-OG1 3.46Å; M1-T15 VanDerWaalsContact O-OG1 3.09Å; M1-T15 HydrophobicContact SD-CG2 3.86Å; V3-T15 HydrophobicContact CG1-CG2 3.92Å; V3-T15 HydrophobicContact CG2-CG2 4.5Å; T15-C18 CarbonylContact O-C 3.29Å; T15-C18 VanDerWaalsContact O-C 3.29Å; T15-C18 VanDerWaalsContact O-O 3.09Å; T15-P19 WeakPolarHBondContact O-CA 3.44Å; T15-L54 HydrophobicContact CG2-CB 3.84Å
16	N	88.8	Confident	91.5	Very high	122 Å²	122	59.1 Å²	59.1	65%	0.652	32%	0.317	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74	-34.6	174.7	-64.4	-26.1	0	0	0	112	D14	D14-N16 PolarHBondContact O-N 2.92Å; D14-N16 VanDerWaalsContact O-N 3.12Å; D14-N16 PolarHBondContact OD1-N 3.33Å
17	D	89	Confident	91.5	Very high	132 Å²	132	56.8 Å²	56.8	71%	0.706	31%	0.309	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.8	-27.7	179.4	-63.7	-27.2	0	0	0	111.7	D14	D14-D17 PolarHBondContact O-N 3.46Å; D14-D17 VanDerWaalsContact O-N 3.12Å
18	C	89.7	Confident	91.7	Very high	6 Å²	6	55.2 Å²	55.2	4%	0.041	30%	0.298	C	S	.	.			trans	-132.7	90.3	177	-65.9	0	0	0	0	108.5	I13 D14 T15 T20 D23 L24 L27 L54	I13-C18 HydrophobicContact CG2-CB 4.34Å; D14-C18 PolarHBondContact O-N 3.12Å; T15-C18 CarbonylContact O-C 3.29Å; T15-C18 VanDerWaalsContact O-C 3.29Å; T15-C18 VanDerWaalsContact O-O 3.09Å; C18-T20 VanDerWaalsContact C-N 3.3Å; C18-T20 PolarHBondContact O-N 3.47Å; C18-D23 HydrophobicContact CB-CB 4.08Å; C18-L24 HydrophobicContact CB-CB 4.35Å; C18-L27 VanDerWaalsContact SG-CD1 3.52Å; C18-L54 HydrophobicContact CB-CD1 4.35Å; C18-L54 WeakPolarHBondContact O-CD1 3.35Å
19	P	90.3	Very high	92	Very high	66 Å²	66	48.8 Å²	48.8	43%	0.429	27%	0.272	S	S	.	.			trans	-69.3	-30.8	-177.4	25.3	-32.2	0	0	0	112.4	T15 D23 S53 L54	T15-P19 WeakPolarHBondContact O-CA 3.44Å; P19-D23 VanDerWaalsContact CD-OD2 3.29Å; P19-D23 WeakPolarHBondContact CD-OD2 3.47Å; P19-D23 WeakPolarHBondContact CG-OD2 3.4Å; P19-S53 WeakPolarHBondContact O-CA 3.28Å; P19-S53 PolarHBondContact O-OG 3.14Å; P19-L54 PolarHBondContact O-N 3.36Å
20	T	93.8	Very high	92.1	Very high	40 Å²	40	49.5 Å²	49.5	25%	0.245	28%	0.276	C	S	.	.	B	Isolated β-bridge	trans	-117.5	154.3	-174.6	-30.5	0	0	0	0	111.8	C18 A22 D23 L24 D50 Q52	C18-T20 VanDerWaalsContact C-N 3.3Å; C18-T20 PolarHBondContact O-N 3.47Å; T20-A22 PolarHBondContact O-N 2.83Å; T20-D23 VanDerWaalsContact CB-OD2 3.25Å; T20-D23 WeakPolarHBondContact CB-OD2 3.38Å; T20-D23 PolarHBondContact N-OD2 2.98Å; T20-D23 WeakPolarHBondContact O-CB 3.46Å; T20-D23 PolarHBondContact O-N 2.89Å; T20-D23 VanDerWaalsContact O-N 3.12Å; T20-D23 PolarHBondContact OG1-OD2 3.12Å; T20-L24 PolarHBondContact O-N 2.85Å; T20-D50 WeakPolarHBondContact CG2-O 3.39Å; T20-Q52 WeakPolarHBondContact CG2-O 3.27Å
21	A	93.7	Very high	92	Very high	0 Å²	0	51.2 Å²	51.2	0%	0	28%	0.276	C	S	.	.	H	α-helix	trans	-54.8	-38.5	171.5	0	0	0	0	0	112.7	D23 L24 K25 L41 I48 S49 Q52 L54	A21-D23 VanDerWaalsContact C-N 3.35Å; A21-D23 PolarHBondContact O-N 2.87Å; A21-L24 WeakPolarHBondContact O-CB 3.48Å; A21-L24 PolarHBondContact O-N 2.82Å; A21-K25 WeakPolarHBondContact O-CG 3.29Å; A21-K25 PolarHBondContact O-N 2.85Å; A21-L41 HydrophobicContact CB-CD1 4.09Å; A21-I48 HydrophobicContact CB-CG2 3.49Å; A21-I48 VanDerWaalsContact CB-CG2 3.49Å; A21-S49 VanDerWaalsContact CB-O 3.28Å; A21-S49 WeakPolarHBondContact CB-O 3.47Å; A21-Q52 PolarHBondContact N-O 3.28Å; A21-L54 HydrophobicContact CB-CD2 4.31Å
22	A	94.2	Very high	92	Very high	32 Å²	32	49 Å²	49	26%	0.264	27%	0.268	S	S	.	.	H	α-helix	trans	-57.5	-43.5	174.6	0	0	0	0	0	113.1	T20 L24 K25 I26 D50	T20-A22 PolarHBondContact O-N 2.83Å; A22-L24 VanDerWaalsContact C-N 3.29Å; A22-L24 PolarHBondContact O-N 3.38Å; A22-K25 WeakPolarHBondContact O-CB 3.48Å; A22-K25 PolarHBondContact O-N 2.94Å; A22-K25 VanDerWaalsContact O-N 3.15Å; A22-I26 WeakPolarHBondContact O-CG1 3.35Å; A22-I26 PolarHBondContact O-N 3.39Å; A22-D50 HydrophobicContact CB-CB 4.28Å; A22-D50 WeakPolarHBondContact CB-O 3.04Å; A22-D50 PolarHBondContact N-O 2.88Å; A22-D50 VanDerWaalsContact N-O 3.16Å
23	D	94.1	Very high	92	Very high	57 Å²	57	52 Å²	52	31%	0.305	28%	0.282	S	S	.	.	H	α-helix	trans	-63.7	-40.5	179.3	-53.9	-45	0	0	0	110.7	C18 P19 T20 A21 I26 L27	C18-D23 HydrophobicContact CB-CB 4.08Å; P19-D23 VanDerWaalsContact CD-OD2 3.29Å; P19-D23 WeakPolarHBondContact CD-OD2 3.47Å; P19-D23 WeakPolarHBondContact CG-OD2 3.4Å; T20-D23 VanDerWaalsContact CB-OD2 3.25Å; T20-D23 WeakPolarHBondContact CB-OD2 3.38Å; T20-D23 PolarHBondContact N-OD2 2.98Å; T20-D23 WeakPolarHBondContact O-CB 3.46Å; T20-D23 PolarHBondContact O-N 2.89Å; T20-D23 VanDerWaalsContact O-N 3.12Å; T20-D23 PolarHBondContact OG1-OD2 3.12Å; A21-D23 VanDerWaalsContact C-N 3.35Å; A21-D23 PolarHBondContact O-N 2.87Å; D23-I26 PolarHBondContact O-N 2.65Å; D23-L27 WeakPolarHBondContact O-CB 3.36Å; D23-L27 PolarHBondContact O-N 2.81Å
24	L	93.4	Very high	91.9	Very high	0 Å²	0	52.8 Å²	52.8	0%	0	29%	0.286	C	S	.	.	H	α-helix	trans	-65	-39.6	174.6	-175.3	152.7	0	0	0	111.8	V3 V5 I13 C18 T20 A21 A22 L27 L28 L41 L54 I63	V3-L24 HydrophobicContact CG2-CD1 4.5Å; V5-L24 HydrophobicContact CG2-CD1 3.81Å; I13-L24 HydrophobicContact CD1-CD1 4.49Å; C18-L24 HydrophobicContact CB-CB 4.35Å; T20-L24 PolarHBondContact O-N 2.85Å; A21-L24 WeakPolarHBondContact O-CB 3.48Å; A21-L24 PolarHBondContact O-N 2.82Å; A22-L24 VanDerWaalsContact C-N 3.29Å; A22-L24 PolarHBondContact O-N 3.38Å; L24-L27 PolarHBondContact O-N 2.99Å; L24-L28 HydrophobicContact CD2-CD1 3.41Å; L24-L28 VanDerWaalsContact CD2-CD1 3.41Å; L24-L28 HydrophobicContact CD2-CG 4.13Å; L24-L28 HydrophobicContact CG-CD1 4.36Å; L24-L28 WeakPolarHBondContact O-CB 3.25Å; L24-L28 VanDerWaalsContact O-CG 3.27Å; L24-L28 WeakPolarHBondContact O-CG 3.44Å; L24-L28 PolarHBondContact O-N 3.03Å; L24-L41 HydrophobicContact CD2-CD1 3.53Å; L24-L41 HydrophobicContact CD2-CD2 3.55Å; L24-L41 HydrophobicContact CD2-CG 4.18Å; L24-L54 HydrophobicContact CB-CD1 3.84Å; L24-L54 HydrophobicContact CD1-CD1 3.37Å; L24-L54 HydrophobicContact CD1-CD2 4.45Å; L24-L54 HydrophobicContact CG-CD1 4.26Å; L24-I63 HydrophobicContact CD1-CD1 4.11Å
