G4VCG8_SCHMA Loading...

V-type proton ATPase subunit G

Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment.

AlphaFold DB , UniProt , Accession G4VCG8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 124 aa.

						>G4VCG8_SCHMA|G4VCG8
MSAVAAQSDGVAKLQQARTAALAKIEEARNRRAKRLKEAKGEANLEVDAFKAQQEAHYNSLELQVNSQYGPYEELCRQMTDEQLNSMQRSFQSNRNAALQLLLSKVLDVKPVVHVNFGFKSPGS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.8	Low	69.6	Low	225 Å²	225	96.2 Å²	96.2	100%	1.108	60%	0.602	S	S	*	*				0	-25.3	0	-67.5	-93.4	-146.2	0	0	113.9
2	S	59	Low	71.3	Confident	100 Å²	100	92.5 Å²	92.5	70%	0.699	59%	0.587	S	S	*	*	H	α-helix	trans	-71.8	-32.8	-171.6	-178	0	0	0	0	116.1	V4 A5 A6	S2-V4 PolarHBondContact O-N 3.36Å; S2-A5 PolarHBondContact O-N 2.91Å; S2-A6 PolarHBondContact O-N 3.05Å; S2-A6 VanDerWaalsContact O-N 3.14Å
3	A	60.5	Low	73	Confident	82 Å²	82	97.5 Å²	97.5	68%	0.678	60%	0.595	S	S	*	*	H	α-helix	trans	-67.5	-34.4	-178.6	0	0	0	0	0	114	Q7	A3-Q7 PolarHBondContact O-N 3.03Å; A3-Q7 VanDerWaalsContact O-N 3.11Å
4	V	61.3	Low	74.4	Confident	108 Å²	108	99.4 Å²	99.4	66%	0.655	60%	0.599	S	S	*	*	H	α-helix	trans	-70.3	-36.1	178.1	179.4	0	0	0	0	111	S2 Q7 S8	S2-V4 PolarHBondContact O-N 3.36Å; V4-Q7 PolarHBondContact O-N 2.71Å; V4-S8 PolarHBondContact O-N 2.94Å; V4-S8 PolarHBondContact O-OG 2.91Å
5	A	60.7	Low	75.8	Confident	49 Å²	49	100.9 Å²	100.9	41%	0.405	60%	0.597	S	S	.	*	H	α-helix	trans	-67.8	-42.5	175.6	0	0	0	0	0	112.2	S2 Q7 S8 D9	S2-A5 PolarHBondContact O-N 2.91Å; A5-Q7 VanDerWaalsContact C-N 3.28Å; A5-Q7 PolarHBondContact O-N 3.37Å; A5-S8 WeakPolarHBondContact CA-OG 3.44Å; A5-S8 PolarHBondContact O-N 2.9Å; A5-S8 PolarHBondContact O-OG 3.45Å; A5-D9 PolarHBondContact O-N 3.48Å
6	A	65	Low	76.9	Confident	65 Å²	65	103.4 Å²	103.4	54%	0.537	60%	0.6	S	S	.	*	H	α-helix	trans	-63.3	-35	175	0	0	0	0	0	112.3	S2 G10	S2-A6 PolarHBondContact O-N 3.05Å; S2-A6 VanDerWaalsContact O-N 3.14Å; A6-G10 PolarHBondContact O-N 3.2Å
7	Q	71.4	Confident	78	Confident	143 Å²	143	100.7 Å²	100.7	67%	0.668	59%	0.593	S	S	*	*	H	α-helix	trans	-69.7	-40.9	175.1	-170.9	175.1	7.3	0	0	112.1	A3 V4 A5 G10 V11	A3-Q7 PolarHBondContact O-N 3.03Å; A3-Q7 VanDerWaalsContact O-N 3.11Å; V4-Q7 PolarHBondContact O-N 2.71Å; A5-Q7 VanDerWaalsContact C-N 3.28Å; A5-Q7 PolarHBondContact O-N 3.37Å; Q7-G10 PolarHBondContact O-N 3.25Å; Q7-V11 WeakPolarHBondContact O-CG2 3.33Å; Q7-V11 PolarHBondContact O-N 3.27Å
8	S	75.3	Confident	78.9	Confident	65 Å²	65	105.1 Å²	105.1	46%	0.455	60%	0.598	S	S	.	*	H	α-helix	trans	-65	-38.2	176.6	54.5	0	0	0	0	112.8	V4 A5 V11 A12	V4-S8 PolarHBondContact O-N 2.94Å; V4-S8 PolarHBondContact O-OG 2.91Å; A5-S8 WeakPolarHBondContact CA-OG 3.44Å; A5-S8 PolarHBondContact O-N 2.9Å; A5-S8 PolarHBondContact O-OG 3.45Å; S8-V11 PolarHBondContact O-N 3.23Å; S8-A12 PolarHBondContact O-N 2.99Å
9	D	81.7	Confident	79.9	Confident	113 Å²	113	104.3 Å²	104.3	60%	0.604	60%	0.595	S	S	*	*	H	α-helix	trans	-65.6	-40.4	178	-72.7	-11	0	0	0	112	A5 V11 A12 K13	A5-D9 PolarHBondContact O-N 3.48Å; D9-V11 PolarHBondContact O-N 2.72Å; D9-A12 PolarHBondContact O-N 3.3Å; D9-K13 PolarHBondContact O-N 3.25Å
10	G	87.9	Confident	80.7	Confident	36 Å²	36	102 Å²	102	37%	0.371	59%	0.59	S	S	.	*	H	α-helix	trans	-61.5	-43.2	175	0	0	0	0	0	112.5	A6 Q7 K13 L14	A6-G10 PolarHBondContact O-N 3.2Å; Q7-G10 PolarHBondContact O-N 3.25Å; G10-K13 PolarHBondContact O-N 3.01Å; G10-L14 WeakPolarHBondContact O-CG 3.26Å; G10-L14 PolarHBondContact O-N 3.09Å; G10-L14 VanDerWaalsContact O-N 3.11Å
11	V	89.7	Confident	81.5	Confident	72 Å²	72	99.6 Å²	99.6	44%	0.436	58%	0.582	S	S	.	*	H	α-helix	trans	-65.3	-42.6	177.3	174.7	0	0	0	0	111.3	Q7 S8 D9 K13 L14 Q15	Q7-V11 WeakPolarHBondContact O-CG2 3.33Å; Q7-V11 PolarHBondContact O-N 3.27Å; S8-V11 PolarHBondContact O-N 3.23Å; D9-V11 PolarHBondContact O-N 2.72Å; V11-K13 VanDerWaalsContact C-N 3.34Å; V11-K13 PolarHBondContact O-N 3.42Å; V11-L14 PolarHBondContact O-N 3.45Å; V11-Q15 WeakPolarHBondContact O-CG 3.22Å; V11-Q15 PolarHBondContact O-N 2.98Å
12	A	90.6	Very high	83.6	Confident	52 Å²	52	93.1 Å²	93.1	43%	0.43	55%	0.551	S	S	.	*	H	α-helix	trans	-60.4	-43.4	177.3	0	0	0	0	0	111.9	S8 D9 L14 Q15 Q16	S8-A12 PolarHBondContact O-N 2.99Å; D9-A12 PolarHBondContact O-N 3.3Å; A12-L14 VanDerWaalsContact C-N 3.35Å; A12-L14 PolarHBondContact O-N 3.33Å; A12-Q15 PolarHBondContact O-N 3.29Å; A12-Q16 PolarHBondContact O-N 3.43Å
13	K	93.2	Very high	85.4	Confident	157 Å²	157	91.2 Å²	91.2	68%	0.683	54%	0.542	S	S	*	.	H	α-helix	trans	-63.2	-39.3	176.9	-167.5	172.1	-175.4	176	0	112.4	D9 G10 V11 Q16 A17	D9-K13 PolarHBondContact O-N 3.25Å; G10-K13 PolarHBondContact O-N 3.01Å; V11-K13 VanDerWaalsContact C-N 3.34Å; V11-K13 PolarHBondContact O-N 3.42Å; K13-Q16 PolarHBondContact O-N 3.31Å; K13-A17 WeakPolarHBondContact O-CB 3.37Å; K13-A17 PolarHBondContact O-N 2.91Å
14	L	92.5	Very high	87.2	Confident	125 Å²	125	94.8 Å²	94.8	65%	0.654	54%	0.542	S	S	*	.	H	α-helix	trans	-65.2	-40	174.4	-71.4	172.7	0	0	0	112.1	G10 V11 A12 A17 R18	G10-L14 WeakPolarHBondContact O-CG 3.26Å; G10-L14 PolarHBondContact O-N 3.09Å; G10-L14 VanDerWaalsContact O-N 3.11Å; V11-L14 PolarHBondContact O-N 3.45Å; A12-L14 VanDerWaalsContact C-N 3.35Å; A12-L14 PolarHBondContact O-N 3.33Å; L14-A17 PolarHBondContact O-N 2.96Å; L14-R18 WeakPolarHBondContact O-CB 3.31Å; L14-R18 PolarHBondContact O-N 3.46Å
15	Q	94.7	Very high	88.9	Confident	122 Å²	122	93.6 Å²	93.6	57%	0.57	53%	0.531	S	S	*	.	H	α-helix	trans	-64.1	-43.2	175.7	-71.9	179.7	-0.8	0	0	111.6	V11 A12 R18 T19	V11-Q15 WeakPolarHBondContact O-CG 3.22Å; V11-Q15 PolarHBondContact O-N 2.98Å; A12-Q15 PolarHBondContact O-N 3.29Å; Q15-R18 WeakPolarHBondContact O-CB 3.43Å; Q15-R18 PolarHBondContact O-N 3.42Å; Q15-T19 WeakPolarHBondContact O-CG2 3.26Å; Q15-T19 PolarHBondContact O-N 2.85Å; Q15-T19 PolarHBondContact O-OG1 3.47Å
16	Q	94.5	Very high	90.7	Very high	140 Å²	140	95.2 Å²	95.2	65%	0.654	53%	0.53	S	S	*	.	H	α-helix	trans	-64	-42.1	175.4	-170.5	-175.8	15	0	0	112.2	A12 K13 R18 T19 A20	A12-Q16 PolarHBondContact O-N 3.43Å; K13-Q16 PolarHBondContact O-N 3.31Å; Q16-R18 VanDerWaalsContact C-N 3.3Å; Q16-R18 PolarHBondContact O-N 3.27Å; Q16-T19 WeakPolarHBondContact CA-OG1 3.34Å; Q16-T19 PolarHBondContact O-N 3Å; Q16-T19 PolarHBondContact O-OG1 2.88Å; Q16-A20 WeakPolarHBondContact O-CB 3.35Å; Q16-A20 PolarHBondContact O-N 3.44Å
17	A	94.8	Very high	92.2	Very high	58 Å²	58	98.5 Å²	98.5	48%	0.479	54%	0.535	S	S	.	.	H	α-helix	trans	-62.9	-39.2	175	0	0	0	0	0	111.4	K13 L14 A21	K13-A17 WeakPolarHBondContact O-CB 3.37Å; K13-A17 PolarHBondContact O-N 2.91Å; L14-A17 PolarHBondContact O-N 2.96Å; A17-A21 VanDerWaalsContact O-CB 3.3Å; A17-A21 WeakPolarHBondContact O-CB 3.45Å; A17-A21 PolarHBondContact O-N 2.96Å
