G4VDI1_SCHMA Loading...

Essential MCU regulator, mitochondrial

Essential regulatory subunit of the mitochondrial calcium uniporter complex (uniplex), a complex that mediates calcium uptake into mitochondria.

AlphaFold DB , UniProt , Accession G4VDI1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 87 aa.

						>G4VDI1_SCHMA|G4VDI1
MLTKRLIENVLRCQHQKYLPTRGMQCYSGESGSCSSTGALHCRPLTTPLGLVKITCVVISSICTGAWISRNGAEFLEENEIFVPEDD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	71.6	Confident	80.8	Confident	205 Å²	205	126.3 Å²	126.3	100%	1.01	63%	0.628	S	S	*	*				0	-44.2	0	-111.5	-179.7	170.6	0	0	113.2	T3	M1-T3 PolarHBondContact O-N 3.03Å
2	L	80.8	Confident	80.3	Confident	141 Å²	141	129.8 Å²	129.8	74%	0.738	63%	0.628	S	S	*	*	H	α-helix	trans	-62.3	-37.6	-179.5	-70.9	161.3	0	0	0	114.2	K4 R5 L6	L2-K4 PolarHBondContact O-N 3.02Å; L2-R5 PolarHBondContact O-N 3.45Å; L2-L6 PolarHBondContact O-N 2.78Å
3	T	82.2	Confident	79.3	Confident	97 Å²	97	125.5 Å²	125.5	60%	0.595	62%	0.619	S	S	*	*	H	α-helix	trans	-64.4	-40.8	-178.8	50.6	0	0	0	0	113	M1 L6 I7	M1-T3 PolarHBondContact O-N 3.03Å; T3-L6 PolarHBondContact O-N 3.36Å; T3-I7 VanDerWaalsContact O-CG1 3.28Å; T3-I7 WeakPolarHBondContact O-CG1 3.2Å; T3-I7 PolarHBondContact O-N 3.49Å
4	K	79.9	Confident	78.6	Confident	155 Å²	155	123.6 Å²	123.6	67%	0.674	61%	0.607	S	S	*	*	H	α-helix	trans	-62.9	-43.8	175.8	-69.7	-160.9	174	-167.3	0	111.9	L2 L6 I7 E8	L2-K4 PolarHBondContact O-N 3.02Å; K4-L6 VanDerWaalsContact C-N 3.33Å; K4-L6 PolarHBondContact O-N 3.18Å; K4-I7 PolarHBondContact O-N 3.4Å; K4-E8 WeakPolarHBondContact O-CG 3.4Å; K4-E8 PolarHBondContact O-N 3.01Å
5	R	82.2	Confident	77.4	Confident	177 Å²	177	124.4 Å²	124.4	67%	0.668	61%	0.609	S	S	*	*	H	α-helix	trans	-62.2	-38.7	175.9	-76.1	-172.5	177.4	-175.2	-0.1	112.5	L2 N9	L2-R5 PolarHBondContact O-N 3.45Å; R5-N9 WeakPolarHBondContact O-CB 3.32Å; R5-N9 VanDerWaalsContact O-CG 3.3Å; R5-N9 PolarHBondContact O-N 3.2Å; R5-N9 PolarHBondContact O-ND2 3.1Å
6	L	83.2	Confident	76.3	Confident	114 Å²	114	125.5 Å²	125.5	60%	0.597	61%	0.612	S	S	*	*	H	α-helix	trans	-64.7	-46.3	175.4	-80.5	163.6	0	0	0	111.5	L2 T3 K4 E8 N9 V10	L2-L6 PolarHBondContact O-N 2.78Å; T3-L6 PolarHBondContact O-N 3.36Å; K4-L6 VanDerWaalsContact C-N 3.33Å; K4-L6 PolarHBondContact O-N 3.18Å; L6-E8 PolarHBondContact O-N 3.34Å; L6-N9 PolarHBondContact O-N 3.04Å; L6-V10 VanDerWaalsContact O-CG2 3.3Å; L6-V10 WeakPolarHBondContact O-CG2 3.43Å; L6-V10 PolarHBondContact O-N 3.44Å
7	I	83.9	Confident	75.3	Confident	103 Å²	103	127.6 Å²	127.6	53%	0.528	62%	0.618	S	S	.	*	H	α-helix	trans	-62.4	-44.3	178.8	-67.7	163.8	0	0	0	111	T3 K4 N9 V10 L11	T3-I7 VanDerWaalsContact O-CG1 3.28Å; T3-I7 WeakPolarHBondContact O-CG1 3.2Å; T3-I7 PolarHBondContact O-N 3.49Å; K4-I7 PolarHBondContact O-N 3.4Å; I7-N9 PolarHBondContact O-N 2.93Å; I7-V10 PolarHBondContact O-N 3.24Å; I7-L11 HydrophobicContact CG2-CD1 3.75Å; I7-L11 WeakPolarHBondContact O-CB 3.43Å; I7-L11 PolarHBondContact O-N 2.97Å
8	E	84.5	Confident	74.3	Confident	110 Å²	110	131.7 Å²	131.7	51%	0.514	63%	0.627	S	S	.	*	H	α-helix	trans	-61.4	-42.2	175.5	-76.8	176.4	171.3	0	0	112.3	K4 L6 L11 R12	K4-E8 WeakPolarHBondContact O-CG 3.4Å; K4-E8 PolarHBondContact O-N 3.01Å; L6-E8 PolarHBondContact O-N 3.34Å; E8-L11 PolarHBondContact O-N 3.31Å; E8-R12 VanDerWaalsContact O-CB 3.28Å; E8-R12 WeakPolarHBondContact O-CB 3.31Å; E8-R12 PolarHBondContact O-N 2.81Å
9	N	79.7	Confident	73.5	Confident	90 Å²	90	129.9 Å²	129.9	48%	0.481	62%	0.621	S	S	.	*	H	α-helix	trans	-66.8	-37.3	177.3	-76.6	-17.2	0	0	0	112.2	R5 L6 I7 C13	R5-N9 WeakPolarHBondContact O-CB 3.32Å; R5-N9 VanDerWaalsContact O-CG 3.3Å; R5-N9 PolarHBondContact O-N 3.2Å; R5-N9 PolarHBondContact O-ND2 3.1Å; L6-N9 PolarHBondContact O-N 3.04Å; I7-N9 PolarHBondContact O-N 2.93Å; N9-C13 WeakPolarHBondContact O-CB 3.48Å; N9-C13 PolarHBondContact O-N 3.42Å; N9-C13 PolarHBondContact O-SG 3.41Å