25	K	94.5	Very high	91.9	Very high	23 Å²	23	53.6 Å²	53.6	10%	0.1	29%	0.294	C	S	.	.	H	α-helix	trans	-60.9	-44.8	173.8	-66.7	-163	177	176.2	0	111.9	A21 A22 L28 A29 L36 L39 L41 D50	A21-K25 WeakPolarHBondContact O-CG 3.29Å; A21-K25 PolarHBondContact O-N 2.85Å; A22-K25 WeakPolarHBondContact O-CB 3.48Å; A22-K25 PolarHBondContact O-N 2.94Å; A22-K25 VanDerWaalsContact O-N 3.15Å; K25-L28 PolarHBondContact O-N 3.43Å; K25-A29 VanDerWaalsContact O-CB 3.27Å; K25-A29 WeakPolarHBondContact O-CB 3.42Å; K25-A29 PolarHBondContact O-N 3.31Å; K25-L36 HydrophobicContact CB-CD1 3.94Å; K25-L39 HydrophobicContact CB-CD2 3.76Å; K25-L39 HydrophobicContact CD-CD2 3.93Å; K25-L39 WeakPolarHBondContact CE-O 3.27Å; K25-L39 HydrophobicContact CG-CD2 3.49Å; K25-L39 VanDerWaalsContact CG-CD2 3.49Å; K25-L39 PolarHBondContact NZ-O 2.95Å; K25-L41 HydrophobicContact CD-CD1 4.4Å; K25-L41 HydrophobicContact CG-CD1 3.55Å; K25-L41 HydrophobicContact CG-CG 3.94Å; K25-D50 WeakPolarHBondContact CD-OD1 3.47Å; K25-D50 WeakPolarHBondContact CE-OD1 3.17Å; K25-D50 IonicContact NZ-OD1 2.62Å; K25-D50 PolarHBondContact NZ-OD1 2.96Å; K25-D50 IonicContact NZ-OD2 3.91Å
26	I	94.1	Very high	92	Very high	80 Å²	80	57.1 Å²	57.1	41%	0.41	31%	0.312	S	S	.	.	H	α-helix	trans	-63.3	-44.9	178.3	-66.3	165.7	0	0	0	110.5	A22 D23 L28 A29 N30 L36	A22-I26 WeakPolarHBondContact O-CG1 3.35Å; A22-I26 PolarHBondContact O-N 3.39Å; D23-I26 PolarHBondContact O-N 2.65Å; I26-L28 VanDerWaalsContact C-N 3.35Å; I26-L28 PolarHBondContact O-N 3.12Å; I26-A29 PolarHBondContact O-N 3.15Å; I26-N30 WeakPolarHBondContact O-CB 3.49Å; I26-N30 PolarHBondContact O-N 3.42Å; I26-N30 PolarHBondContact O-ND2 3.29Å; I26-L36 HydrophobicContact CG1-CD1 4.05Å; I26-L36 HydrophobicContact CG1-CD2 4.41Å
27	L	93	Very high	92.1	Very high	38 Å²	38	59.1 Å²	59.1	20%	0.199	32%	0.322	C	S	.	.	H	α-helix	trans	-59.1	-47	177.1	-177.1	158.3	0	0	0	111.2	I13 C18 D23 L24 N30 K31	I13-L27 HydrophobicContact CD1-CD2 4.09Å; C18-L27 VanDerWaalsContact SG-CD1 3.52Å; D23-L27 WeakPolarHBondContact O-CB 3.36Å; D23-L27 PolarHBondContact O-N 2.81Å; L24-L27 PolarHBondContact O-N 2.99Å; L27-N30 PolarHBondContact O-N 3.12Å; L27-K31 HydrophobicContact CD2-CD 3.68Å; L27-K31 HydrophobicContact CD2-CG 4.24Å; L27-K31 HydrophobicContact CG-CD 4.42Å; L27-K31 WeakPolarHBondContact O-CB 3.38Å; L27-K31 WeakPolarHBondContact O-CG 3.28Å; L27-K31 PolarHBondContact O-N 3.17Å
28	L	93.3	Very high	92.1	Very high	0 Å²	0	54.7 Å²	54.7	0%	0	30%	0.302	C	S	.	.	H	α-helix	trans	-67.6	-41.8	178.9	-70.8	175.2	0	0	0	112.4	V5 L24 K25 I26 N30 K31 D32 L39 L41 V65	V5-L28 HydrophobicContact CG1-CD1 3.96Å; V5-L28 HydrophobicContact CG1-CD2 4.09Å; L24-L28 HydrophobicContact CD2-CD1 3.41Å; L24-L28 VanDerWaalsContact CD2-CD1 3.41Å; L24-L28 HydrophobicContact CD2-CG 4.13Å; L24-L28 HydrophobicContact CG-CD1 4.36Å; L24-L28 WeakPolarHBondContact O-CB 3.25Å; L24-L28 VanDerWaalsContact O-CG 3.27Å; L24-L28 WeakPolarHBondContact O-CG 3.44Å; L24-L28 PolarHBondContact O-N 3.03Å; K25-L28 PolarHBondContact O-N 3.43Å; I26-L28 VanDerWaalsContact C-N 3.35Å; I26-L28 PolarHBondContact O-N 3.12Å; L28-N30 VanDerWaalsContact C-N 3.28Å; L28-N30 PolarHBondContact O-N 3.44Å; L28-K31 PolarHBondContact O-N 3.25Å; L28-D32 WeakPolarHBondContact O-CB 3.36Å; L28-D32 PolarHBondContact O-N 3.03Å; L28-L39 HydrophobicContact CB-CD1 4.5Å; L28-L39 HydrophobicContact CD1-CD2 4.44Å; L28-L41 HydrophobicContact CD1-CD2 4.04Å; L28-V65 HydrophobicContact CD1-CB 4.31Å; L28-V65 HydrophobicContact CD1-CG1 3.93Å; L28-V65 HydrophobicContact CD1-CG2 3.37Å
29	A	93.4	Very high	92.2	Very high	13 Å²	13	54.5 Å²	54.5	11%	0.107	30%	0.3	C	S	.	.	H	α-helix	trans	-56.8	-44.1	176.3	0	0	0	0	0	111.2	K25 I26 N33 L34 L36	K25-A29 VanDerWaalsContact O-CB 3.27Å; K25-A29 WeakPolarHBondContact O-CB 3.42Å; K25-A29 PolarHBondContact O-N 3.31Å; I26-A29 PolarHBondContact O-N 3.15Å; A29-N33 WeakPolarHBondContact O-CA 3.38Å; A29-N33 PolarHBondContact O-N 3.24Å; A29-L34 WeakPolarHBondContact CA-O 3.29Å; A29-L34 WeakPolarHBondContact CB-O 3.29Å; A29-L34 PolarHBondContact O-N 3.47Å; A29-L36 HydrophobicContact CB-CB 4.17Å; A29-L36 HydrophobicContact CB-CD1 4.11Å
30	N	92.7	Very high	92.4	Very high	121 Å²	121	54.4 Å²	54.4	65%	0.647	29%	0.294	S	S	*	.	H	α-helix	trans	-72.5	-40.6	178.9	-69.8	-27.2	0	0	0	113.5	I26 L27 L28	I26-N30 WeakPolarHBondContact O-CB 3.49Å; I26-N30 PolarHBondContact O-N 3.42Å; I26-N30 PolarHBondContact O-ND2 3.29Å; L27-N30 PolarHBondContact O-N 3.12Å; L28-N30 VanDerWaalsContact C-N 3.28Å; L28-N30 PolarHBondContact O-N 3.44Å
31	K	91.7	Very high	92.4	Very high	130 Å²	130	52.5 Å²	52.5	57%	0.565	28%	0.283	S	S	*	.	H	α-helix	trans	-75.8	-41.3	-178.1	-75	-168	-178.1	179	0	113	L27 L28	L27-K31 HydrophobicContact CD2-CD 3.68Å; L27-K31 HydrophobicContact CD2-CG 4.24Å; L27-K31 HydrophobicContact CG-CD 4.42Å; L27-K31 WeakPolarHBondContact O-CB 3.38Å; L27-K31 WeakPolarHBondContact O-CG 3.28Å; L27-K31 PolarHBondContact O-N 3.17Å; L28-K31 PolarHBondContact O-N 3.25Å
32	D	90.7	Very high	92.5	Very high	17 Å²	17	55.5 Å²	55.5	9%	0.091	30%	0.295	C	S	.	.	H	α-helix	trans	-103.8	4.1	-171	-64.7	-10.5	0	0	0	112.4	S7 F8 R11 L28 L34	S7-D32 WeakPolarHBondContact CB-OD2 3.49Å; S7-D32 PolarHBondContact OG-OD2 3.24Å; F8-D32 HydrophobicContact CD2-CB 3.88Å; F8-D32 HydrophobicContact CE2-CB 3.93Å; R11-D32 IonicContact CZ-OD1 2.72Å; R11-D32 IonicContact NH1-OD1 3.55Å; R11-D32 PolarHBondContact NH1-OD1 3.19Å; R11-D32 IonicContact NH1-OD2 3.1Å; R11-D32 IonicContact NH2-OD1 2.73Å; R11-D32 PolarHBondContact NH2-OD1 2.9Å; L28-D32 WeakPolarHBondContact O-CB 3.36Å; L28-D32 PolarHBondContact O-N 3.03Å; D32-L34 VanDerWaalsContact C-N 3.25Å; D32-L34 HydrophobicContact CB-CD1 3.82Å; D32-L34 HydrophobicContact CB-CG 3.74Å; D32-L34 PolarHBondContact O-N 3.26Å
33	N	90.8	Very high	92.3	Very high	146 Å²	146	55.4 Å²	55.4	78%	0.781	29%	0.289	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.3	41.7	-175.3	-64.3	-61.9	0	0	0	112.9	A29	A29-N33 WeakPolarHBondContact O-CA 3.38Å; A29-N33 PolarHBondContact O-N 3.24Å
34	L	89.4	Confident	92	Very high	29 Å²	29	58.4 Å²	58.4	15%	0.152	31%	0.313	C	S	.	.			trans	-91.7	145.7	-179.4	-61.4	174.5	0	0	0	111	F8 A29 D32 L36 L39 V65 V67	F8-L34 HydrophobicContact CE2-CD2 3.74Å; F8-L34 HydrophobicContact CE2-CG 4.36Å; F8-L34 HydrophobicContact CZ-CD2 3.94Å; A29-L34 WeakPolarHBondContact CA-O 3.29Å; A29-L34 WeakPolarHBondContact CB-O 3.29Å; A29-L34 PolarHBondContact O-N 3.47Å; D32-L34 VanDerWaalsContact C-N 3.25Å; D32-L34 HydrophobicContact CB-CD1 3.82Å; D32-L34 HydrophobicContact CB-CG 3.74Å; D32-L34 PolarHBondContact O-N 3.26Å; L34-L36 PolarHBondContact O-N 3.09Å; L34-L36 VanDerWaalsContact O-N 3.14Å; L34-L39 HydrophobicContact CB-CD1 3.55Å; L34-L39 HydrophobicContact CD1-CD1 3.51Å; L34-L39 HydrophobicContact CG-CD1 4.17Å; L34-V65 HydrophobicContact CD1-CG1 4.11Å; L34-V67 HydrophobicContact CB-CG2 4.22Å; L34-V67 HydrophobicContact CD1-CG2 4.23Å; L34-V67 HydrophobicContact CD2-CG2 4Å; L34-V67 HydrophobicContact CG-CG2 4.37Å