18	R	95	Very high	93.5	Very high	180 Å²	180	94.7 Å²	94.7	68%	0.679	53%	0.527	S	S	*	.	H	α-helix	trans	-63.5	-47.1	175.5	-180	-178.6	177	178.4	-0.2	111.8	L14 Q15 Q16 A21 L22	L14-R18 WeakPolarHBondContact O-CB 3.31Å; L14-R18 PolarHBondContact O-N 3.46Å; Q15-R18 WeakPolarHBondContact O-CB 3.43Å; Q15-R18 PolarHBondContact O-N 3.42Å; Q16-R18 VanDerWaalsContact C-N 3.3Å; Q16-R18 PolarHBondContact O-N 3.27Å; R18-A21 PolarHBondContact O-N 2.92Å; R18-L22 HydrophobicContact CG-CD1 4.03Å; R18-L22 HydrophobicContact CG-CG 4.44Å; R18-L22 WeakPolarHBondContact O-CB 3.49Å; R18-L22 VanDerWaalsContact O-CG 3.29Å; R18-L22 WeakPolarHBondContact O-CG 3.33Å; R18-L22 PolarHBondContact O-N 3.35Å
19	T	96.8	Very high	94.6	Very high	89 Å²	89	98.8 Å²	98.8	55%	0.546	53%	0.533	S	S	.	.	H	α-helix	trans	-64.2	-41.6	178.9	53.9	0	0	0	0	111.4	Q15 Q16 L22 A23	Q15-T19 WeakPolarHBondContact O-CG2 3.26Å; Q15-T19 PolarHBondContact O-N 2.85Å; Q15-T19 PolarHBondContact O-OG1 3.47Å; Q16-T19 WeakPolarHBondContact CA-OG1 3.34Å; Q16-T19 PolarHBondContact O-N 3Å; Q16-T19 PolarHBondContact O-OG1 2.88Å; T19-L22 PolarHBondContact O-N 3.44Å; T19-A23 WeakPolarHBondContact O-CB 3.34Å; T19-A23 PolarHBondContact O-N 3.29Å
20	A	96.5	Very high	95.4	Very high	59 Å²	59	98.5 Å²	98.5	49%	0.488	53%	0.531	S	S	.	.	H	α-helix	trans	-62.7	-42.3	174.8	0	0	0	0	0	112.5	Q16 A23 K24	Q16-A20 WeakPolarHBondContact O-CB 3.35Å; Q16-A20 PolarHBondContact O-N 3.44Å; A20-A23 PolarHBondContact O-N 2.98Å; A20-K24 WeakPolarHBondContact O-CB 3.44Å; A20-K24 PolarHBondContact O-N 3.22Å
21	A	96.8	Very high	95.8	Very high	51 Å²	51	104 Å²	104	42%	0.421	54%	0.541	S	S	.	.	H	α-helix	trans	-64.8	-44.2	176.5	0	0	0	0	0	111.9	A17 R18 K24 I25	A17-A21 VanDerWaalsContact O-CB 3.3Å; A17-A21 WeakPolarHBondContact O-CB 3.45Å; A17-A21 PolarHBondContact O-N 2.96Å; R18-A21 PolarHBondContact O-N 2.92Å; A21-K24 PolarHBondContact O-N 3.47Å; A21-I25 WeakPolarHBondContact O-CG1 3.45Å; A21-I25 PolarHBondContact O-N 3.14Å
22	L	97.3	Very high	96.2	Very high	89 Å²	89	110.1 Å²	110.1	47%	0.466	56%	0.556	S	S	.	*	H	α-helix	trans	-62.5	-43.9	175.9	-72	173.1	0	0	0	111.6	R18 T19 K24 I25 E26	R18-L22 HydrophobicContact CG-CD1 4.03Å; R18-L22 HydrophobicContact CG-CG 4.44Å; R18-L22 WeakPolarHBondContact O-CB 3.49Å; R18-L22 VanDerWaalsContact O-CG 3.29Å; R18-L22 WeakPolarHBondContact O-CG 3.33Å; R18-L22 PolarHBondContact O-N 3.35Å; T19-L22 PolarHBondContact O-N 3.44Å; L22-K24 VanDerWaalsContact C-N 3.31Å; L22-K24 PolarHBondContact O-N 2.96Å; L22-I25 PolarHBondContact O-N 3.38Å; L22-E26 PolarHBondContact O-N 2.86Å
23	A	97.3	Very high	96.6	Very high	60 Å²	60	110.5 Å²	110.5	50%	0.496	56%	0.559	S	S	.	*	H	α-helix	trans	-58.9	-43	176	0	0	0	0	0	111.7	T19 A20 I25 E26 E27	T19-A23 WeakPolarHBondContact O-CB 3.34Å; T19-A23 PolarHBondContact O-N 3.29Å; A20-A23 PolarHBondContact O-N 2.98Å; A23-I25 VanDerWaalsContact C-N 3.35Å; A23-I25 PolarHBondContact O-N 3.32Å; A23-E26 PolarHBondContact O-N 3.32Å; A23-E27 WeakPolarHBondContact O-CB 3.48Å; A23-E27 PolarHBondContact O-N 3.44Å
24	K	97.8	Very high	96.8	Very high	157 Å²	157	109.2 Å²	109.2	68%	0.683	55%	0.554	S	S	*	*	H	α-helix	trans	-65.6	-35.8	177.2	-166.6	167.7	-172.6	169.8	0	112.9	A20 A21 L22 A28	A20-K24 WeakPolarHBondContact O-CB 3.44Å; A20-K24 PolarHBondContact O-N 3.22Å; A21-K24 PolarHBondContact O-N 3.47Å; L22-K24 VanDerWaalsContact C-N 3.31Å; L22-K24 PolarHBondContact O-N 2.96Å; K24-A28 WeakPolarHBondContact O-CB 3.34Å; K24-A28 PolarHBondContact O-N 2.96Å; K24-A28 VanDerWaalsContact O-N 3.09Å
25	I	97.8	Very high	97.1	Very high	83 Å²	83	110.2 Å²	110.2	43%	0.426	55%	0.548	S	S	.	.	H	α-helix	trans	-67.4	-45.1	174.8	-69.2	166	0	0	0	110.6	A21 L22 A23 A28 R29	A21-I25 WeakPolarHBondContact O-CG1 3.45Å; A21-I25 PolarHBondContact O-N 3.14Å; L22-I25 PolarHBondContact O-N 3.38Å; A23-I25 VanDerWaalsContact C-N 3.35Å; A23-I25 PolarHBondContact O-N 3.32Å; I25-A28 PolarHBondContact O-N 3.3Å; I25-R29 WeakPolarHBondContact O-CG 3.46Å; I25-R29 PolarHBondContact O-N 3.47Å
26	E	97.7	Very high	97.2	Very high	83 Å²	83	110.4 Å²	110.4	39%	0.388	55%	0.553	S	S	.	*	H	α-helix	trans	-65	-39.7	178	-72.1	-53.5	134.3	0	0	112.1	L22 A23 A28 R29 N30	L22-E26 PolarHBondContact O-N 2.86Å; A23-E26 PolarHBondContact O-N 3.32Å; E26-A28 VanDerWaalsContact C-N 3.33Å; E26-A28 PolarHBondContact O-N 2.91Å; E26-R29 PolarHBondContact O-N 2.88Å; E26-R29 IonicContact OE1-CZ 3.78Å; E26-R29 IonicContact OE1-NE 3.67Å; E26-R29 IonicContact OE1-NH1 3.88Å; E26-R29 PolarHBondContact OE1-NH1 3.3Å; E26-N30 WeakPolarHBondContact O-CB 3.46Å; E26-N30 VanDerWaalsContact O-CG 3.31Å; E26-N30 PolarHBondContact O-N 3.02Å; E26-N30 PolarHBondContact O-ND2 2.88Å
27	E	97.7	Very high	97.4	Very high	135 Å²	135	111.9 Å²	111.9	63%	0.631	56%	0.557	S	S	*	*	H	α-helix	trans	-58.7	-45.2	172.2	-169.7	-170	165	0	0	111.5	A23 R29 N30 R31	A23-E27 WeakPolarHBondContact O-CB 3.48Å; A23-E27 PolarHBondContact O-N 3.44Å; E27-R29 PolarHBondContact O-N 3.32Å; E27-N30 PolarHBondContact O-N 2.9Å; E27-R31 WeakPolarHBondContact O-CB 3.47Å; E27-R31 PolarHBondContact O-N 3.38Å
28	A	97.9	Very high	97.5	Very high	62 Å²	62	113.3 Å²	113.3	51%	0.512	55%	0.554	S	S	.	*	H	α-helix	trans	-63.4	-39.3	176.9	0	0	0	0	0	112.5	K24 I25 E26 R31 R32	K24-A28 WeakPolarHBondContact O-CB 3.34Å; K24-A28 PolarHBondContact O-N 2.96Å; K24-A28 VanDerWaalsContact O-N 3.09Å; I25-A28 PolarHBondContact O-N 3.3Å; E26-A28 VanDerWaalsContact C-N 3.33Å; E26-A28 PolarHBondContact O-N 2.91Å; A28-R31 PolarHBondContact O-N 3.36Å; A28-R32 PolarHBondContact O-N 3.22Å
29	R	98.1	Very high	97.6	Very high	152 Å²	152	107.2 Å²	107.2	57%	0.574	54%	0.542	S	S	*	.	H	α-helix	trans	-63.1	-48	174.6	-74.9	174	172.8	178.2	-5.4	111.5	I25 E26 E27 R31 R32 A33	I25-R29 WeakPolarHBondContact O-CG 3.46Å; I25-R29 PolarHBondContact O-N 3.47Å; E26-R29 PolarHBondContact O-N 2.88Å; E26-R29 IonicContact OE1-CZ 3.78Å; E26-R29 IonicContact OE1-NE 3.67Å; E26-R29 IonicContact OE1-NH1 3.88Å; E26-R29 PolarHBondContact OE1-NH1 3.3Å; E27-R29 PolarHBondContact O-N 3.32Å; R29-R31 VanDerWaalsContact C-N 3.34Å; R29-R31 PolarHBondContact O-N 2.99Å; R29-R32 PolarHBondContact O-N 3.46Å; R29-A33 PolarHBondContact O-N 2.89Å
30	N	98	Very high	97.7	Very high	107 Å²	107	109.8 Å²	109.8	57%	0.572	55%	0.546	S	S	*	.	H	α-helix	trans	-61.9	-41.8	178	-72.6	-22.9	0	0	0	111.7	E26 E27 R32 A33 K34	E26-N30 WeakPolarHBondContact O-CB 3.46Å; E26-N30 VanDerWaalsContact O-CG 3.31Å; E26-N30 PolarHBondContact O-N 3.02Å; E26-N30 PolarHBondContact O-ND2 2.88Å; E27-N30 PolarHBondContact O-N 2.9Å; N30-R32 PolarHBondContact O-N 2.93Å; N30-A33 PolarHBondContact O-N 3.44Å; N30-K34 WeakPolarHBondContact O-CB 3.28Å; N30-K34 PolarHBondContact O-N 2.92Å
31	R	98	Very high	97.7	Very high	152 Å²	152	108.5 Å²	108.5	57%	0.574	54%	0.538	S	S	*	.	H	α-helix	trans	-62.7	-41.5	175.5	-171.3	178.8	-176.4	-176.5	4.1	112.1	E27 A28 R29 R35	E27-R31 WeakPolarHBondContact O-CB 3.47Å; E27-R31 PolarHBondContact O-N 3.38Å; A28-R31 PolarHBondContact O-N 3.36Å; R29-R31 VanDerWaalsContact C-N 3.34Å; R29-R31 PolarHBondContact O-N 2.99Å; R31-R35 VanDerWaalsContact NH2-NH2 3.12Å; R31-R35 WeakPolarHBondContact O-CG 3.46Å; R31-R35 PolarHBondContact O-N 3.46Å