10	V	82	Confident	72.6	Confident	85 Å²	85	128.3 Å²	128.3	52%	0.515	62%	0.622	S	S	.	*	H	α-helix	trans	-66.2	-48	174.4	172.1	0	0	0	0	110.5	L6 I7 R12 C13 Q14	L6-V10 VanDerWaalsContact O-CG2 3.3Å; L6-V10 WeakPolarHBondContact O-CG2 3.43Å; L6-V10 PolarHBondContact O-N 3.44Å; I7-V10 PolarHBondContact O-N 3.24Å; V10-R12 VanDerWaalsContact C-N 3.33Å; V10-R12 PolarHBondContact O-N 2.91Å; V10-C13 WeakPolarHBondContact O-CB 3.35Å; V10-C13 PolarHBondContact O-N 3.44Å; V10-Q14 HydrophobicContact CG1-CG 4.36Å; V10-Q14 VanDerWaalsContact O-CG 3.28Å; V10-Q14 WeakPolarHBondContact O-CG 3.45Å; V10-Q14 PolarHBondContact O-N 2.97Å
11	L	79.1	Confident	71.8	Confident	112 Å²	112	128.7 Å²	128.7	59%	0.586	63%	0.632	S	S	*	*	H	α-helix	trans	-59	-42.8	176.2	-84.3	158.1	0	0	0	111.9	I7 E8 Q14 H15	I7-L11 HydrophobicContact CG2-CD1 3.75Å; I7-L11 WeakPolarHBondContact O-CB 3.43Å; I7-L11 PolarHBondContact O-N 2.97Å; E8-L11 PolarHBondContact O-N 3.31Å; L11-Q14 PolarHBondContact O-N 3.42Å; L11-H15 WeakPolarHBondContact O-CB 3.34Å; L11-H15 PolarHBondContact O-N 3.15Å
12	R	74	Confident	71	Confident	168 Å²	168	129.3 Å²	129.3	63%	0.634	62%	0.623	S	S	*	*	H	α-helix	trans	-63	-42.7	176.9	-153.6	-167.2	-56.5	-112	2.7	111.5	E8 V10 H15 Q16	E8-R12 VanDerWaalsContact O-CB 3.28Å; E8-R12 WeakPolarHBondContact O-CB 3.31Å; E8-R12 PolarHBondContact O-N 2.81Å; V10-R12 VanDerWaalsContact C-N 3.33Å; V10-R12 PolarHBondContact O-N 2.91Å; R12-H15 PolarHBondContact O-N 3.05Å; R12-Q16 WeakPolarHBondContact O-CB 3.35Å; R12-Q16 PolarHBondContact O-N 3.39Å
13	C	67.3	Low	69.6	Low	74 Å²	74	124.7 Å²	124.7	50%	0.5	61%	0.61	S	S	.	*	H	α-helix	trans	-63.6	-40.7	174.3	-82.1	0	0	0	0	112.8	N9 V10 Q16 K17	N9-C13 WeakPolarHBondContact O-CB 3.48Å; N9-C13 PolarHBondContact O-N 3.42Å; N9-C13 PolarHBondContact O-SG 3.41Å; V10-C13 WeakPolarHBondContact O-CB 3.35Å; V10-C13 PolarHBondContact O-N 3.44Å; C13-Q16 PolarHBondContact O-N 3.01Å; C13-K17 WeakPolarHBondContact O-CG 3.39Å; C13-K17 PolarHBondContact O-N 2.84Å
14	Q	69.5	Low	68.4	Low	99 Å²	99	127.3 Å²	127.3	46%	0.463	62%	0.617	S	S	.	*	H	α-helix	trans	-66.5	-42.4	177.3	-66.8	-67.1	-13.6	0	0	111.2	V10 L11 Q16 K17 Y18	V10-Q14 HydrophobicContact CG1-CG 4.36Å; V10-Q14 VanDerWaalsContact O-CG 3.28Å; V10-Q14 WeakPolarHBondContact O-CG 3.45Å; V10-Q14 PolarHBondContact O-N 2.97Å; L11-Q14 PolarHBondContact O-N 3.42Å; Q14-Q16 VanDerWaalsContact C-N 3.31Å; Q14-Q16 PolarHBondContact O-N 3.07Å; Q14-K17 PolarHBondContact O-N 2.74Å; Q14-K17 VanDerWaalsContact O-N 3.16Å; Q14-Y18 PolarHBondContact O-N 3.27Å; Q14-Y18 VanDerWaalsContact O-N 3.15Å
15	H	60.9	Low	67.3	Low	136 Å²	136	126.9 Å²	126.9	63%	0.63	62%	0.617	S	S	*	*	H	α-helix	trans	-63.3	-38	177.3	-156.4	-85.8	0	0	0	111.6	L11 R12 K17 Y18 L19	L11-H15 WeakPolarHBondContact O-CB 3.34Å; L11-H15 PolarHBondContact O-N 3.15Å; R12-H15 PolarHBondContact O-N 3.05Å; H15-K17 VanDerWaalsContact C-N 3.33Å; H15-K17 PolarHBondContact O-N 3.28Å; H15-Y18 PolarHBondContact O-N 2.99Å; H15-L19 WeakPolarHBondContact O-CG 3.35Å; H15-L19 PolarHBondContact O-N 3.44Å; H15-L19 VanDerWaalsContact O-N 3.13Å
16	Q	60.1	Low	66.4	Low	142 Å²	142	119.7 Å²	119.7	66%	0.664	59%	0.594	S	S	*	*	H	α-helix	trans	-67.9	-30.6	176	-167.2	171.1	-0.8	0	0	113.1	R12 C13 Q14	R12-Q16 WeakPolarHBondContact O-CB 3.35Å; R12-Q16 PolarHBondContact O-N 3.39Å; C13-Q16 PolarHBondContact O-N 3.01Å; Q14-Q16 VanDerWaalsContact C-N 3.31Å; Q14-Q16 PolarHBondContact O-N 3.07Å