35	P	90.9	Very high	91.8	Very high	66 Å²	66	61.4 Å²	61.4	43%	0.429	35%	0.345	S	S	.	.			trans	-68.3	112.3	177.3	27.6	-33.9	0	0	0	110.7	D37 S38 L39 V67	P35-D37 VanDerWaalsContact C-N 3.27Å; P35-D37 PolarHBondContact O-N 2.87Å; P35-S38 PolarHBondContact O-N 3.15Å; P35-S38 VanDerWaalsContact O-N 3.17Å; P35-L39 PolarHBondContact O-N 2.96Å; P35-V67 HydrophobicContact CG-CG1 3.61Å
36	L	90.9	Very high	91.6	Very high	82 Å²	82	64.2 Å²	64.2	43%	0.429	37%	0.367	S	S	.	.	G	3₁₀ helix	trans	-52.7	-44.7	-177.5	-177.6	63.4	0	0	0	112.3	K25 I26 A29 L34 S38 L39	K25-L36 HydrophobicContact CB-CD1 3.94Å; I26-L36 HydrophobicContact CG1-CD1 4.05Å; I26-L36 HydrophobicContact CG1-CD2 4.41Å; A29-L36 HydrophobicContact CB-CB 4.17Å; A29-L36 HydrophobicContact CB-CD1 4.11Å; L34-L36 PolarHBondContact O-N 3.09Å; L34-L36 VanDerWaalsContact O-N 3.14Å; L36-S38 VanDerWaalsContact C-N 3.27Å; L36-S38 PolarHBondContact O-N 3.42Å; L36-L39 PolarHBondContact O-N 2.78Å
37	D	89.5	Confident	91.6	Very high	163 Å²	163	64.8 Å²	64.8	87%	0.872	37%	0.37	S	S	*	.	G	3₁₀ helix	trans	-65.6	-28.1	-175.2	-64.1	-10.1	0	0	0	113.7	P35	P35-D37 VanDerWaalsContact C-N 3.27Å; P35-D37 PolarHBondContact O-N 2.87Å
38	S	89.8	Confident	91.6	Very high	39 Å²	39	63.1 Å²	63.1	27%	0.273	36%	0.362	S	S	.	.	G	3₁₀ helix	trans	-99.3	-7.8	-178.4	-58	0	0	0	0	112.6	P35 L36 Q40 P68	P35-S38 PolarHBondContact O-N 3.15Å; P35-S38 VanDerWaalsContact O-N 3.17Å; L36-S38 VanDerWaalsContact C-N 3.27Å; L36-S38 PolarHBondContact O-N 3.42Å; S38-Q40 PolarHBondContact O-N 3.39Å; S38-P68 WeakPolarHBondContact O-CD 3.41Å
39	L	92.9	Very high	91.6	Very high	2 Å²	2	66 Å²	66	1%	0.01	38%	0.382	C	S	.	.			trans	-73.6	124.4	-172.1	-163.7	126.8	0	0	0	111.2	K25 L28 L34 P35 L36 L41 V65 V67	K25-L39 HydrophobicContact CB-CD2 3.76Å; K25-L39 HydrophobicContact CD-CD2 3.93Å; K25-L39 WeakPolarHBondContact CE-O 3.27Å; K25-L39 HydrophobicContact CG-CD2 3.49Å; K25-L39 VanDerWaalsContact CG-CD2 3.49Å; K25-L39 PolarHBondContact NZ-O 2.95Å; L28-L39 HydrophobicContact CB-CD1 4.5Å; L28-L39 HydrophobicContact CD1-CD2 4.44Å; L34-L39 HydrophobicContact CB-CD1 3.55Å; L34-L39 HydrophobicContact CD1-CD1 3.51Å; L34-L39 HydrophobicContact CG-CD1 4.17Å; P35-L39 PolarHBondContact O-N 2.96Å; L36-L39 PolarHBondContact O-N 2.78Å; L39-L41 HydrophobicContact CD2-CD2 3.91Å; L39-L41 HydrophobicContact CD2-CG 4.26Å; L39-V65 HydrophobicContact CD1-CG1 3.84Å; L39-V65 HydrophobicContact CD2-CG1 4.18Å; L39-V65 HydrophobicContact CG-CG1 4.01Å; L39-V67 HydrophobicContact CD1-CG2 4.09Å; L39-V67 HydrophobicContact CG-CG2 4.45Å
40	Q	93.7	Very high	91.6	Very high	65 Å²	65	69.5 Å²	69.5	30%	0.304	40%	0.399	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.2	139.5	179.7	-65.4	177.2	-16.6	0	0	109.6	S38 Y42 L47 V66	S38-Q40 PolarHBondContact O-N 3.39Å; Q40-Y42 HydrophobicContact CB-CD2 4.33Å; Q40-Y42 HydrophobicContact CB-CE2 3.69Å; Q40-Y42 PolarHBondContact OE1-OH 2.76Å; Q40-L47 HydrophobicContact CB-CD1 3.99Å; Q40-L47 HydrophobicContact CG-CD1 4.33Å; Q40-V66 PolarHBondContact N-O 3.48Å; Q40-V66 PolarHBondContact O-N 2.82Å
41	L	94.4	Very high	91.5	Very high	0 Å²	0	68.6 Å²	68.6	0%	0	40%	0.402	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.7	128.6	179.3	-62.3	175.2	0	0	0	108.4	A21 L24 K25 L28 L39 I48 I63 V65	A21-L41 HydrophobicContact CB-CD1 4.09Å; L24-L41 HydrophobicContact CD2-CD1 3.53Å; L24-L41 HydrophobicContact CD2-CD2 3.55Å; L24-L41 HydrophobicContact CD2-CG 4.18Å; K25-L41 HydrophobicContact CD-CD1 4.4Å; K25-L41 HydrophobicContact CG-CD1 3.55Å; K25-L41 HydrophobicContact CG-CG 3.94Å; L28-L41 HydrophobicContact CD1-CD2 4.04Å; L39-L41 HydrophobicContact CD2-CD2 3.91Å; L39-L41 HydrophobicContact CD2-CG 4.26Å; L41-I48 HydrophobicContact CB-CB 4.1Å; L41-I48 HydrophobicContact CB-CD1 4.31Å; L41-I48 PolarHBondContact O-N 3.44Å; L41-I63 HydrophobicContact CB-CG2 4.02Å; L41-I63 HydrophobicContact CD2-CG2 3.98Å; L41-I63 HydrophobicContact CG-CG2 4.47Å; L41-V65 HydrophobicContact CD2-CB 4.47Å; L41-V65 HydrophobicContact CD2-CG1 4.39Å; L41-V65 HydrophobicContact CD2-CG2 3.89Å
42	Y	94.2	Very high	91.5	Very high	63 Å²	63	65.2 Å²	65.2	25%	0.247	39%	0.388	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120	140.2	179.8	-73	-90.4	0	0	0	110.9	Q40 S46 L47 I63 D64 V66	Q40-Y42 HydrophobicContact CB-CD2 4.33Å; Q40-Y42 HydrophobicContact CB-CE2 3.69Å; Q40-Y42 PolarHBondContact OE1-OH 2.76Å; Y42-S46 CarbonylContact C-O 3.53Å; Y42-S46 VanDerWaalsContact CA-O 3.28Å; Y42-S46 WeakPolarHBondContact CA-O 3.38Å; Y42-L47 HydrophobicContact CD1-CB 4.33Å; Y42-L47 HydrophobicContact CE1-CB 3.95Å; Y42-L47 HydrophobicContact CE1-CD1 4.08Å; Y42-L47 HydrophobicContact CE2-CD1 4.05Å; Y42-I63 CarbonylContact O-C 3.51Å; Y42-I63 VanDerWaalsContact O-CA 3.29Å; Y42-I63 WeakPolarHBondContact O-CA 3.28Å; Y42-D64 PolarHBondContact N-O 3.16Å; Y42-D64 PolarHBondContact O-N 3.14Å; Y42-V66 HydrophobicContact CD2-CB 4.17Å; Y42-V66 HydrophobicContact CD2-CG2 3.8Å; Y42-V66 HydrophobicContact CE2-CB 4.11Å; Y42-V66 HydrophobicContact CE2-CG2 4.13Å
43	N	91.9	Very high	91.6	Very high	29 Å²	29	67 Å²	67	16%	0.155	40%	0.402	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	120	165.6	175	13.2	0	0	0	108.5	G45 S46 I48 L57 T61	N43-G45 PolarHBondContact O-N 2.94Å; N43-G45 VanDerWaalsContact O-N 3.1Å; N43-S46 PolarHBondContact N-O 2.99Å; N43-S46 WeakPolarHBondContact O-CB 3.08Å; N43-S46 PolarHBondContact O-N 3.38Å; N43-I48 HydrophobicContact CB-CD1 3.75Å; N43-I48 HydrophobicContact CB-CG1 4.07Å; N43-L57 WeakPolarHBondContact ND2-CD2 3.24Å; N43-T61 HydrophobicContact CB-CG2 4.12Å; N43-T61 WeakPolarHBondContact ND2-CG2 3.24Å; N43-T61 WeakPolarHBondContact OD1-CG2 3.07Å
44	C	87.6	Confident	91.5	Very high	120 Å²	120	60 Å²	60	81%	0.811	37%	0.365	S	S	*	.	T	Hydrogen-bonded Turn	trans	49.6	37.9	-180	-67.4	0	0	0	0	113.3	S46	C44-S46 VanDerWaalsContact C-N 3.29Å; C44-S46 PolarHBondContact O-N 3.47Å
45	G	88.2	Confident	91.5	Very high	64 Å²	64	61.5 Å²	61.5	66%	0.66	38%	0.381	S	S	*	.	T	Hydrogen-bonded Turn	trans	80.9	-4.6	-177.9	0	0	0	0	0	115.7	N43	N43-G45 PolarHBondContact O-N 2.94Å; N43-G45 VanDerWaalsContact O-N 3.1Å