32	R	98.1	Very high	97.7	Very high	200 Å²	200	112.5 Å²	112.5	76%	0.755	55%	0.548	S	S	*	.	H	α-helix	trans	-63.5	-46.7	175.4	-178.3	-178.8	176	-176.1	-0.7	111.3	A28 R29 N30 K34 R35 L36	A28-R32 PolarHBondContact O-N 3.22Å; R29-R32 PolarHBondContact O-N 3.46Å; N30-R32 PolarHBondContact O-N 2.93Å; R32-K34 VanDerWaalsContact C-N 3.35Å; R32-K34 PolarHBondContact O-N 2.87Å; R32-R35 PolarHBondContact O-N 3.44Å; R32-L36 WeakPolarHBondContact O-CB 3.31Å; R32-L36 PolarHBondContact O-N 3.26Å
33	A	98	Very high	97.7	Very high	59 Å²	59	110.5 Å²	110.5	49%	0.488	54%	0.544	S	S	.	.	H	α-helix	trans	-62.1	-42.7	178.7	0	0	0	0	0	111.8	R29 N30 L36 K37	R29-A33 PolarHBondContact O-N 2.89Å; N30-A33 PolarHBondContact O-N 3.44Å; A33-L36 PolarHBondContact O-N 2.89Å; A33-K37 PolarHBondContact O-N 2.91Å
34	K	98.1	Very high	97.8	Very high	131 Å²	131	111.7 Å²	111.7	57%	0.57	54%	0.542	S	S	*	.	H	α-helix	trans	-58.9	-51.8	175.1	-177	177.7	172.2	178.2	0	111.5	N30 R32 L36 K37 E38	N30-K34 WeakPolarHBondContact O-CB 3.28Å; N30-K34 PolarHBondContact O-N 2.92Å; R32-K34 VanDerWaalsContact C-N 3.35Å; R32-K34 PolarHBondContact O-N 2.87Å; K34-L36 VanDerWaalsContact C-N 3.3Å; K34-L36 PolarHBondContact O-N 3.48Å; K34-K37 WeakPolarHBondContact O-CB 3.45Å; K34-K37 PolarHBondContact O-N 3.13Å; K34-K37 VanDerWaalsContact O-N 3.11Å; K34-E38 WeakPolarHBondContact CE-OE1 3.48Å; K34-E38 HydrophobicContact CG-CG 4.49Å; K34-E38 IonicContact NZ-OE1 3.97Å; K34-E38 WeakPolarHBondContact O-CG 3.44Å; K34-E38 PolarHBondContact O-N 3.47Å
35	R	97.7	Very high	97.8	Very high	145 Å²	145	110.1 Å²	110.1	55%	0.547	54%	0.54	S	S	.	.	H	α-helix	trans	-59.6	-38.7	178.1	-78.4	-176.4	171.9	174.8	-6.1	113	R31 R32 E38 A39	R31-R35 VanDerWaalsContact NH2-NH2 3.12Å; R31-R35 WeakPolarHBondContact O-CG 3.46Å; R31-R35 PolarHBondContact O-N 3.46Å; R32-R35 PolarHBondContact O-N 3.44Å; R35-E38 PolarHBondContact O-N 2.71Å; R35-A39 WeakPolarHBondContact O-CB 3.24Å; R35-A39 PolarHBondContact O-N 2.96Å
36	L	97.6	Very high	97.8	Very high	126 Å²	126	113.2 Å²	113.2	66%	0.66	55%	0.553	S	S	*	*	H	α-helix	trans	-66.5	-39.1	177.2	-173.9	64.3	0	0	0	111.6	R32 A33 K34 K40	R32-L36 WeakPolarHBondContact O-CB 3.31Å; R32-L36 PolarHBondContact O-N 3.26Å; A33-L36 PolarHBondContact O-N 2.89Å; K34-L36 VanDerWaalsContact C-N 3.3Å; K34-L36 PolarHBondContact O-N 3.48Å; L36-K40 WeakPolarHBondContact O-CB 3.4Å; L36-K40 PolarHBondContact O-N 3.36Å
37	K	98	Very high	97.8	Very high	171 Å²	171	112.7 Å²	112.7	74%	0.743	56%	0.555	S	S	*	*	H	α-helix	trans	-66.1	-43.1	175.6	-172.6	179.6	179.3	-177.9	0	111.6	A33 K34 K40 G41	A33-K37 PolarHBondContact O-N 2.91Å; K34-K37 WeakPolarHBondContact O-CB 3.45Å; K34-K37 PolarHBondContact O-N 3.13Å; K34-K37 VanDerWaalsContact O-N 3.11Å; K37-K40 PolarHBondContact O-N 2.95Å; K37-G41 PolarHBondContact O-N 3.31Å
38	E	97.8	Very high	97.8	Very high	88 Å²	88	110.4 Å²	110.4	41%	0.411	55%	0.548	S	S	.	.	H	α-helix	trans	-60.7	-52	175.7	-72.3	168.1	166.7	0	0	110.7	K34 R35 K40 G41 E42	K34-E38 WeakPolarHBondContact CE-OE1 3.48Å; K34-E38 HydrophobicContact CG-CG 4.49Å; K34-E38 IonicContact NZ-OE1 3.97Å; K34-E38 WeakPolarHBondContact O-CG 3.44Å; K34-E38 PolarHBondContact O-N 3.47Å; R35-E38 PolarHBondContact O-N 2.71Å; E38-K40 VanDerWaalsContact C-N 3.29Å; E38-K40 PolarHBondContact O-N 3.46Å; E38-G41 CarbonylContact O-C 3.59Å; E38-G41 WeakPolarHBondContact O-CA 3.48Å; E38-G41 PolarHBondContact O-N 2.91Å; E38-E42 WeakPolarHBondContact O-CG 3.37Å; E38-E42 PolarHBondContact O-N 3.39Å
39	A	97.6	Very high	97.8	Very high	52 Å²	52	110.4 Å²	110.4	43%	0.43	55%	0.548	S	S	.	.	H	α-helix	trans	-58.5	-39.2	178.6	0	0	0	0	0	112.8	R35 A43	R35-A39 WeakPolarHBondContact O-CB 3.24Å; R35-A39 PolarHBondContact O-N 2.96Å; A39-A43 WeakPolarHBondContact O-CB 3.3Å; A39-A43 PolarHBondContact O-N 2.92Å
40	K	97.7	Very high	97.8	Very high	144 Å²	144	109.4 Å²	109.4	63%	0.626	55%	0.548	S	S	*	.	H	α-helix	trans	-67.8	-37.6	174.9	-170	176.2	-178.4	179.4	0	112	L36 K37 E38 N44	L36-K40 WeakPolarHBondContact O-CB 3.4Å; L36-K40 PolarHBondContact O-N 3.36Å; K37-K40 PolarHBondContact O-N 2.95Å; E38-K40 VanDerWaalsContact C-N 3.29Å; E38-K40 PolarHBondContact O-N 3.46Å; K40-N44 WeakPolarHBondContact O-CB 3.37Å; K40-N44 VanDerWaalsContact O-CG 3.24Å; K40-N44 PolarHBondContact O-N 3.25Å; K40-N44 VanDerWaalsContact O-N 3.09Å
41	G	97.8	Very high	97.8	Very high	31 Å²	31	110.1 Å²	110.1	32%	0.32	55%	0.546	S	S	.	.	H	α-helix	trans	-64.1	-48.6	175.3	0	0	0	0	0	111.8	K37 E38 N44 L45	K37-G41 PolarHBondContact O-N 3.31Å; E38-G41 CarbonylContact O-C 3.59Å; E38-G41 WeakPolarHBondContact O-CA 3.48Å; E38-G41 PolarHBondContact O-N 2.91Å; G41-N44 PolarHBondContact O-N 3.4Å; G41-L45 WeakPolarHBondContact O-CG 3.38Å; G41-L45 PolarHBondContact O-N 3.1Å
42	E	97	Very high	97.8	Very high	135 Å²	135	105.6 Å²	105.6	63%	0.631	54%	0.541	S	S	*	.	H	α-helix	trans	-60.5	-46	177.5	-71.3	173.3	-177.3	0	0	111.7	E38 N44 L45 E46	E38-E42 WeakPolarHBondContact O-CG 3.37Å; E38-E42 PolarHBondContact O-N 3.39Å; E42-N44 VanDerWaalsContact C-N 3.33Å; E42-N44 PolarHBondContact O-N 3.32Å; E42-L45 PolarHBondContact O-N 2.9Å; E42-E46 PolarHBondContact O-N 3.35Å
43	A	97.2	Very high	97.8	Very high	47 Å²	47	102.3 Å²	102.3	39%	0.388	53%	0.534	S	S	.	.	H	α-helix	trans	-61.2	-40	176.6	0	0	0	0	0	112.6	A39 E46 V47	A39-A43 WeakPolarHBondContact O-CB 3.3Å; A39-A43 PolarHBondContact O-N 2.92Å; A43-E46 PolarHBondContact O-N 2.91Å; A43-V47 VanDerWaalsContact O-CG2 3.28Å; A43-V47 WeakPolarHBondContact O-CG2 3.45Å; A43-V47 PolarHBondContact O-N 3.47Å
44	N	98	Very high	97.8	Very high	86 Å²	86	103.9 Å²	103.9	46%	0.46	53%	0.531	S	S	.	.	H	α-helix	trans	-65.8	-41.8	176.2	-75.6	-10.4	0	0	0	111.7	K40 G41 E42 E46 V47 D48	K40-N44 WeakPolarHBondContact O-CB 3.37Å; K40-N44 VanDerWaalsContact O-CG 3.24Å; K40-N44 PolarHBondContact O-N 3.25Å; K40-N44 VanDerWaalsContact O-N 3.09Å; G41-N44 PolarHBondContact O-N 3.4Å; E42-N44 VanDerWaalsContact C-N 3.33Å; E42-N44 PolarHBondContact O-N 3.32Å; N44-E46 VanDerWaalsContact C-N 3.31Å; N44-E46 PolarHBondContact O-N 2.95Å; N44-V47 PolarHBondContact O-N 2.91Å; N44-D48 WeakPolarHBondContact O-CB 3.36Å; N44-D48 VanDerWaalsContact O-CG 3.31Å; N44-D48 PolarHBondContact O-N 3.27Å
45	L	98	Very high	97.8	Very high	123 Å²	123	103.6 Å²	103.6	64%	0.644	53%	0.532	S	S	*	.	H	α-helix	trans	-61	-41.7	176.5	-71.2	171	0	0	0	111.6	G41 E42 D48 A49	G41-L45 WeakPolarHBondContact O-CG 3.38Å; G41-L45 PolarHBondContact O-N 3.1Å; E42-L45 PolarHBondContact O-N 2.9Å; L45-D48 PolarHBondContact O-N 3.44Å; L45-A49 WeakPolarHBondContact O-CB 3.42Å; L45-A49 PolarHBondContact O-N 3.36Å
46	E	97.4	Very high	97.8	Very high	149 Å²	149	99.6 Å²	99.6	70%	0.696	53%	0.53	S	S	*	.	H	α-helix	trans	-65.1	-43.2	176.7	-171.8	174.9	-170.7	0	0	111.8	E42 A43 N44 D48 A49 F50	E42-E46 PolarHBondContact O-N 3.35Å; A43-E46 PolarHBondContact O-N 2.91Å; N44-E46 VanDerWaalsContact C-N 3.31Å; N44-E46 PolarHBondContact O-N 2.95Å; E46-D48 PolarHBondContact O-N 3.3Å; E46-A49 PolarHBondContact O-N 3.48Å; E46-F50 WeakPolarHBondContact O-CB 3.47Å; E46-F50 PolarHBondContact O-N 3.19Å