17	K	59.1	Low	65.4	Low	162 Å²	162	123.5 Å²	123.5	70%	0.704	60%	0.602	S	S	*	*	H	α-helix	trans	-73.5	-29	174.7	-72	178.8	-178.8	-175.4	0	113.4	C13 Q14 H15	C13-K17 WeakPolarHBondContact O-CG 3.39Å; C13-K17 PolarHBondContact O-N 2.84Å; Q14-K17 PolarHBondContact O-N 2.74Å; Q14-K17 VanDerWaalsContact O-N 3.16Å; H15-K17 VanDerWaalsContact C-N 3.33Å; H15-K17 PolarHBondContact O-N 3.28Å
18	Y	58.1	Low	64.6	Low	200 Å²	200	122 Å²	122	78%	0.784	60%	0.6	S	S	*	*	H	α-helix	trans	-90.3	-11.8	-179.8	-105.8	-88.4	0	0	0	114.1	Q14 H15 P20	Q14-Y18 PolarHBondContact O-N 3.27Å; Q14-Y18 VanDerWaalsContact O-N 3.15Å; H15-Y18 PolarHBondContact O-N 2.99Å; Y18-P20 VanDerWaalsContact O-CD 3.24Å; Y18-P20 WeakPolarHBondContact O-CD 3.24Å; Y18-P20 VanDerWaalsContact O-N 3.1Å
19	L	59.4	Low	63.8	Low	98 Å²	98	119.1 Å²	119.1	51%	0.513	60%	0.6	S	S	.	*	S	Bend	trans	-62.5	116.1	166.1	-73.9	172.9	0	0	0	106.7	H15 T21	H15-L19 WeakPolarHBondContact O-CG 3.35Å; H15-L19 PolarHBondContact O-N 3.44Å; H15-L19 VanDerWaalsContact O-N 3.13Å; L19-T21 PolarHBondContact O-N 3.49Å
20	P	55.1	Low	63.2	Low	98 Å²	98	117.4 Å²	117.4	64%	0.636	59%	0.589	S	S	*	*			trans	-59.1	113.6	175.8	26.3	-32.2	0	0	0	104.7	Y18 R22	Y18-P20 VanDerWaalsContact O-CD 3.24Å; Y18-P20 WeakPolarHBondContact O-CD 3.24Å; Y18-P20 VanDerWaalsContact O-N 3.1Å; P20-R22 HydrophobicContact CB-CG 4.25Å; P20-R22 PolarHBondContact O-N 2.9Å
21	T	56.3	Low	62.4	Low	137 Å²	137	119.1 Å²	119.1	84%	0.84	61%	0.605	S	S	*	*			trans	-69.5	74.3	163.4	-44.1	0	0	0	0	103.7	L19 G23	L19-T21 PolarHBondContact O-N 3.49Å; T21-G23 PolarHBondContact O-N 2.91Å
22	R	53.3	Low	62.1	Low	218 Å²	218	115.6 Å²	115.6	82%	0.823	60%	0.595	S	S	*	*			trans	-60.3	91.6	161	-77.3	-170.5	163.3	-167	-5.7	102.2	P20 M24	P20-R22 HydrophobicContact CB-CG 4.25Å; P20-R22 PolarHBondContact O-N 2.9Å; R22-M24 PolarHBondContact O-N 3.28Å; R22-M24 VanDerWaalsContact O-N 3.13Å
23	G	52.8	Low	62.3	Low	44 Å²	44	111.4 Å²	111.4	45%	0.454	59%	0.592	S	S	.	*			trans	-44.5	128.2	164.6	0	0	0	0	0	104.8	T21 Q25	T21-G23 PolarHBondContact O-N 2.91Å; G23-Q25 PolarHBondContact O-N 2.98Å
24	M	56.3	Low	62.9	Low	152 Å²	152	110.6 Å²	110.6	75%	0.749	59%	0.586	S	S	*	*			trans	-54.9	96.3	174.8	-83	177.4	168.5	0	0	106.2	R22 C26	R22-M24 PolarHBondContact O-N 3.28Å; R22-M24 VanDerWaalsContact O-N 3.13Å; M24-C26 PolarHBondContact O-N 3.46Å
25	Q	57.6	Low	63.4	Low	146 Å²	146	107.5 Å²	107.5	68%	0.682	58%	0.575	S	S	*	*	B	Isolated β-bridge	trans	-79.5	116.3	171.9	-75.9	180	68	0	0	103.9	G23	G23-Q25 PolarHBondContact O-N 2.98Å
26	C	61.9	Low	64.4	Low	25 Å²	25	106.1 Å²	106.1	17%	0.169	58%	0.581	C	S	.	*			trans	-61.7	156.6	168.2	-63.6	0	0	0	0	108.3	M24 S28 G29 G32 H41	M24-C26 PolarHBondContact O-N 3.46Å; C26-S28 PolarHBondContact O-N 3.06Å; C26-G29 PolarHBondContact O-N 2.82Å; C26-G32 PolarHBondContact SG-O 2.9Å; C26-H41 HydrophobicContact CB-CB 4.34Å; C26-H41 WeakPolarHBondContact CB-CD2 3.24Å; C26-H41 WeakPolarHBondContact CB-NE2 3.28Å; C26-H41 VanDerWaalsContact SG-CB 3.54Å; C26-H41 PolarHBondContact SG-ND1 3.11Å
27	Y	63.4	Low	65.6	Low	195 Å²	195	105 Å²	105	77%	0.765	58%	0.584	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.5	-21.2	178.7	-76.2	-80.5	0	0	0	113.2	G29 L45	Y27-G29 VanDerWaalsContact C-N 3.25Å; Y27-G29 PolarHBondContact O-N 3.33Å; Y27-L45 HydrophobicContact CE2-CD1 4.04Å; Y27-L45 HydrophobicContact CE2-CG 4.01Å; Y27-L45 VanDerWaalsContact OH-CD1 3.29Å; Y27-L45 WeakPolarHBondContact OH-CD1 3.34Å
28	S	66.6	Low	66.9	Low	72 Å²	72	100 Å²	100	50%	0.503	58%	0.578	S	S	.	*	T	Hydrogen-bonded Turn	trans	-68.2	-12.3	174.4	-28.3	0	0	0	0	114.7	C26 E30 H41	C26-S28 PolarHBondContact O-N 3.06Å; S28-E30 PolarHBondContact O-N 3.37Å; S28-H41 PolarHBondContact OG-NE2 3.46Å