46	S	90.9	Very high	91.4	Very high	81 Å²	81	62.3 Å²	62.3	57%	0.566	39%	0.388	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-91	133.9	172.8	-171.2	0	0	0	0	111.1	Y42 N43 C44 I48	Y42-S46 CarbonylContact C-O 3.53Å; Y42-S46 VanDerWaalsContact CA-O 3.28Å; Y42-S46 WeakPolarHBondContact CA-O 3.38Å; N43-S46 PolarHBondContact N-O 2.99Å; N43-S46 WeakPolarHBondContact O-CB 3.08Å; N43-S46 PolarHBondContact O-N 3.38Å; C44-S46 VanDerWaalsContact C-N 3.29Å; C44-S46 PolarHBondContact O-N 3.47Å; S46-I48 PolarHBondContact O-N 2.62Å
47	L	93.7	Very high	91.1	Very high	92 Å²	92	59.2 Å²	59.2	48%	0.482	37%	0.372	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.8	127.1	176.4	-177.5	70.5	0	0	0	110	Q40 Y42	Q40-L47 HydrophobicContact CB-CD1 3.99Å; Q40-L47 HydrophobicContact CG-CD1 4.33Å; Y42-L47 HydrophobicContact CD1-CB 4.33Å; Y42-L47 HydrophobicContact CE1-CB 3.95Å; Y42-L47 HydrophobicContact CE1-CD1 4.08Å; Y42-L47 HydrophobicContact CE2-CD1 4.05Å
48	I	93.6	Very high	90.9	Very high	4 Å²	4	55.3 Å²	55.3	2%	0.021	36%	0.357	C	S	.	.	P	Polyproline II helix	trans	-84.1	124.4	172.9	-64.1	165.8	0	0	0	108.1	A21 L41 N43 S46 Q52 L57 I63	A21-I48 HydrophobicContact CB-CG2 3.49Å; A21-I48 VanDerWaalsContact CB-CG2 3.49Å; L41-I48 HydrophobicContact CB-CB 4.1Å; L41-I48 HydrophobicContact CB-CD1 4.31Å; L41-I48 PolarHBondContact O-N 3.44Å; N43-I48 HydrophobicContact CB-CD1 3.75Å; N43-I48 HydrophobicContact CB-CG1 4.07Å; S46-I48 PolarHBondContact O-N 2.62Å; I48-Q52 HydrophobicContact CG2-CB 3.95Å; I48-Q52 HydrophobicContact CG2-CG 4.37Å; I48-L57 HydrophobicContact CD1-CD1 4.34Å; I48-I63 HydrophobicContact CD1-CD1 4.21Å; I48-I63 HydrophobicContact CD1-CG1 4.04Å; I48-I63 HydrophobicContact CD1-CG2 4.05Å
49	S	93.2	Very high	90.3	Very high	61 Å²	61	57.1 Å²	57.1	43%	0.427	37%	0.37	S	S	.	.	P	Polyproline II helix	trans	-76.6	152.4	176.4	61.2	0	0	0	0	111.5	A21 S51 Q52	A21-S49 VanDerWaalsContact CB-O 3.28Å; A21-S49 WeakPolarHBondContact CB-O 3.47Å; S49-S51 PolarHBondContact O-N 3.17Å; S49-S51 VanDerWaalsContact O-N 3.14Å; S49-Q52 VanDerWaalsContact O-CB 3.28Å; S49-Q52 WeakPolarHBondContact O-CB 3.41Å; S49-Q52 PolarHBondContact O-N 3.33Å
50	D	92.6	Very high	89.8	Confident	85 Å²	85	63.4 Å²	63.4	46%	0.455	40%	0.404	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61.6	-26.3	-175.2	-67.4	-21.3	0	0	0	113.7	T20 A22 K25	T20-D50 WeakPolarHBondContact CG2-O 3.39Å; A22-D50 HydrophobicContact CB-CB 4.28Å; A22-D50 WeakPolarHBondContact CB-O 3.04Å; A22-D50 PolarHBondContact N-O 2.88Å; A22-D50 VanDerWaalsContact N-O 3.16Å; K25-D50 WeakPolarHBondContact CD-OD1 3.47Å; K25-D50 WeakPolarHBondContact CE-OD1 3.17Å; K25-D50 IonicContact NZ-OD1 2.62Å; K25-D50 PolarHBondContact NZ-OD1 2.96Å; K25-D50 IonicContact NZ-OD2 3.91Å
51	S	91.8	Very high	89.4	Confident	103 Å²	103	60.5 Å²	60.5	72%	0.72	39%	0.39	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.2	-4.3	178.3	62.3	0	0	0	0	114	S49 S53	S49-S51 PolarHBondContact O-N 3.17Å; S49-S51 VanDerWaalsContact O-N 3.14Å; S51-S53 PolarHBondContact O-N 3.36Å
52	Q	91.9	Very high	89.2	Confident	59 Å²	59	62 Å²	62	28%	0.276	40%	0.401	S	S	.	.			trans	-74.6	129.4	-175.4	-171.4	170.5	-3.7	0	0	110.7	T20 A21 I48 S49	T20-Q52 WeakPolarHBondContact CG2-O 3.27Å; A21-Q52 PolarHBondContact N-O 3.28Å; I48-Q52 HydrophobicContact CG2-CB 3.95Å; I48-Q52 HydrophobicContact CG2-CG 4.37Å; S49-Q52 VanDerWaalsContact O-CB 3.28Å; S49-Q52 WeakPolarHBondContact O-CB 3.41Å; S49-Q52 PolarHBondContact O-N 3.33Å
53	S	92.3	Very high	89.2	Confident	54 Å²	54	59 Å²	59	38%	0.378	39%	0.389	S	S	.	.	B	Isolated β-bridge	trans	-70.7	128.9	174.1	-176.3	0	0	0	0	110.4	P19 S51 A55 S56	P19-S53 WeakPolarHBondContact O-CA 3.28Å; P19-S53 PolarHBondContact O-OG 3.14Å; S51-S53 PolarHBondContact O-N 3.36Å; S53-A55 PolarHBondContact O-N 3.27Å; S53-A55 PolarHBondContact OG-N 2.88Å; S53-S56 PolarHBondContact O-N 3.38Å; S53-S56 VanDerWaalsContact O-N 3.17Å; S53-S56 PolarHBondContact O-OG 2.87Å
54	L	89.2	Confident	89.3	Confident	0 Å²	0	60.4 Å²	60.4	0%	0	40%	0.397	C	S	.	.	G	3₁₀ helix	trans	-69.4	-23.1	178	-63.3	-179.4	0	0	0	112.2	T15 C18 P19 A21 L24 S56 L57 I63	T15-L54 HydrophobicContact CG2-CB 3.84Å; C18-L54 HydrophobicContact CB-CD1 4.35Å; C18-L54 WeakPolarHBondContact O-CD1 3.35Å; P19-L54 PolarHBondContact O-N 3.36Å; A21-L54 HydrophobicContact CB-CD2 4.31Å; L24-L54 HydrophobicContact CB-CD1 3.84Å; L24-L54 HydrophobicContact CD1-CD1 3.37Å; L24-L54 HydrophobicContact CD1-CD2 4.45Å; L24-L54 HydrophobicContact CG-CD1 4.26Å; L54-S56 PolarHBondContact O-N 2.83Å; L54-L57 HydrophobicContact CB-CD1 4.42Å; L54-L57 HydrophobicContact CD2-CD1 3.69Å; L54-L57 WeakPolarHBondContact O-CB 3.39Å; L54-L57 PolarHBondContact O-N 2.72Å; L54-I63 HydrophobicContact CD2-CD1 3.85Å
55	A	88.7	Confident	89.6	Confident	59 Å²	59	55.8 Å²	55.8	49%	0.488	37%	0.365	S	S	.	.	G	3₁₀ helix	trans	-69.4	-18.2	174.9	0	0	0	0	0	113.3	S53 L57	S53-A55 PolarHBondContact O-N 3.27Å; S53-A55 PolarHBondContact OG-N 2.88Å; A55-L57 VanDerWaalsContact C-N 3.26Å
56	S	88.6	Confident	89.8	Confident	83 Å²	83	55.6 Å²	55.6	58%	0.58	35%	0.351	S	S	*	.	G	3₁₀ helix	trans	-81.1	-8.2	176.4	83.9	0	0	0	0	113	S53 L54	S53-S56 PolarHBondContact O-N 3.38Å; S53-S56 VanDerWaalsContact O-N 3.17Å; S53-S56 PolarHBondContact O-OG 2.87Å; L54-S56 PolarHBondContact O-N 2.83Å
57	L	85.5	Confident	89.8	Confident	18 Å²	18	54.4 Å²	54.4	9%	0.094	34%	0.34	C	S	.	.	S	Bend	trans	-79.3	163.4	176.7	-60.6	165.4	0	0	0	109.5	M1 N43 I48 L54 A55 T61 I63	M1-L57 HydrophobicContact CE-CB 4.17Å; M1-L57 WeakPolarHBondContact CE-O 3Å; N43-L57 WeakPolarHBondContact ND2-CD2 3.24Å; I48-L57 HydrophobicContact CD1-CD1 4.34Å; L54-L57 HydrophobicContact CB-CD1 4.42Å; L54-L57 HydrophobicContact CD2-CD1 3.69Å; L54-L57 WeakPolarHBondContact O-CB 3.39Å; L54-L57 PolarHBondContact O-N 2.72Å; A55-L57 VanDerWaalsContact C-N 3.26Å; L57-T61 HydrophobicContact CB-CG2 4.25Å; L57-T61 HydrophobicContact CD1-CG2 4.3Å; L57-I63 HydrophobicContact CD1-CD1 4.06Å
58	S	84.4	Confident	89.5	Confident	80 Å²	80	52.7 Å²	52.7	56%	0.559	33%	0.334	S	S	*	.			trans	-72.5	150.9	175.2	56.5	0	0	0	0	110.9	M1 D60 T61	M1-S58 WeakPolarHBondContact CE-O 3.42Å; S58-D60 PolarHBondContact O-N 3.13Å; S58-T61 PolarHBondContact N-OG1 2.98Å; S58-T61 VanDerWaalsContact N-OG1 3.13Å; S58-T61 VanDerWaalsContact O-CB 3.24Å; S58-T61 WeakPolarHBondContact O-CB 3.43Å; S58-T61 PolarHBondContact O-N 2.9Å; S58-T61 PolarHBondContact O-OG1 3.03Å; S58-T61 PolarHBondContact OG-OG1 3.19Å