47	V	98	Very high	97.8	Very high	71 Å²	71	98.1 Å²	98.1	43%	0.43	52%	0.519	S	S	.	.	H	α-helix	trans	-61.4	-44.1	175.6	167.4	0	0	0	0	111.5	A43 N44 F50 K51	A43-V47 VanDerWaalsContact O-CG2 3.28Å; A43-V47 WeakPolarHBondContact O-CG2 3.45Å; A43-V47 PolarHBondContact O-N 3.47Å; N44-V47 PolarHBondContact O-N 2.91Å; V47-F50 PolarHBondContact O-N 3.32Å; V47-K51 HydrophobicContact CG1-CD 4.23Å; V47-K51 WeakPolarHBondContact O-CG 3.4Å; V47-K51 PolarHBondContact O-N 3.21Å
48	D	98.2	Very high	97.7	Very high	88 Å²	88	96.9 Å²	96.9	47%	0.471	51%	0.511	S	S	.	.	H	α-helix	trans	-69.9	-37.9	-179	-69.7	-19.8	0	0	0	111.5	N44 L45 E46 K51 A52	N44-D48 WeakPolarHBondContact O-CB 3.36Å; N44-D48 VanDerWaalsContact O-CG 3.31Å; N44-D48 PolarHBondContact O-N 3.27Å; L45-D48 PolarHBondContact O-N 3.44Å; E46-D48 PolarHBondContact O-N 3.3Å; D48-K51 PolarHBondContact O-N 2.84Å; D48-K51 IonicContact OD1-NZ 2.71Å; D48-A52 WeakPolarHBondContact O-CB 3.35Å; D48-A52 PolarHBondContact O-N 3.12Å
49	A	98.1	Very high	97.7	Very high	62 Å²	62	96 Å²	96	51%	0.512	51%	0.509	S	S	.	.	H	α-helix	trans	-61.5	-44.2	172.4	0	0	0	0	0	111.8	L45 E46 A52 Q53	L45-A49 WeakPolarHBondContact O-CB 3.42Å; L45-A49 PolarHBondContact O-N 3.36Å; E46-A49 PolarHBondContact O-N 3.48Å; A49-A52 PolarHBondContact O-N 2.89Å; A49-Q53 PolarHBondContact O-N 3.34Å
50	F	97.9	Very high	97.6	Very high	131 Å²	131	97 Å²	97	58%	0.575	51%	0.513	S	S	*	.	H	α-helix	trans	-63.3	-42.6	176.8	-179.7	-99.1	0	0	0	112.2	E46 V47 Q53 Q54	E46-F50 WeakPolarHBondContact O-CB 3.47Å; E46-F50 PolarHBondContact O-N 3.19Å; V47-F50 PolarHBondContact O-N 3.32Å; F50-Q53 PolarHBondContact O-N 3.35Å; F50-Q54 HydrophobicContact CE1-CG 4.21Å; F50-Q54 HydrophobicContact CZ-CG 4.1Å; F50-Q54 PolarHBondContact O-N 3.5Å
51	K	98.1	Very high	97.5	Very high	121 Å²	121	93.7 Å²	93.7	53%	0.526	50%	0.502	S	S	.	.	H	α-helix	trans	-60.5	-47.3	175.2	-75.1	172.7	-176.1	167.8	0	111.7	V47 D48 Q53 Q54 E55	V47-K51 HydrophobicContact CG1-CD 4.23Å; V47-K51 WeakPolarHBondContact O-CG 3.4Å; V47-K51 PolarHBondContact O-N 3.21Å; D48-K51 PolarHBondContact O-N 2.84Å; D48-K51 IonicContact OD1-NZ 2.71Å; K51-Q53 VanDerWaalsContact C-N 3.3Å; K51-Q53 PolarHBondContact O-N 3.03Å; K51-Q54 PolarHBondContact O-N 3.4Å; K51-E55 WeakPolarHBondContact O-CB 3.3Å; K51-E55 PolarHBondContact O-N 3.02Å
52	A	98	Very high	97.3	Very high	57 Å²	57	96.3 Å²	96.3	47%	0.471	51%	0.506	S	S	.	.	H	α-helix	trans	-61.1	-40.5	178.5	0	0	0	0	0	111.8	D48 A49 E55 A56	D48-A52 WeakPolarHBondContact O-CB 3.35Å; D48-A52 PolarHBondContact O-N 3.12Å; A49-A52 PolarHBondContact O-N 2.89Å; A52-E55 PolarHBondContact O-N 2.68Å; A52-A56 WeakPolarHBondContact O-CB 3.45Å; A52-A56 PolarHBondContact O-N 3.35Å
53	Q	97.8	Very high	97.1	Very high	132 Å²	132	95.5 Å²	95.5	62%	0.617	51%	0.505	S	S	*	.	H	α-helix	trans	-62.4	-44.8	174.6	-175	-179.4	7.6	0	0	111.6	A49 F50 K51 A56 H57	A49-Q53 PolarHBondContact O-N 3.34Å; F50-Q53 PolarHBondContact O-N 3.35Å; K51-Q53 VanDerWaalsContact C-N 3.3Å; K51-Q53 PolarHBondContact O-N 3.03Å; Q53-A56 PolarHBondContact O-N 2.97Å; Q53-H57 WeakPolarHBondContact O-CB 3.46Å; Q53-H57 PolarHBondContact O-N 3.45Å
54	Q	98	Very high	96.9	Very high	91 Å²	91	98.3 Å²	98.3	43%	0.425	51%	0.51	S	S	.	.	H	α-helix	trans	-68.3	-37.5	178.8	-97.4	-46.7	104	0	0	113.5	F50 K51 H57 Y58	F50-Q54 HydrophobicContact CE1-CG 4.21Å; F50-Q54 HydrophobicContact CZ-CG 4.1Å; F50-Q54 PolarHBondContact O-N 3.5Å; K51-Q54 PolarHBondContact O-N 3.4Å; Q54-H57 PolarHBondContact O-N 3.1Å; Q54-Y58 VanDerWaalsContact O-CB 3.3Å; Q54-Y58 WeakPolarHBondContact O-CB 3.5Å; Q54-Y58 PolarHBondContact O-N 3.33Å
55	E	97.8	Very high	96.5	Very high	125 Å²	125	97.3 Å²	97.3	58%	0.584	51%	0.507	S	S	*	.	H	α-helix	trans	-64.3	-43.1	175.4	-171.1	175.6	-179.6	0	0	110.6	K51 A52 H57 Y58 N59	K51-E55 WeakPolarHBondContact O-CB 3.3Å; K51-E55 PolarHBondContact O-N 3.02Å; A52-E55 PolarHBondContact O-N 2.68Å; E55-H57 PolarHBondContact O-N 3.01Å; E55-Y58 PolarHBondContact O-N 2.85Å; E55-N59 WeakPolarHBondContact O-CB 3.04Å; E55-N59 PolarHBondContact O-N 3.29Å; E55-N59 PolarHBondContact O-ND2 2.94Å; E55-N59 PolarHBondContact O-OD1 2.9Å
56	A	97.6	Very high	96	Very high	61 Å²	61	95.7 Å²	95.7	50%	0.504	50%	0.499	S	S	.	.	H	α-helix	trans	-61.1	-43.2	174.1	0	0	0	0	0	112.3	A52 Q53 S60	A52-A56 WeakPolarHBondContact O-CB 3.45Å; A52-A56 PolarHBondContact O-N 3.35Å; Q53-A56 PolarHBondContact O-N 2.97Å; A56-S60 WeakPolarHBondContact O-CB 3.36Å; A56-S60 PolarHBondContact O-N 3.44Å
57	H	97.3	Very high	95.5	Very high	96 Å²	96	92.5 Å²	92.5	44%	0.444	49%	0.493	S	S	.	.	H	α-helix	trans	-63.9	-44.9	176.1	177.9	-98.7	0	0	0	112	Q53 Q54 E55 S60 L61	Q53-H57 WeakPolarHBondContact O-CB 3.46Å; Q53-H57 PolarHBondContact O-N 3.45Å; Q54-H57 PolarHBondContact O-N 3.1Å; E55-H57 PolarHBondContact O-N 3.01Å; H57-S60 WeakPolarHBondContact O-CB 3.44Å; H57-S60 PolarHBondContact O-N 2.86Å; H57-L61 WeakPolarHBondContact CE1-CD1 3.34Å; H57-L61 PolarHBondContact O-N 3.45Å
58	Y	97.4	Very high	94.8	Very high	145 Å²	145	93.8 Å²	93.8	57%	0.569	49%	0.494	S	S	*	.	H	α-helix	trans	-61.2	-47.6	177.2	-178	-92.5	0	0	0	111.4	Q54 E55 S60 L61 E62	Q54-Y58 VanDerWaalsContact O-CB 3.3Å; Q54-Y58 WeakPolarHBondContact O-CB 3.5Å; Q54-Y58 PolarHBondContact O-N 3.33Å; E55-Y58 PolarHBondContact O-N 2.85Å; Y58-S60 VanDerWaalsContact C-N 3.28Å; Y58-S60 PolarHBondContact O-N 3.31Å; Y58-L61 WeakPolarHBondContact O-CB 3.49Å; Y58-L61 PolarHBondContact O-N 3.44Å; Y58-L61 VanDerWaalsContact O-N 3.1Å; Y58-E62 WeakPolarHBondContact CE1-OE2 3.35Å; Y58-E62 WeakPolarHBondContact O-CB 3.48Å; Y58-E62 PolarHBondContact O-N 2.82Å
59	N	96.9	Very high	94.1	Very high	69 Å²	69	96.8 Å²	96.8	37%	0.369	50%	0.5	S	S	.	.	H	α-helix	trans	-60.9	-37.9	177.6	-68.6	-13.8	0	0	0	111.6	E55 E62 L63	E55-N59 WeakPolarHBondContact O-CB 3.04Å; E55-N59 PolarHBondContact O-N 3.29Å; E55-N59 PolarHBondContact O-ND2 2.94Å; E55-N59 PolarHBondContact O-OD1 2.9Å; N59-E62 PolarHBondContact O-N 3.34Å; N59-L63 WeakPolarHBondContact O-CB 3.34Å; N59-L63 VanDerWaalsContact O-CG 3.32Å; N59-L63 WeakPolarHBondContact O-CG 3.25Å; N59-L63 PolarHBondContact O-N 3.48Å
60	S	95.9	Very high	93.4	Very high	72 Å²	72	96 Å²	96	50%	0.503	50%	0.497	S	S	.	.	H	α-helix	trans	-64	-42.5	174.5	-174	0	0	0	0	112.2	A56 H57 Y58 Q64	A56-S60 WeakPolarHBondContact O-CB 3.36Å; A56-S60 PolarHBondContact O-N 3.44Å; H57-S60 WeakPolarHBondContact O-CB 3.44Å; H57-S60 PolarHBondContact O-N 2.86Å; Y58-S60 VanDerWaalsContact C-N 3.28Å; Y58-S60 PolarHBondContact O-N 3.31Å; S60-Q64 WeakPolarHBondContact O-CB 3.49Å; S60-Q64 PolarHBondContact O-N 3.41Å
61	L	95.5	Very high	92.9	Very high	75 Å²	75	93.9 Å²	93.9	39%	0.393	50%	0.497	S	S	.	.	H	α-helix	trans	-65.8	-42.6	176.4	-73.9	177.4	0	0	0	111.4	H57 Y58 L63 Q64 V65	H57-L61 WeakPolarHBondContact CE1-CD1 3.34Å; H57-L61 PolarHBondContact O-N 3.45Å; Y58-L61 WeakPolarHBondContact O-CB 3.49Å; Y58-L61 PolarHBondContact O-N 3.44Å; Y58-L61 VanDerWaalsContact O-N 3.1Å; L61-L63 PolarHBondContact O-N 3Å; L61-Q64 PolarHBondContact O-N 2.94Å; L61-V65 WeakPolarHBondContact O-CB 3.49Å; L61-V65 WeakPolarHBondContact O-CG2 3.27Å; L61-V65 PolarHBondContact O-N 3.35Å