29	G	67.5	Low	68.2	Low	48 Å²	48	93 Å²	93	50%	0.495	56%	0.562	S	S	.	*			trans	74.9	-2	-172.5	0	0	0	0	0	114.5	C26 Y27	C26-G29 PolarHBondContact O-N 2.82Å; Y27-G29 VanDerWaalsContact C-N 3.25Å; Y27-G29 PolarHBondContact O-N 3.33Å
30	E	66.1	Low	69.3	Low	54 Å²	54	94.7 Å²	94.7	25%	0.252	57%	0.571	S	S	.	*			trans	-71.1	139.7	177.6	-64.8	-179.2	126.3	0	0	110.9	S28 G32 S35 S36 H41	S28-E30 PolarHBondContact O-N 3.37Å; E30-G32 PolarHBondContact O-N 2.84Å; E30-S35 WeakPolarHBondContact OE2-CA 3.33Å; E30-S35 WeakPolarHBondContact OE2-CB 3.42Å; E30-S35 PolarHBondContact OE2-OG 2.84Å; E30-S36 WeakPolarHBondContact OE1-CB 3.35Å; E30-S36 PolarHBondContact OE1-N 3.02Å; E30-S36 PolarHBondContact OE1-OG 2.9Å; E30-H41 IonicContact OE2-CE1 3.46Å; E30-H41 PolarHBondContact OE2-CE1 3.35Å; E30-H41 IonicContact OE2-NE2 3.6Å
31	S	66.8	Low	70.4	Confident	122 Å²	122	92.3 Å²	92.3	85%	0.853	55%	0.551	S	S	*	*	B	Isolated β-bridge	trans	-79.8	112.4	176.7	-66.8	0	0	0	0	109.9
32	G	72.2	Confident	71.5	Confident	38 Å²	38	91.7 Å²	91.7	39%	0.392	55%	0.551	S	S	.	*	S	Bend	trans	117.5	-173.9	174.1	0	0	0	0	0	114.2	C26 E30	C26-G32 PolarHBondContact SG-O 2.9Å; E30-G32 PolarHBondContact O-N 2.84Å
33	S	77.5	Confident	72.7	Confident	79 Å²	79	92.4 Å²	92.4	55%	0.552	55%	0.554	S	S	*	*	S	Bend	trans	-88.3	-10.9	-177.5	56.2	0	0	0	0	114.2	H41	S33-H41 PolarHBondContact O-N 2.95Å; S33-H41 PolarHBondContact O-ND1 3.47Å
34	C	81.4	Confident	73.9	Confident	57 Å²	57	94.2 Å²	94.2	39%	0.385	56%	0.557	S	S	.	*	B	Isolated β-bridge	trans	-111.6	147	-176.2	-56	0	0	0	0	110.6	A39 H41	C34-A39 CarbonylContact C-O 3.47Å; C34-A39 VanDerWaalsContact CA-O 3.26Å; C34-A39 WeakPolarHBondContact CA-O 3.32Å; C34-H41 PolarHBondContact O-CE1 2.79Å
35	S	79.7	Confident	74.9	Confident	34 Å²	34	93.5 Å²	93.5	24%	0.238	56%	0.556	C	S	.	*			trans	-81	166.8	170.6	-167.5	0	0	0	0	111.2	E30 T37 G38 A39 H41	E30-S35 WeakPolarHBondContact OE2-CA 3.33Å; E30-S35 WeakPolarHBondContact OE2-CB 3.42Å; E30-S35 PolarHBondContact OE2-OG 2.84Å; S35-T37 PolarHBondContact O-N 2.95Å; S35-G38 WeakPolarHBondContact O-CA 3.21Å; S35-G38 PolarHBondContact O-N 3.45Å; S35-A39 PolarHBondContact N-O 2.87Å; S35-H41 PolarHBondContact N-CE1 3.34Å
36	S	80.8	Confident	76.1	Confident	108 Å²	108	92.4 Å²	92.4	76%	0.755	56%	0.559	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51.4	-25.3	172.9	51.4	0	0	0	0	114.6	E30 G38	E30-S36 WeakPolarHBondContact OE1-CB 3.35Å; E30-S36 PolarHBondContact OE1-N 3.02Å; E30-S36 PolarHBondContact OE1-OG 2.9Å; S36-G38 VanDerWaalsContact C-N 3.31Å
37	T	86.6	Confident	77.4	Confident	118 Å²	118	96.4 Å²	96.4	72%	0.724	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81	-5.2	174.1	59.1	0	0	0	0	114.4	S35 A39	S35-T37 PolarHBondContact O-N 2.95Å; T37-A39 VanDerWaalsContact C-N 3.31Å
38	G	84.7	Confident	78.6	Confident	56 Å²	56	91.9 Å²	91.9	58%	0.577	58%	0.577	S	S	*	*	S	Bend	trans	85.1	-5.6	-172.6	0	0	0	0	0	114.6	S35 S36	S35-G38 WeakPolarHBondContact O-CA 3.21Å; S35-G38 PolarHBondContact O-N 3.45Å; S36-G38 VanDerWaalsContact C-N 3.31Å
39	A	85.5	Confident	79.8	Confident	53 Å²	53	94.5 Å²	94.5	44%	0.438	59%	0.585	S	S	.	*	P	Polyproline II helix	trans	-66.4	140.2	176.6	0	0	0	0	0	111.5	C34 S35 T37	C34-A39 CarbonylContact C-O 3.47Å; C34-A39 VanDerWaalsContact CA-O 3.26Å; C34-A39 WeakPolarHBondContact CA-O 3.32Å; S35-A39 PolarHBondContact N-O 2.87Å; T37-A39 VanDerWaalsContact C-N 3.31Å
40	L	83.6	Confident	81	Confident	134 Å²	134	93.2 Å²	93.2	70%	0.702	57%	0.572	S	S	*	*	B	Isolated β-bridge	trans	-72.1	136.6	171.9	-72.7	170.7	0	0	0	110.4