59	S	77.2	Confident	88.8	Confident	78 Å²	78	56.7 Å²	56.7	55%	0.545	37%	0.368	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57.3	-23.5	-174	50	0	0	0	0	114.8	K2	K2-S59 VanDerWaalsContact O-O 3.05Å
60	D	81.8	Confident	87.9	Confident	133 Å²	133	61.9 Å²	61.9	71%	0.711	39%	0.39	S	S	*	.	T	Hydrogen-bonded Turn	trans	-108.5	23.6	-179.2	-57.5	-33.5	0	0	0	112.2	S58 S62	S58-D60 PolarHBondContact O-N 3.13Å; D60-S62 PolarHBondContact O-N 2.86Å
61	T	85.8	Confident	86.8	Confident	4 Å²	4	61.5 Å²	61.5	3%	0.025	41%	0.406	C	S	.	.	P	Polyproline II helix	trans	-66.5	128.4	179.7	-65.5	0	0	0	0	111	F4 N43 L57 S58 I63	F4-T61 PolarHBondContact N-O 3.26Å; F4-T61 VanDerWaalsContact N-O 3.15Å; N43-T61 HydrophobicContact CB-CG2 4.12Å; N43-T61 WeakPolarHBondContact ND2-CG2 3.24Å; N43-T61 WeakPolarHBondContact OD1-CG2 3.07Å; L57-T61 HydrophobicContact CB-CG2 4.25Å; L57-T61 HydrophobicContact CD1-CG2 4.3Å; S58-T61 PolarHBondContact N-OG1 2.98Å; S58-T61 VanDerWaalsContact N-OG1 3.13Å; S58-T61 VanDerWaalsContact O-CB 3.24Å; S58-T61 WeakPolarHBondContact O-CB 3.43Å; S58-T61 PolarHBondContact O-N 2.9Å; S58-T61 PolarHBondContact O-OG1 3.03Å; S58-T61 PolarHBondContact OG-OG1 3.19Å; T61-I63 HydrophobicContact CG2-CG1 4.04Å
62	S	91.2	Very high	85.6	Confident	32 Å²	32	59.5 Å²	59.5	22%	0.224	40%	0.401	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99	120.5	164.7	69.6	0	0	0	0	110.9	F4 K6 D60	F4-S62 CarbonylContact O-C 3.5Å; F4-S62 VanDerWaalsContact O-CA 3.29Å; F4-S62 WeakPolarHBondContact O-CA 2.98Å; K6-S62 PolarHBondContact NZ-OG 3.39Å; D60-S62 PolarHBondContact O-N 2.86Å
63	I	93.8	Very high	84.5	Confident	0 Å²	0	67.4 Å²	67.4	0%	0	44%	0.435	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.3	120.4	176.8	-58.1	175.6	0	0	0	108.5	V3 F4 V5 K6 L24 L41 Y42 I48 L54 L57 T61	V3-I63 HydrophobicContact CB-CD1 4.26Å; V3-I63 HydrophobicContact CG2-CD1 4.27Å; F4-I63 PolarHBondContact O-N 3Å; V5-I63 WeakPolarHBondContact CA-O 3.5Å; V5-I63 HydrophobicContact CG2-CB 4.41Å; K6-I63 PolarHBondContact N-O 3.19Å; L24-I63 HydrophobicContact CD1-CD1 4.11Å; L41-I63 HydrophobicContact CB-CG2 4.02Å; L41-I63 HydrophobicContact CD2-CG2 3.98Å; L41-I63 HydrophobicContact CG-CG2 4.47Å; Y42-I63 CarbonylContact O-C 3.51Å; Y42-I63 VanDerWaalsContact O-CA 3.29Å; Y42-I63 WeakPolarHBondContact O-CA 3.28Å; I48-I63 HydrophobicContact CD1-CD1 4.21Å; I48-I63 HydrophobicContact CD1-CG1 4.04Å; I48-I63 HydrophobicContact CD1-CG2 4.05Å; L54-I63 HydrophobicContact CD2-CD1 3.85Å; L57-I63 HydrophobicContact CD1-CD1 4.06Å; T61-I63 HydrophobicContact CG2-CG1 4.04Å
64	D	94.2	Very high	83.4	Confident	59 Å²	59	71 Å²	71	32%	0.316	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.4	127.5	174.3	-62.7	-39.5	0	0	0	109.8	K6 Y42	K6-D64 VanDerWaalsContact CD-OD1 3.27Å; K6-D64 WeakPolarHBondContact CD-OD1 3.28Å; Y42-D64 PolarHBondContact N-O 3.16Å; Y42-D64 PolarHBondContact O-N 3.14Å
65	V	93.7	Very high	82.5	Confident	23 Å²	23	80.3 Å²	80.3	14%	0.139	50%	0.498	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.1	119.5	179.5	-175.5	0	0	0	0	108.6	V5 K6 L28 L34 L39 L41	V5-V65 HydrophobicContact CG1-CG2 3.51Å; K6-V65 PolarHBondContact O-N 3.5Å; L28-V65 HydrophobicContact CD1-CB 4.31Å; L28-V65 HydrophobicContact CD1-CG1 3.93Å; L28-V65 HydrophobicContact CD1-CG2 3.37Å; L34-V65 HydrophobicContact CD1-CG1 4.11Å; L39-V65 HydrophobicContact CD1-CG1 3.84Å; L39-V65 HydrophobicContact CD2-CG1 4.18Å; L39-V65 HydrophobicContact CG-CG1 4.01Å; L41-V65 HydrophobicContact CD2-CB 4.47Å; L41-V65 HydrophobicContact CD2-CG1 4.39Å; L41-V65 HydrophobicContact CD2-CG2 3.89Å
66	V	92.7	Very high	81.9	Confident	60 Å²	60	80.1 Å²	80.1	36%	0.364	50%	0.501	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	127.7	-177.6	-178.8	0	0	0	0	109.4	Q40 Y42	Q40-V66 PolarHBondContact N-O 3.48Å; Q40-V66 PolarHBondContact O-N 2.82Å; Y42-V66 HydrophobicContact CD2-CB 4.17Å; Y42-V66 HydrophobicContact CD2-CG2 3.8Å; Y42-V66 HydrophobicContact CE2-CB 4.11Å; Y42-V66 HydrophobicContact CE2-CG2 4.13Å
67	V	90.5	Very high	81.6	Confident	56 Å²	56	80.6 Å²	80.6	34%	0.339	50%	0.504	S	S	.	.			trans	-110.8	108.3	166.2	180	0	0	0	0	107.5	L34 P35 L39 A69	L34-V67 HydrophobicContact CB-CG2 4.22Å; L34-V67 HydrophobicContact CD1-CG2 4.23Å; L34-V67 HydrophobicContact CD2-CG2 4Å; L34-V67 HydrophobicContact CG-CG2 4.37Å; P35-V67 HydrophobicContact CG-CG1 3.61Å; L39-V67 HydrophobicContact CD1-CG2 4.09Å; L39-V67 HydrophobicContact CG-CG2 4.45Å; V67-A69 PolarHBondContact O-N 3.4Å
68	P	86.3	Confident	81.6	Confident	56 Å²	56	87.3 Å²	87.3	36%	0.364	54%	0.54	S	S	.	.	P	Polyproline II helix	trans	-67.1	130	-178.5	27.7	-31	0	0	0	109.6	S38 L70	S38-P68 WeakPolarHBondContact O-CD 3.41Å; P68-L70 PolarHBondContact O-N 2.86Å
69	A	79.7	Confident	81.6	Confident	88 Å²	88	87.6 Å²	87.6	73%	0.727	55%	0.547	S	S	*	.	P	Polyproline II helix	trans	-62.8	132.7	170.7	0	0	0	0	0	109.7	V67 G71	V67-A69 PolarHBondContact O-N 3.4Å; A69-G71 PolarHBondContact O-N 3.1Å
70	L	73.9	Confident	82	Confident	170 Å²	170	93.5 Å²	93.5	89%	0.89	56%	0.558	S	S	*	*	S	Bend	trans	-62.9	118.7	173.1	-62.9	175.9	0	0	0	108.8	P68	P68-L70 PolarHBondContact O-N 2.86Å
71	G	69.2	Low	82.5	Confident	76 Å²	76	91 Å²	91	78%	0.784	56%	0.556	S	S	*	*	S	Bend	trans	102	73.9	-178.9	0	0	0	0	0	114.1	A69	A69-G71 PolarHBondContact O-N 3.1Å
72	G	67	Low	82.8	Confident	61 Å²	61	93.4 Å²	93.4	63%	0.629	58%	0.58	S	S	*	*			trans	-68.7	168.5	173.7	0	0	0	0	0	113.8	V74	G72-V74 PolarHBondContact O-N 2.89Å
73	K	68.6	Low	83	Confident	225 Å²	225	97.7 Å²	97.7	98%	0.978	60%	0.595	S	S	*	*			trans	-64.4	94.6	172.4	-70.2	-179.2	-178.6	175	0	110
74	V	69.7	Low	83	Confident	130 Å²	130	102.9 Å²	102.9	79%	0.788	63%	0.627	S	S	*	*			trans	-82.8	121.4	169.9	179.4	0	0	0	0	108.8	G72	G72-V74 PolarHBondContact O-N 2.89Å
75	H	71.3	Confident	83.1	Confident	196 Å²	196	110.8 Å²	110.8	91%	0.907	65%	0.652	S	S	*	*	S	Bend	trans	-76.5	141.8	173.2	-173.5	73.9	0	0	0	110.6
76	G	75.3	Confident	83	Confident	55 Å²	55	113.1 Å²	113.1	57%	0.567	68%	0.68	S	S	*	*	S	Bend	trans	88.9	82.3	-178.5	0	0	0	0	0	113.4
77	S	81.4	Confident	83.2	Confident	92 Å²	92	116.7 Å²	116.7	64%	0.643	69%	0.693	S	S	*	*			trans	-69.7	146.4	178.2	63.9	0	0	0	0	112.5	A79	S77-A79 PolarHBondContact O-N 3.1Å; S77-A79 VanDerWaalsContact O-N 3.1Å
78	L	85.3	Confident	83.4	Confident	159 Å²	159	118.2 Å²	118.2	83%	0.832	70%	0.702	S	S	*	*	G	3₁₀ helix	trans	-69	0.5	174	-76.9	162.5	0	0	0	113.8	R80 A81	L78-R80 PolarHBondContact O-N 3.3Å; L78-A81 WeakPolarHBondContact O-CB 3.37Å; L78-A81 PolarHBondContact O-N 3.35Å; L78-A81 VanDerWaalsContact O-N 3.11Å