62	E	94.1	Very high	92.5	Very high	87 Å²	87	95.3 Å²	95.3	41%	0.407	50%	0.5	S	S	.	.	H	α-helix	trans	-61.4	-45.2	177.7	-173.8	175.7	-176.5	0	0	111.3	Y58 N59 Q64 V65 N66	Y58-E62 WeakPolarHBondContact CE1-OE2 3.35Å; Y58-E62 WeakPolarHBondContact O-CB 3.48Å; Y58-E62 PolarHBondContact O-N 2.82Å; N59-E62 PolarHBondContact O-N 3.34Å; E62-Q64 VanDerWaalsContact C-N 3.33Å; E62-Q64 PolarHBondContact O-N 3.42Å; E62-V65 PolarHBondContact O-N 3.49Å; E62-N66 VanDerWaalsContact O-CB 3.27Å; E62-N66 WeakPolarHBondContact O-CB 3.5Å; E62-N66 VanDerWaalsContact O-CG 3.28Å; E62-N66 PolarHBondContact O-N 3.48Å; E62-N66 PolarHBondContact O-ND2 2.98Å
63	L	92.7	Very high	92.1	Very high	117 Å²	117	99.7 Å²	99.7	61%	0.613	51%	0.511	S	S	*	.	H	α-helix	trans	-60.9	-41.2	174	-75.3	171.1	0	0	0	112.2	N59 L61 S67	N59-L63 WeakPolarHBondContact O-CB 3.34Å; N59-L63 VanDerWaalsContact O-CG 3.32Å; N59-L63 WeakPolarHBondContact O-CG 3.25Å; N59-L63 PolarHBondContact O-N 3.48Å; L61-L63 PolarHBondContact O-N 3Å; L63-S67 VanDerWaalsContact O-CB 3.25Å; L63-S67 WeakPolarHBondContact O-CB 3.46Å; L63-S67 PolarHBondContact O-N 2.85Å; L63-S67 PolarHBondContact O-OG 3.18Å
64	Q	91.6	Very high	91.9	Very high	107 Å²	107	97.7 Å²	97.7	50%	0.5	50%	0.502	S	S	.	.	H	α-helix	trans	-64.3	-45.3	177.9	-174.1	-179.7	6.7	0	0	111.5	S60 L61 E62 S67 Q68	S60-Q64 WeakPolarHBondContact O-CB 3.49Å; S60-Q64 PolarHBondContact O-N 3.41Å; L61-Q64 PolarHBondContact O-N 2.94Å; E62-Q64 VanDerWaalsContact C-N 3.33Å; E62-Q64 PolarHBondContact O-N 3.42Å; Q64-S67 PolarHBondContact O-N 2.97Å; Q64-Q68 WeakPolarHBondContact O-CG 3.45Å; Q64-Q68 PolarHBondContact O-N 2.95Å; Q64-Q68 VanDerWaalsContact O-N 3.12Å
65	V	90.4	Very high	91.7	Very high	65 Å²	65	97.3 Å²	97.3	39%	0.394	50%	0.502	S	S	.	.	H	α-helix	trans	-65	-46.4	178.1	170	0	0	0	0	110.6	L61 E62 S67 Q68 Y69	L61-V65 WeakPolarHBondContact O-CB 3.49Å; L61-V65 WeakPolarHBondContact O-CG2 3.27Å; L61-V65 PolarHBondContact O-N 3.35Å; E62-V65 PolarHBondContact O-N 3.49Å; V65-S67 VanDerWaalsContact C-N 3.28Å; V65-S67 PolarHBondContact O-N 3Å; V65-Q68 WeakPolarHBondContact O-CB 3.32Å; V65-Q68 PolarHBondContact O-N 3.3Å; V65-Y69 HydrophobicContact CG1-CD2 4.31Å; V65-Y69 HydrophobicContact CG1-CE2 3.49Å; V65-Y69 VanDerWaalsContact CG1-CE2 3.49Å; V65-Y69 WeakPolarHBondContact O-CD2 3.49Å; V65-Y69 PolarHBondContact O-N 3.38Å
66	N	87.8	Confident	91.6	Very high	88 Å²	88	94.7 Å²	94.7	47%	0.471	50%	0.497	S	S	.	.	H	α-helix	trans	-62.1	-36.8	177.7	-74.4	-18	0	0	0	112.4	E62 Q68 Y69	E62-N66 VanDerWaalsContact O-CB 3.27Å; E62-N66 WeakPolarHBondContact O-CB 3.5Å; E62-N66 VanDerWaalsContact O-CG 3.28Å; E62-N66 PolarHBondContact O-N 3.48Å; E62-N66 PolarHBondContact O-ND2 2.98Å; N66-Q68 VanDerWaalsContact C-N 3.29Å; N66-Q68 PolarHBondContact O-N 3.41Å; N66-Y69 PolarHBondContact O-N 3.37Å
67	S	86.9	Confident	91.6	Very high	83 Å²	83	99.5 Å²	99.5	58%	0.58	50%	0.502	S	S	*	.	H	α-helix	trans	-69.4	-25.7	175.4	-59	0	0	0	0	113	L63 Q64 V65 P71	L63-S67 VanDerWaalsContact O-CB 3.25Å; L63-S67 WeakPolarHBondContact O-CB 3.46Å; L63-S67 PolarHBondContact O-N 2.85Å; L63-S67 PolarHBondContact O-OG 3.18Å; Q64-S67 PolarHBondContact O-N 2.97Å; V65-S67 VanDerWaalsContact C-N 3.28Å; V65-S67 PolarHBondContact O-N 3Å; S67-P71 WeakPolarHBondContact O-CD 3.49Å
68	Q	83.1	Confident	91.6	Very high	97 Å²	97	99.4 Å²	99.4	45%	0.453	50%	0.502	S	S	.	.	H	α-helix	trans	-79.2	-26.7	178.4	-75.8	-179.6	24.5	0	0	113.3	Q64 V65 N66 G70 P71 Y72	Q64-Q68 WeakPolarHBondContact O-CG 3.45Å; Q64-Q68 PolarHBondContact O-N 2.95Å; Q64-Q68 VanDerWaalsContact O-N 3.12Å; V65-Q68 WeakPolarHBondContact O-CB 3.32Å; V65-Q68 PolarHBondContact O-N 3.3Å; N66-Q68 VanDerWaalsContact C-N 3.29Å; N66-Q68 PolarHBondContact O-N 3.41Å; Q68-G70 PolarHBondContact O-N 2.96Å; Q68-P71 WeakPolarHBondContact O-CD 3.44Å; Q68-Y72 WeakPolarHBondContact O-CB 3.48Å; Q68-Y72 PolarHBondContact O-N 3.37Å
69	Y	82.8	Confident	91.6	Very high	152 Å²	152	97.6 Å²	97.6	60%	0.596	50%	0.5	S	S	*	.	H	α-helix	trans	-62.1	-43.5	-178.7	-75.4	-60.3	0	0	0	113.1	V65 N66 Y72 E73	V65-Y69 HydrophobicContact CG1-CD2 4.31Å; V65-Y69 HydrophobicContact CG1-CE2 3.49Å; V65-Y69 VanDerWaalsContact CG1-CE2 3.49Å; V65-Y69 WeakPolarHBondContact O-CD2 3.49Å; V65-Y69 PolarHBondContact O-N 3.38Å; N66-Y69 PolarHBondContact O-N 3.37Å; Y69-Y72 PolarHBondContact O-N 2.95Å; Y69-E73 WeakPolarHBondContact O-CB 3.3Å; Y69-E73 PolarHBondContact O-N 3.26Å
70	G	83.4	Confident	91.6	Very high	44 Å²	44	98.6 Å²	98.6	45%	0.454	51%	0.508	S	S	.	.	H	α-helix	trans	-58.8	-54.8	-179.2	0	0	0	0	0	113.5	Q68 Y72 E73 E74	Q68-G70 PolarHBondContact O-N 2.96Å; G70-Y72 VanDerWaalsContact C-N 3.29Å; G70-Y72 PolarHBondContact O-N 2.99Å; G70-E73 PolarHBondContact O-N 3.09Å; G70-E74 PolarHBondContact O-N 3.43Å; G70-E74 VanDerWaalsContact O-N 3.1Å
71	P	88	Confident	91.7	Very high	88 Å²	88	98.7 Å²	98.7	57%	0.571	50%	0.503	S	S	*	.	H	α-helix	trans	-59.5	-36.1	175.5	-26	34.7	0	0	0	113.8	S67 Q68 L75	S67-P71 WeakPolarHBondContact O-CD 3.49Å; Q68-P71 WeakPolarHBondContact O-CD 3.44Å; P71-L75 VanDerWaalsContact O-CB 3.3Å; P71-L75 WeakPolarHBondContact O-CB 3.28Å; P71-L75 PolarHBondContact O-N 2.96Å
72	Y	88.7	Confident	91.9	Very high	151 Å²	151	101.2 Å²	101.2	59%	0.592	51%	0.513	S	S	*	.	H	α-helix	trans	-68.3	-42	177.5	-110.1	-80.5	0	0	0	112.6	Q68 Y69 G70 L75 C76	Q68-Y72 WeakPolarHBondContact O-CB 3.48Å; Q68-Y72 PolarHBondContact O-N 3.37Å; Y69-Y72 PolarHBondContact O-N 2.95Å; G70-Y72 VanDerWaalsContact C-N 3.29Å; G70-Y72 PolarHBondContact O-N 2.99Å; Y72-L75 PolarHBondContact O-N 3.2Å; Y72-C76 WeakPolarHBondContact O-CB 3.4Å; Y72-C76 PolarHBondContact O-N 2.97Å; Y72-C76 PolarHBondContact O-SG 3.39Å; Y72-C76 VanDerWaalsContact O-SG 3.35Å
73	E	91.1	Very high	92.1	Very high	148 Å²	148	103.4 Å²	103.4	69%	0.692	52%	0.523	S	S	*	.	H	α-helix	trans	-62.6	-45.1	177	-174	176.9	179.1	0	0	111	Y69 G70 C76 R77	Y69-E73 WeakPolarHBondContact O-CB 3.3Å; Y69-E73 PolarHBondContact O-N 3.26Å; G70-E73 PolarHBondContact O-N 3.09Å; E73-C76 PolarHBondContact O-N 2.97Å; E73-R77 WeakPolarHBondContact O-CB 3.35Å; E73-R77 PolarHBondContact O-N 3.45Å
74	E	92.8	Very high	92.3	Very high	90 Å²	90	102.1 Å²	102.1	42%	0.421	52%	0.517	S	S	.	.	H	α-helix	trans	-64.1	-41.5	176.8	-176.9	56	-151.1	0	0	111.9	G70 R77 Q78	G70-E74 PolarHBondContact O-N 3.43Å; G70-E74 VanDerWaalsContact O-N 3.1Å; E74-R77 WeakPolarHBondContact O-CB 3.42Å; E74-R77 PolarHBondContact O-N 3.05Å; E74-Q78 WeakPolarHBondContact O-CG 3.35Å; E74-Q78 PolarHBondContact O-N 3.46Å; E74-Q78 PolarHBondContact OE1-NE2 2.98Å
75	L	94.7	Very high	92.6	Very high	84 Å²	84	100.7 Å²	100.7	44%	0.44	51%	0.512	S	S	.	.	H	α-helix	trans	-60.9	-46.7	174.3	-180	65.6	0	0	0	111.7	P71 Y72 R77 Q78 M79	P71-L75 VanDerWaalsContact O-CB 3.3Å; P71-L75 WeakPolarHBondContact O-CB 3.28Å; P71-L75 PolarHBondContact O-N 2.96Å; Y72-L75 PolarHBondContact O-N 3.2Å; L75-R77 VanDerWaalsContact C-N 3.28Å; L75-R77 PolarHBondContact O-N 2.91Å; L75-Q78 PolarHBondContact O-N 2.84Å; L75-M79 HydrophobicContact CD1-CG 4.48Å; L75-M79 HydrophobicContact CG-SD 4.37Å; L75-M79 WeakPolarHBondContact O-CG 3.45Å; L75-M79 PolarHBondContact O-N 2.95Å