41	H	77.5	Confident	82.3	Confident	49 Å²	49	97.6 Å²	97.6	23%	0.227	60%	0.596	C	S	.	*	P	Polyproline II helix	trans	-66.2	149.4	173.5	-75.8	93.1	0	0	0	111.3	C26 S28 E30 S33 C34 S35	C26-H41 HydrophobicContact CB-CB 4.34Å; C26-H41 WeakPolarHBondContact CB-CD2 3.24Å; C26-H41 WeakPolarHBondContact CB-NE2 3.28Å; C26-H41 VanDerWaalsContact SG-CB 3.54Å; C26-H41 PolarHBondContact SG-ND1 3.11Å; S28-H41 PolarHBondContact OG-NE2 3.46Å; E30-H41 IonicContact OE2-CE1 3.46Å; E30-H41 PolarHBondContact OE2-CE1 3.35Å; E30-H41 IonicContact OE2-NE2 3.6Å; S33-H41 PolarHBondContact O-N 2.95Å; S33-H41 PolarHBondContact O-ND1 3.47Å; C34-H41 PolarHBondContact O-CE1 2.79Å; S35-H41 PolarHBondContact N-CE1 3.34Å
42	C	79.2	Confident	83.7	Confident	123 Å²	123	95.9 Å²	95.9	83%	0.831	58%	0.58	S	S	*	*	P	Polyproline II helix	trans	-57	157.4	170.2	-67.2	0	0	0	0	110.9
43	R	79.4	Confident	84.9	Confident	234 Å²	234	99.9 Å²	99.9	88%	0.883	59%	0.587	S	S	*	*	P	Polyproline II helix	trans	-53.9	139.9	177.1	-65.6	-174.4	-178.6	-154.4	0.7	110.4
44	P	76.8	Confident	85.8	Confident	82 Å²	82	101 Å²	101	53%	0.532	59%	0.585	S	S	.	*	P	Polyproline II helix	trans	-60.2	145.6	176.7	26.5	-34.4	0	0	0	110.1	T46	P44-T46 PolarHBondContact O-N 3.07Å
45	L	78.7	Confident	86.6	Confident	137 Å²	137	101.6 Å²	101.6	72%	0.717	59%	0.588	S	S	*	*	P	Polyproline II helix	trans	-63.9	123.5	173.1	-64.9	-178.1	0	0	0	108.8	Y27	Y27-L45 HydrophobicContact CE2-CD1 4.04Å; Y27-L45 HydrophobicContact CE2-CG 4.01Å; Y27-L45 VanDerWaalsContact OH-CD1 3.29Å; Y27-L45 WeakPolarHBondContact OH-CD1 3.34Å
46	T	83.1	Confident	87.4	Confident	123 Å²	123	103.7 Å²	103.7	76%	0.755	60%	0.602	S	S	*	*	P	Polyproline II helix	trans	-101.9	131.3	174.6	55.5	0	0	0	0	109.2	P44 P48	P44-T46 PolarHBondContact O-N 3.07Å; T46-P48 WeakPolarHBondContact O-CD 3.4Å
47	T	88.5	Confident	88.2	Confident	108 Å²	108	103.1 Å²	103.1	66%	0.663	59%	0.593	S	S	*	*			trans	-83.5	114.9	175	52	0	0	0	0	109.4	L49 G50	T47-L49 PolarHBondContact O-N 3.28Å; T47-G50 PolarHBondContact O-N 3.4Å
48	P	88.6	Confident	88.8	Confident	100 Å²	100	100.6 Å²	100.6	65%	0.649	58%	0.578	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.8	134.7	176.7	26	-33.6	0	0	0	109.7	T46 G50 K53	T46-P48 WeakPolarHBondContact O-CD 3.4Å; P48-G50 PolarHBondContact O-N 3.11Å; P48-K53 PolarHBondContact O-NZ 2.91Å
49	L	92.9	Very high	89.5	Confident	127 Å²	127	102.6 Å²	102.6	67%	0.665	57%	0.574	S	S	*	*	T	Hydrogen-bonded Turn	trans	57.5	25.6	-178.4	-54.9	173.7	0	0	0	114.3	T47 L51 V52 K53	T47-L49 PolarHBondContact O-N 3.28Å; L49-L51 VanDerWaalsContact C-N 3.31Å; L49-L51 PolarHBondContact O-N 3.46Å; L49-V52 HydrophobicContact CB-CB 4.41Å; L49-V52 HydrophobicContact CD2-CG2 4.5Å; L49-V52 PolarHBondContact O-N 3.47Å; L49-V52 VanDerWaalsContact O-N 3.11Å; L49-K53 WeakPolarHBondContact O-CG 3.29Å; L49-K53 PolarHBondContact O-N 3.48Å
50	G	92.1	Very high	90	Very high	21 Å²	21	103.1 Å²	103.1	22%	0.216	57%	0.574	C	S	.	*	H	α-helix	trans	-55.1	-42.1	-177.8	0	0	0	0	0	113.9	T47 P48 K53 I54	T47-G50 PolarHBondContact O-N 3.4Å; P48-G50 PolarHBondContact O-N 3.11Å; G50-K53 PolarHBondContact O-N 2.95Å; G50-I54 WeakPolarHBondContact O-CG2 3.3Å; G50-I54 PolarHBondContact O-N 3.28Å
51	L	93.1	Very high	90.7	Very high	147 Å²	147	99.9 Å²	99.9	77%	0.77	56%	0.563	S	S	*	*	H	α-helix	trans	-64.7	-39.8	177	-72	176.3	0	0	0	112.9	L49 I54 T55	L49-L51 VanDerWaalsContact C-N 3.31Å; L49-L51 PolarHBondContact O-N 3.46Å; L51-I54 VanDerWaalsContact O-CG2 3.3Å; L51-I54 WeakPolarHBondContact O-CG2 3.42Å; L51-T55 VanDerWaalsContact O-CB 3.28Å; L51-T55 WeakPolarHBondContact O-CB 3.36Å; L51-T55 PolarHBondContact O-N 3.28Å; L51-T55 VanDerWaalsContact O-N 3.08Å; L51-T55 PolarHBondContact O-OG1 3.08Å
52	V	96.5	Very high	91.7	Very high	85 Å²	85	102.9 Å²	102.9	52%	0.515	58%	0.58	S	S	.	*	H	α-helix	trans	-68.2	-46.1	177.3	-179	0	0	0	0	109.3	L49 I54 T55 C56	L49-V52 HydrophobicContact CB-CB 4.41Å; L49-V52 HydrophobicContact CD2-CG2 4.5Å; L49-V52 PolarHBondContact O-N 3.47Å; L49-V52 VanDerWaalsContact O-N 3.11Å; V52-I54 PolarHBondContact O-N 2.91Å; V52-T55 PolarHBondContact O-N 3.39Å; V52-C56 PolarHBondContact O-N 3.28Å; V52-C56 PolarHBondContact O-SG 3.48Å