79	A	84.5	Confident	83.9	Confident	87 Å²	87	120.4 Å²	120.4	72%	0.719	72%	0.717	S	S	*	*	G	3₁₀ helix	trans	-60.9	-21	-172.1	0	0	0	0	0	114.8	S77	S77-A79 PolarHBondContact O-N 3.1Å; S77-A79 VanDerWaalsContact O-N 3.1Å
80	R	85.8	Confident	84.6	Confident	202 Å²	202	125.9 Å²	125.9	76%	0.762	72%	0.724	S	S	*	*	G	3₁₀ helix	trans	-99.7	2.2	-178.8	-63	-174.5	-66	-178.6	-0.1	113.9	L78 G82 K83	L78-R80 PolarHBondContact O-N 3.3Å; R80-G82 PolarHBondContact O-N 3.27Å; R80-K83 PolarHBondContact O-N 3.11Å
81	A	92	Very high	85.6	Confident	81 Å²	81	123.7 Å²	123.7	67%	0.669	72%	0.718	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60	127.9	179.4	0	0	0	0	0	110.6	L78 K83	L78-A81 WeakPolarHBondContact O-CB 3.37Å; L78-A81 PolarHBondContact O-N 3.35Å; L78-A81 VanDerWaalsContact O-N 3.11Å; A81-K83 VanDerWaalsContact C-N 3.31Å; A81-K83 PolarHBondContact O-N 3.05Å
82	G	92.3	Very high	86.9	Confident	53 Å²	53	128.3 Å²	128.3	55%	0.546	72%	0.719	S	S	.	*	T	Hydrogen-bonded Turn	trans	77.3	1	176.2	0	0	0	0	0	116.7	R80 V84 R85 G86	R80-G82 PolarHBondContact O-N 3.27Å; G82-V84 PolarHBondContact O-N 2.99Å; G82-R85 PolarHBondContact O-N 3.11Å; G82-R85 VanDerWaalsContact O-N 3.11Å; G82-G86 PolarHBondContact O-N 3.31Å
83	K	95.2	Very high	88.2	Confident	123 Å²	123	135.2 Å²	135.2	54%	0.535	73%	0.731	S	S	.	*	H	α-helix	trans	-48.5	-54.2	-177.5	-178.7	-179.7	177.6	-179	0	113	R80 A81 R85 G86 Q87	R80-K83 PolarHBondContact O-N 3.11Å; A81-K83 VanDerWaalsContact C-N 3.31Å; A81-K83 PolarHBondContact O-N 3.05Å; K83-R85 PolarHBondContact O-N 3.33Å; K83-G86 PolarHBondContact O-N 3.45Å; K83-Q87 VanDerWaalsContact CE-NE2 3.34Å; K83-Q87 WeakPolarHBondContact O-CB 3.5Å; K83-Q87 VanDerWaalsContact O-CG 3.3Å; K83-Q87 WeakPolarHBondContact O-CG 3.47Å; K83-Q87 PolarHBondContact O-N 3.07Å
84	V	95.5	Very high	89.4	Confident	109 Å²	109	132.1 Å²	132.1	66%	0.661	72%	0.72	S	S	*	*	H	α-helix	trans	-66.7	-38.3	-176.5	179.7	0	0	0	0	111.6	G82 G86 Q87 T88	G82-V84 PolarHBondContact O-N 2.99Å; V84-G86 VanDerWaalsContact C-N 3.32Å; V84-G86 PolarHBondContact O-N 2.74Å; V84-Q87 PolarHBondContact O-N 3.25Å; V84-T88 WeakPolarHBondContact O-CB 3.3Å; V84-T88 PolarHBondContact O-N 3.41Å; V84-T88 PolarHBondContact O-OG1 3.45Å
85	R	94.4	Very high	90.5	Very high	225 Å²	225	135.4 Å²	135.4	85%	0.849	73%	0.727	S	S	*	*	H	α-helix	trans	-65.7	-36	178.9	-172.7	177.3	179.8	-177.7	-0.6	111.9	G82 K83	G82-R85 PolarHBondContact O-N 3.11Å; G82-R85 VanDerWaalsContact O-N 3.11Å; K83-R85 PolarHBondContact O-N 3.33Å
86	G	93.4	Very high	91.5	Very high	71 Å²	71	134.6 Å²	134.6	73%	0.732	72%	0.721	S	S	*	*	H	α-helix	trans	-77.7	-30.9	176.3	0	0	0	0	0	114	G82 K83 V84	G82-G86 PolarHBondContact O-N 3.31Å; K83-G86 PolarHBondContact O-N 3.45Å; V84-G86 VanDerWaalsContact C-N 3.32Å; V84-G86 PolarHBondContact O-N 2.74Å
87	Q	95.9	Very high	92.4	Very high	136 Å²	136	142 Å²	142	64%	0.636	74%	0.738	S	S	*	*	H	α-helix	trans	-80.2	-22.6	179.1	-72.1	-177.7	-16.1	0	0	113.7	K83 V84	K83-Q87 VanDerWaalsContact CE-NE2 3.34Å; K83-Q87 WeakPolarHBondContact O-CB 3.5Å; K83-Q87 VanDerWaalsContact O-CG 3.3Å; K83-Q87 WeakPolarHBondContact O-CG 3.47Å; K83-Q87 PolarHBondContact O-N 3.07Å; V84-Q87 PolarHBondContact O-N 3.25Å
88	T	95.8	Very high	92.9	Very high	87 Å²	87	147.7 Å²	147.7	53%	0.534	75%	0.751	S	S	.	*	S	Bend	trans	-78.2	121.7	-178.3	-54.6	0	0	0	0	109.9	V84 K90	V84-T88 WeakPolarHBondContact O-CB 3.3Å; V84-T88 PolarHBondContact O-N 3.41Å; V84-T88 PolarHBondContact O-OG1 3.45Å; T88-K90 PolarHBondContact O-N 3.37Å
89	P	95.8	Very high	93.2	Very high	102 Å²	102	143.9 Å²	143.9	66%	0.662	74%	0.737	S	S	*	*			trans	-59.8	135.8	179.6	25.2	-34.1	0	0	0	110.6	V91	P89-V91 PolarHBondContact O-N 3.23Å
90	K	94.9	Very high	93.7	Very high	204 Å²	204	142.1 Å²	142.1	89%	0.887	72%	0.719	S	S	*	*			trans	-80.6	83.2	-179.1	-167.6	177	-177.8	-174.9	0	110.1	T88 E92	T88-K90 PolarHBondContact O-N 3.37Å; K90-E92 PolarHBondContact O-N 3.02Å
91	V	95.3	Very high	94.1	Very high	124 Å²	124	143 Å²	143	75%	0.752	72%	0.722	S	S	*	*			trans	-66.9	117.5	178	-176.6	0	0	0	0	109.8	P89	P89-V91 PolarHBondContact O-N 3.23Å
92	E	94.6	Very high	94.4	Very high	173 Å²	173	141.7 Å²	141.7	81%	0.808	72%	0.717	S	S	*	*			trans	-64.6	145.6	176.8	-65.2	-169.3	163.1	0	0	111.4	K90 Q94	K90-E92 PolarHBondContact O-N 3.02Å; E92-Q94 PolarHBondContact O-N 2.98Å
93	K	95.2	Very high	94.6	Very high	205 Å²	205	148.3 Å²	148.3	89%	0.891	73%	0.725	S	S	*	*			trans	-74.7	113.9	177.7	-69.2	179.9	-178.8	174.3	0	108.6	E95	K93-E95 PolarHBondContact O-N 3.48Å
94	Q	93.6	Very high	94.7	Very high	160 Å²	160	145.2 Å²	145.2	75%	0.748	72%	0.723	S	S	*	*			trans	-61	135.6	169.9	-64.5	174.3	6.1	0	0	110.2	E92 K96	E92-Q94 PolarHBondContact O-N 2.98Å; Q94-K96 PolarHBondContact O-N 3.26Å
95	E	92.2	Very high	94.8	Very high	200 Å²	200	145.5 Å²	145.5	94%	0.935	72%	0.715	S	S	*	*			trans	-65.5	121.2	173.4	-65.5	-165	164.3	0	0	110.2	K93	K93-E95 PolarHBondContact O-N 3.48Å
96	K	93.6	Very high	94.9	Very high	179 Å²	179	143.1 Å²	143.1	78%	0.778	71%	0.706	S	S	*	*			trans	-111.3	141.6	174.3	-67.7	-179.8	-179.1	178.3	0	109	Q94 K98	Q94-K96 PolarHBondContact O-N 3.26Å; K96-K98 PolarHBondContact O-N 3.35Å
97	K	93.6	Very high	95.1	Very high	210 Å²	210	146.8 Å²	146.8	91%	0.913	70%	0.698	S	S	*	*	P	Polyproline II helix	trans	-51.5	134.1	174.4	-66.2	-176.2	-179.4	-179.1	0	110	S99	K97-S99 PolarHBondContact O-N 3.21Å
98	K	92.5	Very high	95	Very high	211 Å²	211	145.8 Å²	145.8	92%	0.917	70%	0.695	S	S	*	*	P	Polyproline II helix	trans	-58	124.3	176.8	-68.4	-179.3	-177.9	174.4	0	108.8	K96	K96-K98 PolarHBondContact O-N 3.35Å
99	S	92	Very high	94.9	Very high	79 Å²	79	144.3 Å²	144.3	55%	0.552	68%	0.682	S	S	*	*	P	Polyproline II helix	trans	-71.5	142.8	174.8	52.3	0	0	0	0	110.4	K97	K97-S99 PolarHBondContact O-N 3.21Å
100	P	94.4	Very high	94.9	Very high	51 Å²	51	145.9 Å²	145.9	33%	0.331	68%	0.675	S	S	.	*	P	Polyproline II helix	trans	-60	150.2	176.4	25.1	-33.2	0	0	0	110.5	A104 K105 M108	P100-A104 HydrophobicContact CB-CB 4.1Å; P100-K105 VanDerWaalsContact O-CB 3.32Å; P100-K105 WeakPolarHBondContact O-CB 3.32Å; P100-K105 WeakPolarHBondContact O-CD 3.48Å; P100-K105 WeakPolarHBondContact O-CG 3.48Å; P100-M108 HydrophobicContact CG-CE 3.67Å; P100-M108 HydrophobicContact CG-SD 4.3Å
101	R	95	Very high	94.8	Very high	220 Å²	220	139.7 Å²	139.7	83%	0.83	65%	0.652	S	S	*	*			trans	-118.3	167.9	179.7	-62.3	-176	179.3	-171.8	-0.9	110.7