76	C	95.7	Very high	93	Very high	69 Å²	69	100.3 Å²	100.3	47%	0.466	51%	0.513	S	S	.	.	H	α-helix	trans	-59.6	-40.6	176.2	-77.7	0	0	0	0	111.6	Y72 E73 T80	Y72-C76 WeakPolarHBondContact O-CB 3.4Å; Y72-C76 PolarHBondContact O-N 2.97Å; Y72-C76 PolarHBondContact O-SG 3.39Å; Y72-C76 VanDerWaalsContact O-SG 3.35Å; E73-C76 PolarHBondContact O-N 2.97Å; C76-T80 WeakPolarHBondContact O-CB 3.34Å; C76-T80 PolarHBondContact O-N 2.91Å; C76-T80 PolarHBondContact O-OG1 3.44Å
77	R	96.7	Very high	93.5	Very high	163 Å²	163	102.1 Å²	102.1	62%	0.615	52%	0.52	S	S	*	.	H	α-helix	trans	-62.8	-49.3	176.3	-174.5	179.5	-178.3	155.1	1.8	111.5	E73 E74 L75 M79 T80 D81	E73-R77 WeakPolarHBondContact O-CB 3.35Å; E73-R77 PolarHBondContact O-N 3.45Å; E74-R77 WeakPolarHBondContact O-CB 3.42Å; E74-R77 PolarHBondContact O-N 3.05Å; L75-R77 VanDerWaalsContact C-N 3.28Å; L75-R77 PolarHBondContact O-N 2.91Å; R77-M79 PolarHBondContact O-N 3.27Å; R77-T80 WeakPolarHBondContact O-CB 3.34Å; R77-T80 PolarHBondContact O-N 2.9Å; R77-T80 VanDerWaalsContact O-N 3.13Å; R77-D81 PolarHBondContact O-N 3.48Å
78	Q	97.2	Very high	94	Very high	94 Å²	94	103 Å²	103	44%	0.439	52%	0.515	S	S	.	.	H	α-helix	trans	-59.4	-47.1	178.3	-71.8	174.8	15.8	0	0	111.8	E74 L75 T80 D81 E82	E74-Q78 WeakPolarHBondContact O-CG 3.35Å; E74-Q78 PolarHBondContact O-N 3.46Å; E74-Q78 PolarHBondContact OE1-NE2 2.98Å; L75-Q78 PolarHBondContact O-N 2.84Å; Q78-T80 VanDerWaalsContact C-N 3.28Å; Q78-T80 PolarHBondContact O-N 3.21Å; Q78-D81 PolarHBondContact O-N 3.35Å; Q78-E82 WeakPolarHBondContact O-CG 3.43Å; Q78-E82 PolarHBondContact O-N 2.99Å
79	M	97.5	Very high	94.7	Very high	106 Å²	106	105.4 Å²	105.4	52%	0.522	52%	0.52	S	S	.	.	H	α-helix	trans	-60.6	-39.1	175.9	-71.1	-176	72.3	0	0	112	L75 R77 E82 Q83	L75-M79 HydrophobicContact CD1-CG 4.48Å; L75-M79 HydrophobicContact CG-SD 4.37Å; L75-M79 WeakPolarHBondContact O-CG 3.45Å; L75-M79 PolarHBondContact O-N 2.95Å; R77-M79 PolarHBondContact O-N 3.27Å; M79-E82 PolarHBondContact O-N 3.44Å; M79-Q83 VanDerWaalsContact O-CG 3.24Å; M79-Q83 WeakPolarHBondContact O-CG 3.47Å; M79-Q83 PolarHBondContact O-N 2.92Å
80	T	97.7	Very high	95.4	Very high	90 Å²	90	101.3 Å²	101.3	55%	0.552	51%	0.513	S	S	*	.	H	α-helix	trans	-65.3	-45.2	177.6	-58.5	0	0	0	0	111.2	C76 R77 Q78 E82 Q83 L84	C76-T80 WeakPolarHBondContact O-CB 3.34Å; C76-T80 PolarHBondContact O-N 2.91Å; C76-T80 PolarHBondContact O-OG1 3.44Å; R77-T80 WeakPolarHBondContact O-CB 3.34Å; R77-T80 PolarHBondContact O-N 2.9Å; R77-T80 VanDerWaalsContact O-N 3.13Å; Q78-T80 VanDerWaalsContact C-N 3.28Å; Q78-T80 PolarHBondContact O-N 3.21Å; T80-E82 VanDerWaalsContact C-N 3.35Å; T80-E82 PolarHBondContact O-N 3.01Å; T80-Q83 PolarHBondContact O-N 3.34Å; T80-L84 WeakPolarHBondContact O-CB 3.47Å; T80-L84 PolarHBondContact O-N 3.39Å
81	D	98	Very high	96.1	Very high	74 Å²	74	104.8 Å²	104.8	40%	0.396	52%	0.516	S	S	.	.	H	α-helix	trans	-63.5	-40.3	177.8	-74.3	-20.9	0	0	0	111.4	R77 Q78 L84 N85	R77-D81 PolarHBondContact O-N 3.48Å; Q78-D81 PolarHBondContact O-N 3.35Å; D81-L84 PolarHBondContact O-N 3.49Å; D81-N85 VanDerWaalsContact O-CB 3.3Å; D81-N85 WeakPolarHBondContact O-CB 3.49Å; D81-N85 PolarHBondContact O-N 3.02Å; D81-N85 PolarHBondContact O-ND2 3.24Å
82	E	98.2	Very high	96.5	Very high	129 Å²	129	106.1 Å²	106.1	60%	0.603	52%	0.515	S	S	*	.	H	α-helix	trans	-61.3	-45.9	174.1	-75.6	-179.2	174.5	0	0	112.5	Q78 M79 T80 N85 S86	Q78-E82 WeakPolarHBondContact O-CG 3.43Å; Q78-E82 PolarHBondContact O-N 2.99Å; M79-E82 PolarHBondContact O-N 3.44Å; T80-E82 VanDerWaalsContact C-N 3.35Å; T80-E82 PolarHBondContact O-N 3.01Å; E82-N85 PolarHBondContact O-N 3.33Å; E82-S86 WeakPolarHBondContact O-CB 3.42Å; E82-S86 PolarHBondContact O-N 3Å
83	Q	98.2	Very high	96.9	Very high	132 Å²	132	103.6 Å²	103.6	62%	0.617	52%	0.519	S	S	*	.	H	α-helix	trans	-64.5	-42.9	177.7	-70.7	-65.4	-17	0	0	111.6	M79 T80 N85 S86 M87	M79-Q83 VanDerWaalsContact O-CG 3.24Å; M79-Q83 WeakPolarHBondContact O-CG 3.47Å; M79-Q83 PolarHBondContact O-N 2.92Å; T80-Q83 PolarHBondContact O-N 3.34Å; Q83-N85 VanDerWaalsContact C-N 3.34Å; Q83-N85 PolarHBondContact O-N 2.88Å; Q83-S86 WeakPolarHBondContact O-CB 3.47Å; Q83-S86 PolarHBondContact O-N 3.09Å; Q83-M87 WeakPolarHBondContact O-CB 3.34Å; Q83-M87 PolarHBondContact O-N 3.45Å
84	L	98.1	Very high	97.2	Very high	91 Å²	91	100.8 Å²	100.8	48%	0.476	51%	0.509	S	S	.	.	H	α-helix	trans	-61.1	-44.8	176.6	-169.6	72.5	0	0	0	111	T80 D81 S86 M87 Q88	T80-L84 WeakPolarHBondContact O-CB 3.47Å; T80-L84 PolarHBondContact O-N 3.39Å; D81-L84 PolarHBondContact O-N 3.49Å; L84-S86 VanDerWaalsContact C-N 3.34Å; L84-S86 PolarHBondContact O-N 3.43Å; L84-M87 HydrophobicContact CD1-CE 3.82Å; L84-M87 PolarHBondContact O-N 3.23Å; L84-Q88 WeakPolarHBondContact O-CB 3.34Å; L84-Q88 PolarHBondContact O-N 3.11Å
85	N	98.2	Very high	97.4	Very high	77 Å²	77	102.8 Å²	102.8	41%	0.412	51%	0.512	S	S	.	.	H	α-helix	trans	-63	-39.8	176.3	-76.8	-41.9	0	0	0	112	D81 E82 Q83 Q88 R89	D81-N85 VanDerWaalsContact O-CB 3.3Å; D81-N85 WeakPolarHBondContact O-CB 3.49Å; D81-N85 PolarHBondContact O-N 3.02Å; D81-N85 PolarHBondContact O-ND2 3.24Å; E82-N85 PolarHBondContact O-N 3.33Å; Q83-N85 VanDerWaalsContact C-N 3.34Å; Q83-N85 PolarHBondContact O-N 2.88Å; N85-Q88 PolarHBondContact O-N 3.46Å; N85-R89 WeakPolarHBondContact O-CG 3.41Å; N85-R89 PolarHBondContact O-N 3.49Å
86	S	98	Very high	97.5	Very high	57 Å²	57	103.9 Å²	103.9	40%	0.399	52%	0.519	S	S	.	.	H	α-helix	trans	-62.7	-47.2	175	-170.6	0	0	0	0	111.9	E82 Q83 L84 Q88 R89 S90	E82-S86 WeakPolarHBondContact O-CB 3.42Å; E82-S86 PolarHBondContact O-N 3Å; Q83-S86 WeakPolarHBondContact O-CB 3.47Å; Q83-S86 PolarHBondContact O-N 3.09Å; L84-S86 VanDerWaalsContact C-N 3.34Å; L84-S86 PolarHBondContact O-N 3.43Å; S86-Q88 VanDerWaalsContact C-N 3.33Å; S86-Q88 PolarHBondContact O-N 2.93Å; S86-R89 PolarHBondContact O-N 2.88Å; S86-S90 PolarHBondContact O-N 3.36Å
87	M	97.8	Very high	97.6	Very high	126 Å²	126	103.4 Å²	103.4	62%	0.621	52%	0.52	S	S	*	.	H	α-helix	trans	-60.5	-43.4	176.4	-174.9	177.9	72.1	0	0	111.3	Q83 L84 S90 F91	Q83-M87 WeakPolarHBondContact O-CB 3.34Å; Q83-M87 PolarHBondContact O-N 3.45Å; L84-M87 HydrophobicContact CD1-CE 3.82Å; L84-M87 PolarHBondContact O-N 3.23Å; M87-S90 PolarHBondContact O-N 3.31Å; M87-F91 WeakPolarHBondContact O-CB 3.48Å; M87-F91 PolarHBondContact O-N 3.02Å
88	Q	98	Very high	97.6	Very high	101 Å²	101	98.5 Å²	98.5	47%	0.472	51%	0.514	S	S	.	.	H	α-helix	trans	-63.1	-43.4	177.8	-178.3	168.6	-30.5	0	0	112.1	L84 N85 S86 F91 Q92	L84-Q88 WeakPolarHBondContact O-CB 3.34Å; L84-Q88 PolarHBondContact O-N 3.11Å; N85-Q88 PolarHBondContact O-N 3.46Å; S86-Q88 VanDerWaalsContact C-N 3.33Å; S86-Q88 PolarHBondContact O-N 2.93Å; Q88-F91 PolarHBondContact O-N 3.4Å; Q88-Q92 WeakPolarHBondContact O-CB 3.49Å; Q88-Q92 VanDerWaalsContact O-CG 3.31Å; Q88-Q92 WeakPolarHBondContact O-CG 3.39Å; Q88-Q92 PolarHBondContact O-N 3.02Å