53	K	95.9	Very high	92.6	Very high	123 Å²	123	100.7 Å²	100.7	54%	0.535	57%	0.565	S	S	.	*	H	α-helix	trans	-56	-51.9	177.6	-73	175.9	178.2	175.4	0	112.1	P48 L49 G50 T55 C56 V57	P48-K53 PolarHBondContact O-NZ 2.91Å; L49-K53 WeakPolarHBondContact O-CG 3.29Å; L49-K53 PolarHBondContact O-N 3.48Å; G50-K53 PolarHBondContact O-N 2.95Å; K53-T55 VanDerWaalsContact C-N 3.34Å; K53-T55 PolarHBondContact O-N 3.2Å; K53-C56 PolarHBondContact O-N 3.38Å; K53-V57 WeakPolarHBondContact O-CG2 3.48Å; K53-V57 PolarHBondContact O-N 3.2Å; K53-V57 VanDerWaalsContact O-N 3.07Å
54	I	97.2	Very high	93.5	Very high	101 Å²	101	93.1 Å²	93.1	52%	0.518	55%	0.545	S	S	.	.	H	α-helix	trans	-64.6	-40.7	-179.1	-165.9	167.8	0	0	0	111.2	G50 L51 V52 C56 V57 V58	G50-I54 WeakPolarHBondContact O-CG2 3.3Å; G50-I54 PolarHBondContact O-N 3.28Å; L51-I54 VanDerWaalsContact O-CG2 3.3Å; L51-I54 WeakPolarHBondContact O-CG2 3.42Å; V52-I54 PolarHBondContact O-N 2.91Å; I54-C56 PolarHBondContact O-N 2.69Å; I54-V57 PolarHBondContact O-N 3.37Å; I54-V58 HydrophobicContact CG1-CG2 4Å; I54-V58 VanDerWaalsContact O-CB 3.32Å; I54-V58 WeakPolarHBondContact O-CB 3.4Å; I54-V58 WeakPolarHBondContact O-CG2 3.28Å; I54-V58 PolarHBondContact O-N 3.37Å
55	T	97.7	Very high	94.5	Very high	70 Å²	70	90.7 Å²	90.7	43%	0.429	54%	0.535	S	S	.	.	H	α-helix	trans	-61.3	-46.4	177.7	-59.2	0	0	0	0	111.3	L51 V52 K53 V57 V58 I59	L51-T55 VanDerWaalsContact O-CB 3.28Å; L51-T55 WeakPolarHBondContact O-CB 3.36Å; L51-T55 PolarHBondContact O-N 3.28Å; L51-T55 VanDerWaalsContact O-N 3.08Å; L51-T55 PolarHBondContact O-OG1 3.08Å; V52-T55 PolarHBondContact O-N 3.39Å; K53-T55 VanDerWaalsContact C-N 3.34Å; K53-T55 PolarHBondContact O-N 3.2Å; T55-V57 PolarHBondContact O-N 3.11Å; T55-V58 PolarHBondContact O-N 2.86Å; T55-I59 HydrophobicContact CG2-CD1 3.49Å; T55-I59 VanDerWaalsContact CG2-CD1 3.49Å; T55-I59 HydrophobicContact CG2-CG1 4.23Å; T55-I59 WeakPolarHBondContact O-CB 3.49Å; T55-I59 VanDerWaalsContact O-CG1 3.24Å; T55-I59 WeakPolarHBondContact O-CG1 3.24Å; T55-I59 PolarHBondContact O-N 2.73Å
56	C	97.8	Very high	95.4	Very high	79 Å²	79	87 Å²	87	53%	0.534	52%	0.524	S	S	.	.	H	α-helix	trans	-60.7	-45	177.5	-70.2	0	0	0	0	112.4	V52 K53 I54 S60	V52-C56 PolarHBondContact O-N 3.28Å; V52-C56 PolarHBondContact O-SG 3.48Å; K53-C56 PolarHBondContact O-N 3.38Å; I54-C56 PolarHBondContact O-N 2.69Å; C56-S60 WeakPolarHBondContact O-CB 3.28Å; C56-S60 PolarHBondContact O-N 2.69Å; C56-S60 PolarHBondContact O-OG 3.34Å; C56-S60 VanDerWaalsContact O-OG 3.11Å
57	V	97.8	Very high	96.1	Very high	96 Å²	96	89.3 Å²	89.3	58%	0.582	52%	0.519	S	S	*	.	H	α-helix	trans	-66.9	-43.6	179.7	172.2	0	0	0	0	111.6	K53 I54 T55 S60 S61	K53-V57 WeakPolarHBondContact O-CG2 3.48Å; K53-V57 PolarHBondContact O-N 3.2Å; K53-V57 VanDerWaalsContact O-N 3.07Å; I54-V57 PolarHBondContact O-N 3.37Å; T55-V57 PolarHBondContact O-N 3.11Å; V57-S60 PolarHBondContact O-OG 3.28Å; V57-S60 VanDerWaalsContact O-OG 3.11Å; V57-S61 WeakPolarHBondContact O-CB 3.32Å; V57-S61 PolarHBondContact O-N 3.15Å; V57-S61 PolarHBondContact O-OG 3.41Å
58	V	98.5	Very high	96.6	Very high	65 Å²	65	89.2 Å²	89.2	39%	0.394	51%	0.513	S	S	.	.	H	α-helix	trans	-67.7	-46.5	-179.5	170.8	0	0	0	0	110.6	I54 T55 S61 I62	I54-V58 HydrophobicContact CG1-CG2 4Å; I54-V58 VanDerWaalsContact O-CB 3.32Å; I54-V58 WeakPolarHBondContact O-CB 3.4Å; I54-V58 WeakPolarHBondContact O-CG2 3.28Å; I54-V58 PolarHBondContact O-N 3.37Å; T55-V58 PolarHBondContact O-N 2.86Å; V58-S61 PolarHBondContact O-N 3.47Å; V58-S61 PolarHBondContact O-OG 2.9Å; V58-I62 HydrophobicContact CG1-CD1 3.59Å; V58-I62 HydrophobicContact CG1-CG1 4.36Å; V58-I62 WeakPolarHBondContact O-CB 3.42Å; V58-I62 VanDerWaalsContact O-CG1 3.24Å; V58-I62 WeakPolarHBondContact O-CG1 3.46Å; V58-I62 PolarHBondContact O-N 2.67Å