102	G	97.1	Very high	94.6	Very high	54 Å²	54	140.9 Å²	140.9	56%	0.557	65%	0.647	S	S	*	*	H	α-helix	trans	62.7	-139	176.3	0	0	0	0	0	114.5	A104 K105 R106	G102-A104 VanDerWaalsContact C-N 3.29Å; G102-A104 PolarHBondContact O-N 3.41Å; G102-K105 WeakPolarHBondContact O-CB 3.44Å; G102-K105 PolarHBondContact O-N 3.32Å; G102-K105 VanDerWaalsContact O-N 3.14Å; G102-R106 PolarHBondContact O-N 3.16Å; G102-R106 VanDerWaalsContact O-N 3.16Å
103	R	97.2	Very high	94.4	Very high	191 Å²	191	139.5 Å²	139.5	72%	0.721	63%	0.634	S	S	*	*	H	α-helix	trans	-58.8	-38.3	-175.7	-171	173	-175.2	-101	3.4	112.9	K105 R106 R107	R103-K105 PolarHBondContact O-N 3.14Å; R103-R106 PolarHBondContact O-N 3.29Å; R103-R107 VanDerWaalsContact NH1-NH2 3.16Å; R103-R107 PolarHBondContact O-N 3.22Å
104	A	96.7	Very high	94.1	Very high	59 Å²	59	136.1 Å²	136.1	49%	0.488	62%	0.62	S	S	.	*	H	α-helix	trans	-61.4	-42.9	177.3	0	0	0	0	0	111.8	P100 G102 R107 M108	P100-A104 HydrophobicContact CB-CB 4.1Å; G102-A104 VanDerWaalsContact C-N 3.29Å; G102-A104 PolarHBondContact O-N 3.41Å; A104-R107 PolarHBondContact O-N 2.93Å; A104-M108 PolarHBondContact O-N 3.28Å
105	K	97.5	Very high	93.8	Very high	115 Å²	115	133.2 Å²	133.2	50%	0.5	61%	0.613	S	S	.	*	H	α-helix	trans	-62.4	-43.1	175.1	-165.9	179.5	178.5	177.6	0	111.9	P100 G102 R103 M108 Q109	P100-K105 VanDerWaalsContact O-CB 3.32Å; P100-K105 WeakPolarHBondContact O-CB 3.32Å; P100-K105 WeakPolarHBondContact O-CD 3.48Å; P100-K105 WeakPolarHBondContact O-CG 3.48Å; G102-K105 WeakPolarHBondContact O-CB 3.44Å; G102-K105 PolarHBondContact O-N 3.32Å; G102-K105 VanDerWaalsContact O-N 3.14Å; R103-K105 PolarHBondContact O-N 3.14Å; K105-M108 PolarHBondContact O-N 2.98Å; K105-Q109 WeakPolarHBondContact O-CB 3.43Å; K105-Q109 PolarHBondContact O-N 3.37Å
106	R	96.8	Very high	93.3	Very high	175 Å²	175	127.3 Å²	127.3	66%	0.66	60%	0.598	S	S	*	*	H	α-helix	trans	-64.5	-41.8	178.9	-69.5	-64.4	-170.2	176.2	6.8	112	G102 R103 Q109 Y110	G102-R106 PolarHBondContact O-N 3.16Å; G102-R106 VanDerWaalsContact O-N 3.16Å; R103-R106 PolarHBondContact O-N 3.29Å; R106-Q109 PolarHBondContact O-N 3.14Å; R106-Y110 PolarHBondContact O-N 3.31Å
107	R	96.8	Very high	92.5	Very high	147 Å²	147	121.6 Å²	121.6	56%	0.555	58%	0.578	S	S	*	*	H	α-helix	trans	-59.6	-48.5	173.2	-176.4	-178.6	-74.4	176.7	-11	111.5	R103 A104 Q109 Y110 N111	R103-R107 VanDerWaalsContact NH1-NH2 3.16Å; R103-R107 PolarHBondContact O-N 3.22Å; A104-R107 PolarHBondContact O-N 2.93Å; R107-Q109 VanDerWaalsContact C-N 3.32Å; R107-Q109 PolarHBondContact O-N 3.24Å; R107-Y110 PolarHBondContact O-N 3.46Å; R107-N111 PolarHBondContact O-N 3.36Å; R107-N111 PolarHBondContact O-OD1 3.03Å
108	M	94	Very high	91.3	Very high	115 Å²	115	117.7 Å²	117.7	57%	0.567	57%	0.572	S	S	*	*	H	α-helix	trans	-59.5	-42	176.8	-176	-172.8	-75.2	0	0	112	P100 A104 K105 N111 K112	P100-M108 HydrophobicContact CG-CE 3.67Å; P100-M108 HydrophobicContact CG-SD 4.3Å; A104-M108 PolarHBondContact O-N 3.28Å; K105-M108 PolarHBondContact O-N 2.98Å; M108-N111 PolarHBondContact O-N 3.39Å; M108-K112 WeakPolarHBondContact O-CB 3.41Å; M108-K112 PolarHBondContact O-N 3.38Å
109	Q	94.1	Very high	90.1	Very high	57 Å²	57	115.1 Å²	115.1	27%	0.266	56%	0.563	S	S	.	*	H	α-helix	trans	-66	-41.2	178.2	-172.3	177.2	19.3	0	0	112.4	K105 R106 R107 K112 R113	K105-Q109 WeakPolarHBondContact O-CB 3.43Å; K105-Q109 PolarHBondContact O-N 3.37Å; R106-Q109 PolarHBondContact O-N 3.14Å; R107-Q109 VanDerWaalsContact C-N 3.32Å; R107-Q109 PolarHBondContact O-N 3.24Å; Q109-K112 PolarHBondContact O-N 3.42Å; Q109-R113 WeakPolarHBondContact O-CB 3.48Å; Q109-R113 VanDerWaalsContact O-CG 3.28Å; Q109-R113 WeakPolarHBondContact O-CG 3.21Å; Q109-R113 PolarHBondContact O-N 2.91Å
110	Y	95.2	Very high	89	Confident	134 Å²	134	117.1 Å²	117.1	53%	0.525	56%	0.564	S	S	.	*	H	α-helix	trans	-61.6	-50.1	175.2	177.7	-91.1	0	0	0	110.7	R106 R107 K112 R113 F114 V115	R106-Y110 PolarHBondContact O-N 3.31Å; R107-Y110 PolarHBondContact O-N 3.46Å; Y110-K112 VanDerWaalsContact C-N 3.32Å; Y110-K112 PolarHBondContact O-N 3.46Å; Y110-R113 PolarHBondContact O-N 3.3Å; Y110-R113 VanDerWaalsContact O-N 3.1Å; Y110-F114 AromaticContact CD2-CD2 3.42Å; Y110-F114 HydrophobicContact CD2-CD2 3.42Å; Y110-F114 VanDerWaalsContact CD2-CD2 3.42Å; Y110-F114 AromaticContact CD2-CE2 3.96Å; Y110-F114 HydrophobicContact CD2-CE2 3.96Å; Y110-F114 HydrophobicContact CD2-CG 4.39Å; Y110-F114 HydrophobicContact CE2-CB 4.31Å; Y110-F114 AromaticContact CE2-CD2 3.65Å; Y110-F114 HydrophobicContact CE2-CD2 3.65Å; Y110-F114 HydrophobicContact CE2-CE2 4.32Å; Y110-F114 HydrophobicContact CE2-CG 4.24Å; Y110-F114 HydrophobicContact CG-CD2 4.05Å; Y110-F114 PolarHBondContact O-N 2.92Å; Y110-V115 HydrophobicContact CD1-CG2 3.98Å; Y110-V115 HydrophobicContact CE1-CG2 3.62Å
111	N	93.9	Very high	87.7	Confident	74 Å²	74	121.1 Å²	121.1	40%	0.396	59%	0.59	S	S	.	*	I	π-helix	trans	-58	-45.4	178.1	-68.8	4.4	0	0	0	111.1	R107 M108 R113 V115 A116	R107-N111 PolarHBondContact O-N 3.36Å; R107-N111 PolarHBondContact O-OD1 3.03Å; M108-N111 PolarHBondContact O-N 3.39Å; N111-R113 VanDerWaalsContact C-N 3.32Å; N111-R113 PolarHBondContact O-N 2.97Å; N111-V115 PolarHBondContact O-N 3.49Å; N111-V115 VanDerWaalsContact O-N 3.16Å; N111-A116 WeakPolarHBondContact O-CB 3.4Å; N111-A116 PolarHBondContact O-N 3.03Å
112	K	90.4	Very high	86.7	Confident	149 Å²	149	115.1 Å²	115.1	65%	0.648	60%	0.596	S	S	*	*	I	π-helix	trans	-64.6	-31.6	178.1	-173.2	173.1	-179.6	176.5	0	113.5	M108 Q109 Y110	M108-K112 WeakPolarHBondContact O-CB 3.41Å; M108-K112 PolarHBondContact O-N 3.38Å; Q109-K112 PolarHBondContact O-N 3.42Å; Y110-K112 VanDerWaalsContact C-N 3.32Å; Y110-K112 PolarHBondContact O-N 3.46Å
113	R	90.2	Very high	85.4	Confident	144 Å²	144	114.4 Å²	114.4	54%	0.543	59%	0.588	S	S	.	*	I	π-helix	trans	-93.8	-26.4	-173.4	-75.4	-179.4	175.9	-172.8	-5.7	114.9	Q109 Y110 N111 V117	Q109-R113 WeakPolarHBondContact O-CB 3.48Å; Q109-R113 VanDerWaalsContact O-CG 3.28Å; Q109-R113 WeakPolarHBondContact O-CG 3.21Å; Q109-R113 PolarHBondContact O-N 2.91Å; Y110-R113 PolarHBondContact O-N 3.3Å; Y110-R113 VanDerWaalsContact O-N 3.1Å; N111-R113 VanDerWaalsContact C-N 3.32Å; N111-R113 PolarHBondContact O-N 2.97Å; R113-V117 VanDerWaalsContact C-CG2 3.4Å; R113-V117 WeakPolarHBondContact O-CG2 3.28Å