89	R	98.1	Very high	97.6	Very high	147 Å²	147	97.8 Å²	97.8	56%	0.555	51%	0.513	S	S	*	.	H	α-helix	trans	-61.2	-45.4	174.7	-74.4	-173.7	-63.7	-96.5	2.3	111.8	N85 S86 F91 Q92 S93	N85-R89 WeakPolarHBondContact O-CG 3.41Å; N85-R89 PolarHBondContact O-N 3.49Å; S86-R89 PolarHBondContact O-N 2.88Å; R89-F91 VanDerWaalsContact C-N 3.34Å; R89-F91 PolarHBondContact O-N 2.9Å; R89-Q92 PolarHBondContact O-N 2.71Å; R89-S93 WeakPolarHBondContact O-CB 3.35Å; R89-S93 PolarHBondContact O-N 3.45Å
90	S	97.5	Very high	97.6	Very high	66 Å²	66	99.3 Å²	99.3	46%	0.462	52%	0.518	S	S	.	.	H	α-helix	trans	-60.6	-44.1	177.1	-177.1	0	0	0	0	111.7	S86 M87 S93 N94	S86-S90 PolarHBondContact O-N 3.36Å; M87-S90 PolarHBondContact O-N 3.31Å; S90-S93 PolarHBondContact O-N 2.9Å; S90-N94 WeakPolarHBondContact O-CB 2.86Å; S90-N94 PolarHBondContact O-N 2.94Å; S90-N94 VanDerWaalsContact O-N 3.14Å; S90-N94 PolarHBondContact O-ND2 2.89Å
91	F	97.7	Very high	97.5	Very high	117 Å²	117	100 Å²	100	51%	0.513	52%	0.518	S	S	.	.	H	α-helix	trans	-60.4	-50.5	175	173.9	-101	0	0	0	111.6	M87 Q88 R89 S93 N94 R95	M87-F91 WeakPolarHBondContact O-CB 3.48Å; M87-F91 PolarHBondContact O-N 3.02Å; Q88-F91 PolarHBondContact O-N 3.4Å; R89-F91 VanDerWaalsContact C-N 3.34Å; R89-F91 PolarHBondContact O-N 2.9Å; F91-S93 VanDerWaalsContact C-N 3.33Å; F91-S93 PolarHBondContact O-N 3.33Å; F91-N94 PolarHBondContact O-N 3.46Å; F91-R95 HydrophobicContact CZ-CG 4.28Å; F91-R95 VanDerWaalsContact O-CB 3.28Å; F91-R95 WeakPolarHBondContact O-CB 3.4Å; F91-R95 PolarHBondContact O-N 3.26Å
92	Q	97.2	Very high	97.5	Very high	117 Å²	117	101.7 Å²	101.7	55%	0.547	53%	0.527	S	S	.	.	H	α-helix	trans	-59.5	-42.5	-179.3	-73.5	179.5	3	0	0	112.2	Q88 R89 N94	Q88-Q92 WeakPolarHBondContact O-CB 3.49Å; Q88-Q92 VanDerWaalsContact O-CG 3.31Å; Q88-Q92 WeakPolarHBondContact O-CG 3.39Å; Q88-Q92 PolarHBondContact O-N 3.02Å; R89-Q92 PolarHBondContact O-N 2.71Å; Q92-N94 VanDerWaalsContact C-N 3.33Å; Q92-N94 PolarHBondContact O-N 3.19Å
93	S	97.3	Very high	97.4	Very high	98 Å²	98	100.4 Å²	100.4	69%	0.685	52%	0.523	S	S	*	.	H	α-helix	trans	-65.4	-34.7	179	-171.7	0	0	0	0	112.9	R89 S90 F91	R89-S93 WeakPolarHBondContact O-CB 3.35Å; R89-S93 PolarHBondContact O-N 3.45Å; S90-S93 PolarHBondContact O-N 2.9Å; F91-S93 VanDerWaalsContact C-N 3.33Å; F91-S93 PolarHBondContact O-N 3.33Å
94	N	97	Very high	97.3	Very high	88 Å²	88	97.1 Å²	97.1	47%	0.471	52%	0.515	S	S	.	.	H	α-helix	trans	-99.4	-13.4	-172.9	-67.3	-57.1	0	0	0	113.8	S90 F91 Q92 N96 A97 A98	S90-N94 WeakPolarHBondContact O-CB 2.86Å; S90-N94 PolarHBondContact O-N 2.94Å; S90-N94 VanDerWaalsContact O-N 3.14Å; S90-N94 PolarHBondContact O-ND2 2.89Å; F91-N94 PolarHBondContact O-N 3.46Å; Q92-N94 VanDerWaalsContact C-N 3.33Å; Q92-N94 PolarHBondContact O-N 3.19Å; N94-N96 PolarHBondContact O-N 3.39Å; N94-A97 PolarHBondContact O-N 2.91Å; N94-A98 WeakPolarHBondContact O-CB 3.47Å; N94-A98 PolarHBondContact O-N 2.9Å
95	R	96.8	Very high	97.1	Very high	132 Å²	132	99.4 Å²	99.4	50%	0.498	52%	0.521	S	S	.	.	H	α-helix	trans	-52	-50.3	-173.9	177.5	177.9	177.6	140.5	1.3	113.1	F91 A98 L99	F91-R95 HydrophobicContact CZ-CG 4.28Å; F91-R95 VanDerWaalsContact O-CB 3.28Å; F91-R95 WeakPolarHBondContact O-CB 3.4Å; F91-R95 PolarHBondContact O-N 3.26Å; R95-A98 PolarHBondContact O-N 2.93Å; R95-L99 HydrophobicContact CG-CD1 3.99Å; R95-L99 WeakPolarHBondContact O-CB 3.3Å; R95-L99 WeakPolarHBondContact O-CG 3.46Å; R95-L99 PolarHBondContact O-N 2.91Å
96	N	96.4	Very high	97	Very high	108 Å²	108	100.4 Å²	100.4	58%	0.578	53%	0.53	S	S	*	.	H	α-helix	trans	-69.8	-40.5	-175.1	-69.7	-21.3	0	0	0	112	N94 L99 Q100	N94-N96 PolarHBondContact O-N 3.39Å; N96-L99 PolarHBondContact O-N 3.46Å; N96-Q100 WeakPolarHBondContact O-CB 3.44Å; N96-Q100 WeakPolarHBondContact O-CG 3.39Å; N96-Q100 PolarHBondContact O-N 3.4Å
97	A	97.1	Very high	96.8	Very high	59 Å²	59	104.1 Å²	104.1	49%	0.488	55%	0.545	S	S	.	.	H	α-helix	trans	-63.1	-43.5	176.4	0	0	0	0	0	111.4	N94 Q100 L101	N94-A97 PolarHBondContact O-N 2.91Å; A97-Q100 PolarHBondContact O-N 3.34Å; A97-L101 WeakPolarHBondContact O-CB 3.29Å; A97-L101 PolarHBondContact O-N 2.94Å
98	A	97.4	Very high	96.7	Very high	59 Å²	59	101.6 Å²	101.6	49%	0.488	53%	0.534	S	S	.	.	H	α-helix	trans	-63	-43.1	176.1	0	0	0	0	0	112.1	N94 R95 L101 L102	N94-A98 WeakPolarHBondContact O-CB 3.47Å; N94-A98 PolarHBondContact O-N 2.9Å; R95-A98 PolarHBondContact O-N 2.93Å; A98-L101 PolarHBondContact O-N 3.25Å; A98-L102 WeakPolarHBondContact O-CB 3.45Å; A98-L102 PolarHBondContact O-N 3.44Å
99	L	97.2	Very high	96.3	Very high	79 Å²	79	102.3 Å²	102.3	41%	0.414	55%	0.545	S	S	.	.	H	α-helix	trans	-63.7	-43.8	176.6	-76.8	171.5	0	0	0	112.3	R95 N96 L102 L103	R95-L99 HydrophobicContact CG-CD1 3.99Å; R95-L99 WeakPolarHBondContact O-CB 3.3Å; R95-L99 WeakPolarHBondContact O-CG 3.46Å; R95-L99 PolarHBondContact O-N 2.91Å; N96-L99 PolarHBondContact O-N 3.46Å; L99-L102 PolarHBondContact O-N 2.96Å; L99-L103 WeakPolarHBondContact O-CB 3.33Å; L99-L103 WeakPolarHBondContact O-CG 3.48Å; L99-L103 PolarHBondContact O-N 2.99Å
100	Q	96.9	Very high	96	Very high	138 Å²	138	102.2 Å²	102.2	65%	0.645	55%	0.548	S	S	*	.	H	α-helix	trans	-62.1	-43.9	177	-75.8	176.7	0.1	0	0	111.6	N96 A97 L103 S104	N96-Q100 WeakPolarHBondContact O-CB 3.44Å; N96-Q100 WeakPolarHBondContact O-CG 3.39Å; N96-Q100 PolarHBondContact O-N 3.4Å; A97-Q100 PolarHBondContact O-N 3.34Å; Q100-L103 PolarHBondContact O-N 3.39Å; Q100-S104 WeakPolarHBondContact O-CB 3.39Å; Q100-S104 PolarHBondContact O-N 2.89Å; Q100-S104 PolarHBondContact O-OG 3.22Å
101	L	96.9	Very high	95.6	Very high	105 Å²	105	104.8 Å²	104.8	55%	0.55	56%	0.564	S	S	.	*	H	α-helix	trans	-59.9	-48.6	175.8	179.2	62.2	0	0	0	110.8	A97 A98 L103 S104 K105	A97-L101 WeakPolarHBondContact O-CB 3.29Å; A97-L101 PolarHBondContact O-N 2.94Å; A98-L101 PolarHBondContact O-N 3.25Å; L101-L103 PolarHBondContact O-N 3.11Å; L101-S104 PolarHBondContact O-N 3.44Å; L101-S104 PolarHBondContact O-OG 3.41Å; L101-K105 HydrophobicContact CD1-CG 4.35Å; L101-K105 WeakPolarHBondContact O-CG 3.36Å; L101-K105 PolarHBondContact O-N 3.45Å; L101-K105 VanDerWaalsContact O-N 3.09Å
102	L	96.7	Very high	95.2	Very high	110 Å²	110	105.4 Å²	105.4	58%	0.576	58%	0.577	S	S	*	*	H	α-helix	trans	-58.9	-49	179.1	-175.7	64	0	0	0	111.6	A98 L99 S104 K105 V106	A98-L102 WeakPolarHBondContact O-CB 3.45Å; A98-L102 PolarHBondContact O-N 3.44Å; L99-L102 PolarHBondContact O-N 2.96Å; L102-S104 PolarHBondContact O-N 3.43Å; L102-K105 PolarHBondContact O-N 3.06Å; L102-V106 HydrophobicContact CD1-CG2 4.39Å; L102-V106 VanDerWaalsContact O-CG2 3.31Å; L102-V106 WeakPolarHBondContact O-CG2 3.36Å; L102-V106 PolarHBondContact O-N 3.35Å
103	L	97	Very high	94.7	Very high	101 Å²	101	104.7 Å²	104.7	53%	0.529	58%	0.58	S	S	.	*	H	α-helix	trans	-61.5	-42.9	178.1	-72.7	171.1	0	0	0	112	L99 Q100 L101 K105 V106 L107	L99-L103 WeakPolarHBondContact O-CB 3.33Å; L99-L103 WeakPolarHBondContact O-CG 3.48Å; L99-L103 PolarHBondContact O-N 2.99Å; Q100-L103 PolarHBondContact O-N 3.39Å; L101-L103 PolarHBondContact O-N 3.11Å; L103-K105 VanDerWaalsContact C-N 3.25Å; L103-K105 PolarHBondContact O-N 2.96Å; L103-V106 PolarHBondContact O-N 3.45Å; L103-L107 WeakPolarHBondContact O-CB 3.41Å; L103-L107 WeakPolarHBondContact O-CG 3.45Å; L103-L107 PolarHBondContact O-N 3.27Å