59	I	98.3	Very high	97	Very high	97 Å²	97	88.4 Å²	88.4	50%	0.497	51%	0.51	S	S	.	.	H	α-helix	trans	-64.3	-45.9	179.7	-67.9	175	0	0	0	110.7	T55 S61 I62 C63	T55-I59 HydrophobicContact CG2-CD1 3.49Å; T55-I59 VanDerWaalsContact CG2-CD1 3.49Å; T55-I59 HydrophobicContact CG2-CG1 4.23Å; T55-I59 WeakPolarHBondContact O-CB 3.49Å; T55-I59 VanDerWaalsContact O-CG1 3.24Å; T55-I59 WeakPolarHBondContact O-CG1 3.24Å; T55-I59 PolarHBondContact O-N 2.73Å; I59-S61 PolarHBondContact O-N 3.16Å; I59-I62 PolarHBondContact O-N 2.9Å; I59-C63 WeakPolarHBondContact O-CB 3.5Å; I59-C63 PolarHBondContact O-N 3.42Å; I59-C63 PolarHBondContact O-SG 3.13Å
60	S	97.5	Very high	97.1	Very high	64 Å²	64	91.1 Å²	91.1	45%	0.448	51%	0.512	S	S	.	.	H	α-helix	trans	-61.5	-46.1	179.7	67.7	0	0	0	0	111.5	C56 V57 C63 T64	C56-S60 WeakPolarHBondContact O-CB 3.28Å; C56-S60 PolarHBondContact O-N 2.69Å; C56-S60 PolarHBondContact O-OG 3.34Å; C56-S60 VanDerWaalsContact O-OG 3.11Å; V57-S60 PolarHBondContact O-OG 3.28Å; V57-S60 VanDerWaalsContact O-OG 3.11Å; S60-C63 PolarHBondContact O-N 2.84Å; S60-T64 WeakPolarHBondContact O-CB 3.28Å; S60-T64 PolarHBondContact O-N 3.13Å; S60-T64 PolarHBondContact O-OG1 3.41Å
61	S	98	Very high	97.3	Very high	67 Å²	67	93.2 Å²	93.2	47%	0.469	52%	0.518	S	S	.	.	H	α-helix	trans	-64.1	-41.8	178.8	56.3	0	0	0	0	112.9	V57 V58 I59 G65	V57-S61 WeakPolarHBondContact O-CB 3.32Å; V57-S61 PolarHBondContact O-N 3.15Å; V57-S61 PolarHBondContact O-OG 3.41Å; V58-S61 PolarHBondContact O-N 3.47Å; V58-S61 PolarHBondContact O-OG 2.9Å; I59-S61 PolarHBondContact O-N 3.16Å; S61-G65 PolarHBondContact O-N 2.89Å
62	I	98.4	Very high	97.3	Very high	111 Å²	111	87.7 Å²	87.7	57%	0.569	50%	0.496	S	S	*	.	H	α-helix	trans	-63.7	-45.7	175.2	-68.8	171.4	0	0	0	110.6	V58 I59 G65 A66	V58-I62 HydrophobicContact CG1-CD1 3.59Å; V58-I62 HydrophobicContact CG1-CG1 4.36Å; V58-I62 WeakPolarHBondContact O-CB 3.42Å; V58-I62 VanDerWaalsContact O-CG1 3.24Å; V58-I62 WeakPolarHBondContact O-CG1 3.46Å; V58-I62 PolarHBondContact O-N 2.67Å; I59-I62 PolarHBondContact O-N 2.9Å; I62-G65 PolarHBondContact O-N 3.21Å; I62-A66 WeakPolarHBondContact O-CB 3.2Å; I62-A66 PolarHBondContact O-N 3.41Å
63	C	98.3	Very high	97.1	Very high	77 Å²	77	86.3 Å²	86.3	52%	0.52	49%	0.494	S	S	.	.	H	α-helix	trans	-64.6	-43.4	178.4	-71.5	0	0	0	0	112.2	I59 S60 A66 W67	I59-C63 WeakPolarHBondContact O-CB 3.5Å; I59-C63 PolarHBondContact O-N 3.42Å; I59-C63 PolarHBondContact O-SG 3.13Å; S60-C63 PolarHBondContact O-N 2.84Å; C63-A66 PolarHBondContact O-N 3.18Å; C63-W67 WeakPolarHBondContact O-CB 3.45Å; C63-W67 PolarHBondContact O-N 3.44Å
64	T	98.2	Very high	96.9	Very high	76 Å²	76	84.8 Å²	84.8	47%	0.466	49%	0.489	S	S	.	.	H	α-helix	trans	-62.4	-43.8	174.7	-62.3	0	0	0	0	110.9	S60 W67 I68	S60-T64 WeakPolarHBondContact O-CB 3.28Å; S60-T64 PolarHBondContact O-N 3.13Å; S60-T64 PolarHBondContact O-OG1 3.41Å; T64-W67 PolarHBondContact O-N 3.24Å; T64-I68 HydrophobicContact CG2-CD1 3.88Å; T64-I68 HydrophobicContact CG2-CG1 4.48Å; T64-I68 VanDerWaalsContact O-CG1 3.31Å; T64-I68 WeakPolarHBondContact O-CG1 3.4Å; T64-I68 PolarHBondContact O-N 3.01Å
65	G	98	Very high	96.7	Very high	31 Å²	31	85.6 Å²	85.6	32%	0.32	49%	0.489	S	S	.	.	H	α-helix	trans	-59.5	-47.5	174.5	0	0	0	0	0	112	S61 I62 W67 I68 S69	S61-G65 PolarHBondContact O-N 2.89Å; I62-G65 PolarHBondContact O-N 3.21Å; G65-W67 VanDerWaalsContact C-N 3.31Å; G65-W67 PolarHBondContact O-N 3.33Å; G65-I68 PolarHBondContact O-N 2.99Å; G65-S69 WeakPolarHBondContact O-CB 3.43Å; G65-S69 PolarHBondContact O-N 3.46Å; G65-S69 PolarHBondContact O-OG 2.9Å