114	F	88.5	Confident	84.4	Confident	135 Å²	135	116.8 Å²	116.8	59%	0.592	60%	0.597	S	S	*	*	I	π-helix	trans	-128.1	-40.5	-170.6	-57.4	-67.6	0	0	0	112.8	Y110	Y110-F114 AromaticContact CD2-CD2 3.42Å; Y110-F114 HydrophobicContact CD2-CD2 3.42Å; Y110-F114 VanDerWaalsContact CD2-CD2 3.42Å; Y110-F114 AromaticContact CD2-CE2 3.96Å; Y110-F114 HydrophobicContact CD2-CE2 3.96Å; Y110-F114 HydrophobicContact CD2-CG 4.39Å; Y110-F114 HydrophobicContact CE2-CB 4.31Å; Y110-F114 AromaticContact CE2-CD2 3.65Å; Y110-F114 HydrophobicContact CE2-CD2 3.65Å; Y110-F114 HydrophobicContact CE2-CE2 4.32Å; Y110-F114 HydrophobicContact CE2-CG 4.24Å; Y110-F114 HydrophobicContact CG-CD2 4.05Å; Y110-F114 PolarHBondContact O-N 2.92Å
115	V	87.3	Confident	83.5	Confident	99 Å²	99	123.8 Å²	123.8	60%	0.6	61%	0.611	S	S	*	*	I	π-helix	trans	-85.1	-49	-175.4	-175.2	0	0	0	0	111.7	Y110 N111 V117	Y110-V115 HydrophobicContact CD1-CG2 3.98Å; Y110-V115 HydrophobicContact CE1-CG2 3.62Å; N111-V115 PolarHBondContact O-N 3.49Å; N111-V115 VanDerWaalsContact O-N 3.16Å; V115-V117 VanDerWaalsContact C-N 3.29Å; V115-V117 PolarHBondContact O-N 3.16Å
116	A	83.2	Confident	82.7	Confident	75 Å²	75	125.1 Å²	125.1	62%	0.62	61%	0.613	S	S	*	*	S	Bend	trans	-87.9	10.9	-175.7	0	0	0	0	0	113.7	N111 V118	N111-A116 WeakPolarHBondContact O-CB 3.4Å; N111-A116 PolarHBondContact O-N 3.03Å; A116-V118 PolarHBondContact O-N 3.35Å
117	V	76.8	Confident	82.2	Confident	59 Å²	59	119 Å²	119	36%	0.358	60%	0.604	S	S	.	*			trans	-82.5	100.2	178.1	177.5	0	0	0	0	108.9	R113 V115 Q119	R113-V117 VanDerWaalsContact C-CG2 3.4Å; R113-V117 WeakPolarHBondContact O-CG2 3.28Å; V115-V117 VanDerWaalsContact C-N 3.29Å; V115-V117 PolarHBondContact O-N 3.16Å; V117-Q119 HydrophobicContact CG1-CG 4.43Å; V117-Q119 PolarHBondContact O-N 2.81Å
118	V	68	Low	81.8	Confident	128 Å²	128	118.1 Å²	118.1	78%	0.776	62%	0.618	S	S	*	*			trans	-80	109.3	163.6	-178.4	0	0	0	0	107.3	A116 Q120	A116-V118 PolarHBondContact O-N 3.35Å; V118-Q120 PolarHBondContact O-N 3.38Å
119	Q	68.1	Low	81.7	Confident	157 Å²	157	119.4 Å²	119.4	73%	0.734	63%	0.627	S	S	*	*			trans	-68.9	110.8	167.1	-64.9	-172.2	33.7	0	0	107.1	V117 P121	V117-Q119 HydrophobicContact CG1-CG 4.43Å; V117-Q119 PolarHBondContact O-N 2.81Å; Q119-P121 WeakPolarHBondContact O-CD 3.33Å
120	Q	67.2	Low	81.4	Confident	122 Å²	122	119.2 Å²	119.2	57%	0.57	63%	0.632	S	S	*	*			trans	-64.4	125.7	171.5	-72.3	-175.9	-26.6	0	0	108	V118 G122 G123	V118-Q120 PolarHBondContact O-N 3.38Å; Q120-G122 PolarHBondContact O-N 2.9Å; Q120-G122 VanDerWaalsContact O-N 3.15Å; Q120-G123 PolarHBondContact O-N 3.1Å
121	P	68.7	Low	81.1	Confident	135 Å²	135	119.8 Å²	119.8	88%	0.877	64%	0.644	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.4	122.7	176.8	-20.8	30.8	0	0	0	109.5	Q119 G123	Q119-P121 WeakPolarHBondContact O-CD 3.33Å; P121-G123 VanDerWaalsContact C-N 3.26Å; P121-G123 PolarHBondContact O-N 3.39Å
122	G	72.1	Confident	80.6	Confident	94 Å²	94	120.7 Å²	120.7	97%	0.969	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	74.9	-0.1	-178.7	0	0	0	0	0	116.4	Q120	Q120-G122 PolarHBondContact O-N 2.9Å; Q120-G122 VanDerWaalsContact O-N 3.15Å
123	G	71.4	Confident	80	Confident	38 Å²	38	122.8 Å²	122.8	39%	0.392	66%	0.661	S	S	.	*	P	Polyproline II helix	trans	-91.6	133.5	-178.9	0	0	0	0	0	113.8	Q120 P121	Q120-G123 PolarHBondContact O-N 3.1Å; P121-G123 VanDerWaalsContact C-N 3.26Å; P121-G123 PolarHBondContact O-N 3.39Å
124	R	75.1	Confident	79	Confident	241 Å²	241	120.5 Å²	120.5	91%	0.909	67%	0.667	S	S	*	*	P	Polyproline II helix	trans	-61	137.2	168.9	-77.4	179.6	142.9	-171.1	-5.6	110.7	R126	R124-R126 PolarHBondContact O-N 3.22Å; R124-R126 VanDerWaalsContact O-N 3.15Å
125	R	77.1	Confident	78.1	Confident	206 Å²	206	123.2 Å²	123.2	78%	0.777	70%	0.703	S	S	*	*	P	Polyproline II helix	trans	-57.8	118.9	176.8	-62.8	-179	84.4	172.4	7	110.1
126	R	81.5	Confident	77.6	Confident	144 Å²	144	124.5 Å²	124.5	54%	0.543	71%	0.708	S	S	.	*	P	Polyproline II helix	trans	-77.6	143	177.5	-65.1	-172.7	-177.6	-166.5	1.4	111.2	R124	R124-R126 PolarHBondContact O-N 3.22Å; R124-R126 VanDerWaalsContact O-N 3.15Å
127	G	86.5	Confident	77.4	Confident	45 Å²	45	127.1 Å²	127.1	46%	0.464	71%	0.713	S	S	.	*	P	Polyproline II helix	trans	-69.1	156.6	175	0	0	0	0	0	112.9	N129 S130	G127-N129 VanDerWaalsContact C-N 3.26Å; G127-N129 PolarHBondContact O-N 3.15Å; G127-S130 WeakPolarHBondContact O-CB 3.41Å; G127-S130 PolarHBondContact O-N 3.42Å
128	P	88	Confident	77.4	Confident	130 Å²	130	130.8 Å²	130.8	84%	0.844	73%	0.732	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69	-16.7	-173.7	27.3	-35.8	0	0	0	115.2
129	N	91.5	Very high	77.9	Confident	142 Å²	142	131 Å²	131	76%	0.759	73%	0.73	S	S	*	*	T	Hydrogen-bonded Turn	trans	-124.8	37.2	177.3	-165.9	43.6	0	0	0	110.9	G127	G127-N129 VanDerWaalsContact C-N 3.26Å; G127-N129 PolarHBondContact O-N 3.15Å
130	S	87.9	Confident	78.5	Confident	53 Å²	53	129.4 Å²	129.4	37%	0.371	73%	0.73	S	S	.	*			trans	-75.8	124.7	176.3	179	0	0	0	0	109.9	G127 V132	G127-S130 WeakPolarHBondContact O-CB 3.41Å; G127-S130 PolarHBondContact O-N 3.42Å; S130-V132 VanDerWaalsContact C-N 3.29Å; S130-V132 WeakPolarHBondContact OG-CB 3.49Å; S130-V132 WeakPolarHBondContact OG-CG2 3.09Å; S130-V132 PolarHBondContact OG-N 3.15Å
131	N	89.4	Confident	79.3	Confident	145 Å²	145	129.9 Å²	129.9	78%	0.775	74%	0.74	S	S	*	*			trans	-93	16.1	173.6	-67.8	-7	0	0	0	112.4	K133	N131-K133 PolarHBondContact O-N 3.19Å; N131-K133 VanDerWaalsContact O-N 3.14Å
132	V	84.3	Confident	80.1	Confident	93 Å²	93	129.5 Å²	129.5	56%	0.564	73%	0.731	S	S	*	*			trans	-65.7	113.7	178.7	177.8	0	0	0	0	108.8	S130 S134	S130-V132 VanDerWaalsContact C-N 3.29Å; S130-V132 WeakPolarHBondContact OG-CB 3.49Å; S130-V132 WeakPolarHBondContact OG-CG2 3.09Å; S130-V132 PolarHBondContact OG-N 3.15Å; V132-S134 PolarHBondContact O-N 2.98Å
133	K	77.7	Confident	80.7	Confident	193 Å²	193	132.2 Å²	132.2	84%	0.839	71%	0.712	S	S	*	*			trans	-61.2	128.3	171.6	-62.6	-177.8	-179.4	-179.5	0	108.2	N131 S135	N131-K133 PolarHBondContact O-N 3.19Å; N131-K133 VanDerWaalsContact O-N 3.14Å; K133-S135 PolarHBondContact O-N 3.28Å
134	S	69.6	Low	81.4	Confident	96 Å²	96	140.1 Å²	140.1	67%	0.671	74%	0.739	S	S	*	*			trans	-67.1	118.5	163.3	46.7	0	0	0	0	107.1	V132	V132-S134 PolarHBondContact O-N 2.98Å
135	S	68.6	Low	82	Confident	193 Å²	193	130.9 Å²	130.9	100%	1.35	72%	0.723	S	S	*	*			trans	-59.3	0	166.3	-55.5	0	0	0	0	111.4	K133	K133-S135 PolarHBondContact O-N 3.28Å

Retrieved 135 of 135 residues in 33 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).