104	S	96.3	Very high	94.3	Very high	63 Å²	63	106.1 Å²	106.1	44%	0.441	58%	0.576	S	S	.	*	H	α-helix	trans	-60.4	-36.5	178.6	75.2	0	0	0	0	112.3	Q100 L101 L102 D108	Q100-S104 WeakPolarHBondContact O-CB 3.39Å; Q100-S104 PolarHBondContact O-N 2.89Å; Q100-S104 PolarHBondContact O-OG 3.22Å; L101-S104 PolarHBondContact O-N 3.44Å; L101-S104 PolarHBondContact O-OG 3.41Å; L102-S104 PolarHBondContact O-N 3.43Å; S104-D108 VanDerWaalsContact O-CB 3.26Å; S104-D108 WeakPolarHBondContact O-CB 3.43Å; S104-D108 PolarHBondContact O-N 3.04Å
105	K	94.6	Very high	93.9	Very high	139 Å²	139	108.2 Å²	108.2	60%	0.604	59%	0.591	S	S	*	*	H	α-helix	trans	-77.3	-37	178.9	-66.4	-62.6	177.9	-173.2	0	112.8	L101 L102 L103	L101-K105 HydrophobicContact CD1-CG 4.35Å; L101-K105 WeakPolarHBondContact O-CG 3.36Å; L101-K105 PolarHBondContact O-N 3.45Å; L101-K105 VanDerWaalsContact O-N 3.09Å; L102-K105 PolarHBondContact O-N 3.06Å; L103-K105 VanDerWaalsContact C-N 3.25Å; L103-K105 PolarHBondContact O-N 2.96Å
106	V	95	Very high	93.5	Very high	98 Å²	98	108.2 Å²	108.2	59%	0.594	60%	0.601	S	S	*	*	H	α-helix	trans	-69.7	-36.2	178.3	171.7	0	0	0	0	111.4	L102 L103	L102-V106 HydrophobicContact CD1-CG2 4.39Å; L102-V106 VanDerWaalsContact O-CG2 3.31Å; L102-V106 WeakPolarHBondContact O-CG2 3.36Å; L102-V106 PolarHBondContact O-N 3.35Å; L103-V106 PolarHBondContact O-N 3.45Å
107	L	94.5	Very high	92.9	Very high	136 Å²	136	109.8 Å²	109.8	71%	0.712	60%	0.603	S	S	*	*	H	α-helix	trans	-84	-16.6	-179.5	-63	175.5	0	0	0	113.7	L103 V109	L103-L107 WeakPolarHBondContact O-CB 3.41Å; L103-L107 WeakPolarHBondContact O-CG 3.45Å; L103-L107 PolarHBondContact O-N 3.27Å; L107-V109 VanDerWaalsContact C-N 3.31Å; L107-V109 PolarHBondContact O-N 3.38Å
108	D	94.2	Very high	91.9	Very high	73 Å²	73	110 Å²	110	39%	0.39	61%	0.611	S	S	.	*			trans	-79.4	74.4	175.7	-177	27.5	0	0	0	111.2	S104 K110	S104-D108 VanDerWaalsContact O-CB 3.26Å; S104-D108 WeakPolarHBondContact O-CB 3.43Å; S104-D108 PolarHBondContact O-N 3.04Å; D108-K110 PolarHBondContact O-N 3.21Å; D108-K110 VanDerWaalsContact OD1-CE 3.22Å; D108-K110 WeakPolarHBondContact OD1-CE 3.49Å; D108-K110 IonicContact OD1-NZ 3.37Å; D108-K110 PolarHBondContact OD1-NZ 3Å; D108-K110 WeakPolarHBondContact OD2-CE 3.48Å; D108-K110 IonicContact OD2-NZ 2.71Å; D108-K110 PolarHBondContact OD2-NZ 3.38Å
109	V	91.3	Very high	90.3	Very high	116 Å²	116	114.9 Å²	114.9	70%	0.703	62%	0.621	S	S	*	*			trans	-77.3	108.2	177.8	-175.1	0	0	0	0	109.7	L107 P111	L107-V109 VanDerWaalsContact C-N 3.31Å; L107-V109 PolarHBondContact O-N 3.38Å; V109-P111 VanDerWaalsContact O-CD 3.26Å; V109-P111 WeakPolarHBondContact O-CD 3.4Å
110	K	90.8	Very high	88.6	Confident	145 Å²	145	120.1 Å²	120.1	63%	0.63	64%	0.641	S	S	*	*			trans	-108.2	89.8	172.8	-71.2	178.2	175.2	138.1	0	109.7	D108 V112	D108-K110 PolarHBondContact O-N 3.21Å; D108-K110 VanDerWaalsContact OD1-CE 3.22Å; D108-K110 WeakPolarHBondContact OD1-CE 3.49Å; D108-K110 IonicContact OD1-NZ 3.37Å; D108-K110 PolarHBondContact OD1-NZ 3Å; D108-K110 WeakPolarHBondContact OD2-CE 3.48Å; D108-K110 IonicContact OD2-NZ 2.71Å; D108-K110 PolarHBondContact OD2-NZ 3.38Å; K110-V112 PolarHBondContact O-N 3.4Å
111	P	88.6	Confident	86.6	Confident	120 Å²	120	117 Å²	117	78%	0.779	63%	0.634	S	S	*	*			trans	-66.1	120.6	177.7	26.3	-30.3	0	0	0	109	V109	V109-P111 VanDerWaalsContact O-CD 3.26Å; V109-P111 WeakPolarHBondContact O-CD 3.4Å
112	V	89.7	Confident	84.5	Confident	130 Å²	130	118 Å²	118	79%	0.788	65%	0.647	S	S	*	*			trans	-114.9	128.4	176.3	-175.9	0	0	0	0	108	K110 H114	K110-V112 PolarHBondContact O-N 3.4Å; V112-H114 PolarHBondContact O-N 3.34Å
113	V	86.1	Confident	82.6	Confident	101 Å²	101	116.6 Å²	116.6	61%	0.612	66%	0.659	S	S	*	*			trans	-66.6	132.9	173.1	-179.1	0	0	0	0	108.2	V115 F117	V113-V115 PolarHBondContact O-N 3.5Å; V113-F117 HydrophobicContact CG1-CB 3.28Å; V113-F117 HydrophobicContact CG1-CD1 3.74Å; V113-F117 HydrophobicContact CG1-CD2 4.33Å; V113-F117 HydrophobicContact CG1-CG 3.53Å
114	H	89.7	Confident	80.1	Confident	129 Å²	129	119.9 Å²	119.9	60%	0.597	69%	0.69	S	S	*	*			trans	-56.4	139.4	179.4	-171.2	-89.7	0	0	0	110.7	V112 N116 F117	V112-H114 PolarHBondContact O-N 3.34Å; H114-N116 PolarHBondContact ND1-N 3.11Å; H114-N116 PolarHBondContact O-N 3.45Å; H114-F117 WeakPolarHBondContact O-CB 3.38Å; H114-F117 PolarHBondContact O-N 3.14Å
115	V	89.4	Confident	79.3	Confident	132 Å²	132	122.8 Å²	122.8	80%	0.8	70%	0.703	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.5	-22.7	-173.9	-65.9	0	0	0	0	114.6	V113	V113-V115 PolarHBondContact O-N 3.5Å
116	N	88.4	Confident	78.4	Confident	132 Å²	132	121.9 Å²	121.9	71%	0.706	71%	0.708	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.6	7.5	179.4	-62.1	-17	0	0	0	114.2	H114 G118	H114-N116 PolarHBondContact ND1-N 3.11Å; H114-N116 PolarHBondContact O-N 3.45Å; N116-G118 PolarHBondContact O-N 3.36Å
117	F	83.2	Confident	77.5	Confident	140 Å²	140	123.2 Å²	123.2	61%	0.614	71%	0.714	S	S	*	*			trans	-71.9	93.5	179.1	-172.4	-99.4	0	0	0	110.4	V113 H114 F119	V113-F117 HydrophobicContact CG1-CB 3.28Å; V113-F117 HydrophobicContact CG1-CD1 3.74Å; V113-F117 HydrophobicContact CG1-CD2 4.33Å; V113-F117 HydrophobicContact CG1-CG 3.53Å; H114-F117 WeakPolarHBondContact O-CB 3.38Å; H114-F117 PolarHBondContact O-N 3.14Å; F117-F119 PolarHBondContact O-N 2.8Å
118	G	75.1	Confident	76.5	Confident	63 Å²	63	122.5 Å²	122.5	65%	0.649	72%	0.715	S	S	*	*			trans	-79.6	104	173	0	0	0	0	0	110.8	N116 K120	N116-G118 PolarHBondContact O-N 3.36Å; G118-K120 PolarHBondContact O-N 3.32Å
119	F	63.9	Low	75.4	Confident	162 Å²	162	125.6 Å²	125.6	71%	0.711	74%	0.735	S	S	*	*			trans	-68.9	98	166.5	-171.6	-96.2	0	0	0	108.4	F117 S121	F117-F119 PolarHBondContact O-N 2.8Å; F119-S121 PolarHBondContact O-N 3.26Å
120	K	61.5	Low	74.4	Confident	190 Å²	190	126.2 Å²	126.2	83%	0.826	74%	0.737	S	S	*	*			trans	-69.9	100.6	166.1	-72.9	-168.9	177.2	-173.5	0	107.4	G118	G118-K120 PolarHBondContact O-N 3.32Å
121	S	55.1	Low	73.2	Confident	71 Å²	71	124.9 Å²	124.9	50%	0.497	75%	0.745	S	S	.	*			trans	-58.6	137.8	168.8	-175.2	0	0	0	0	109.1	F119 G123	F119-S121 PolarHBondContact O-N 3.26Å; S121-G123 PolarHBondContact O-N 2.99Å
122	P	53.5	Low	72	Confident	128 Å²	128	125.2 Å²	125.2	83%	0.831	74%	0.742	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.2	96.3	171.5	28.2	-30.3	0	0	0	108.3
123	G	56.9	Low	70.5	Confident	80 Å²	80	124.8 Å²	124.8	83%	0.825	74%	0.738	S	S	*	*	T	Hydrogen-bonded Turn	trans	158.4	1.5	178.9	0	0	0	0	0	117.5	S121	S121-G123 PolarHBondContact O-N 2.99Å
124	S	43.5	Very low	69.1	Low	170 Å²	170	127 Å²	127	100%	1.189	75%	0.749	S	S	*	*			trans	-111.3	0	169.2	66.8	0	0	0	0	111.9

Retrieved 124 of 124 residues in 71.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).