66	A	97.9	Very high	96.4	Very high	60 Å²	60	84.9 Å²	84.9	50%	0.496	48%	0.482	S	S	.	.	H	α-helix	trans	-60.7	-39.3	176.3	0	0	0	0	0	112.5	I62 C63 S69 R70	I62-A66 WeakPolarHBondContact O-CB 3.2Å; I62-A66 PolarHBondContact O-N 3.41Å; C63-A66 PolarHBondContact O-N 3.18Å; A66-S69 PolarHBondContact O-N 3.28Å; A66-R70 WeakPolarHBondContact O-CB 3.44Å; A66-R70 PolarHBondContact O-N 2.88Å
67	W	97.8	Very high	95.9	Very high	171 Å²	171	87.6 Å²	87.6	65%	0.648	49%	0.487	S	S	*	.	H	α-helix	trans	-65.8	-47.4	175.9	-174.9	64.5	0	0	0	111.5	C63 T64 G65 S69 R70 N71	C63-W67 WeakPolarHBondContact O-CB 3.45Å; C63-W67 PolarHBondContact O-N 3.44Å; T64-W67 PolarHBondContact O-N 3.24Å; G65-W67 VanDerWaalsContact C-N 3.31Å; G65-W67 PolarHBondContact O-N 3.33Å; W67-S69 VanDerWaalsContact C-N 3.33Å; W67-S69 PolarHBondContact O-N 2.99Å; W67-R70 PolarHBondContact O-N 3.45Å; W67-N71 VanDerWaalsContact CD1-ND2 3.33Å; W67-N71 VanDerWaalsContact CE2-ND2 3.34Å; W67-N71 PolarHBondContact NE1-ND2 3.47Å; W67-N71 VanDerWaalsContact NE1-ND2 3.15Å; W67-N71 PolarHBondContact O-N 2.86Å; W67-N71 PolarHBondContact O-ND2 3.3Å
68	I	97.7	Very high	95.5	Very high	105 Å²	105	89.8 Å²	89.8	54%	0.538	49%	0.491	S	S	.	.	H	α-helix	trans	-59.5	-45.2	175.4	-67	166.3	0	0	0	110.5	T64 G65 R70 N71 G72	T64-I68 HydrophobicContact CG2-CD1 3.88Å; T64-I68 HydrophobicContact CG2-CG1 4.48Å; T64-I68 VanDerWaalsContact O-CG1 3.31Å; T64-I68 WeakPolarHBondContact O-CG1 3.4Å; T64-I68 PolarHBondContact O-N 3.01Å; G65-I68 PolarHBondContact O-N 2.99Å; I68-R70 VanDerWaalsContact C-N 3.33Å; I68-R70 PolarHBondContact O-N 3.44Å; I68-N71 PolarHBondContact O-N 2.89Å; I68-G72 PolarHBondContact O-N 3.49Å
69	S	96.9	Very high	95	Very high	84 Å²	84	90.7 Å²	90.7	59%	0.587	49%	0.493	S	S	*	.	H	α-helix	trans	-60.1	-41.8	178.5	-63.9	0	0	0	0	112.4	G65 A66 W67 A73	G65-S69 WeakPolarHBondContact O-CB 3.43Å; G65-S69 PolarHBondContact O-N 3.46Å; G65-S69 PolarHBondContact O-OG 2.9Å; A66-S69 PolarHBondContact O-N 3.28Å; W67-S69 VanDerWaalsContact C-N 3.33Å; W67-S69 PolarHBondContact O-N 2.99Å; S69-A73 WeakPolarHBondContact O-CB 3.3Å; S69-A73 PolarHBondContact O-N 3.48Å
70	R	95.5	Very high	94.2	Very high	183 Å²	183	94.1 Å²	94.1	69%	0.691	51%	0.507	S	S	*	.	H	α-helix	trans	-64.2	-52.1	177.4	179.2	-179.6	173.6	168.6	1.1	111.9	A66 W67 I68 G72 A73 E74	A66-R70 WeakPolarHBondContact O-CB 3.44Å; A66-R70 PolarHBondContact O-N 2.88Å; W67-R70 PolarHBondContact O-N 3.45Å; I68-R70 VanDerWaalsContact C-N 3.33Å; I68-R70 PolarHBondContact O-N 3.44Å; R70-G72 VanDerWaalsContact C-N 3.27Å; R70-G72 PolarHBondContact O-N 2.93Å; R70-A73 PolarHBondContact O-N 3.27Å; R70-E74 PolarHBondContact O-N 3.33Å
71	N	95.8	Very high	93.5	Very high	66 Å²	66	95.7 Å²	95.7	35%	0.353	51%	0.51	S	S	.	.	H	α-helix	trans	-66.2	-33.5	-179.7	-68	-89.6	0	0	0	111.5	W67 I68 F75	W67-N71 VanDerWaalsContact CD1-ND2 3.33Å; W67-N71 VanDerWaalsContact CE2-ND2 3.34Å; W67-N71 PolarHBondContact NE1-ND2 3.47Å; W67-N71 VanDerWaalsContact NE1-ND2 3.15Å; W67-N71 PolarHBondContact O-N 2.86Å; W67-N71 PolarHBondContact O-ND2 3.3Å; I68-N71 PolarHBondContact O-N 2.89Å; N71-F75 VanDerWaalsContact O-CB 3.32Å; N71-F75 WeakPolarHBondContact O-CB 3.41Å; N71-F75 PolarHBondContact O-N 3.2Å
72	G	94.1	Very high	92.4	Very high	30 Å²	30	98.8 Å²	98.8	31%	0.309	52%	0.515	S	S	.	.	H	α-helix	trans	-65.4	-43.6	175.1	0	0	0	0	0	112.2	I68 R70 F75 L76	I68-G72 PolarHBondContact O-N 3.49Å; R70-G72 VanDerWaalsContact C-N 3.27Å; R70-G72 PolarHBondContact O-N 2.93Å; G72-F75 PolarHBondContact O-N 2.81Å; G72-L76 WeakPolarHBondContact O-CG 3.45Å; G72-L76 PolarHBondContact O-N 3.05Å
73	A	92.2	Very high	91	Very high	57 Å²	57	99 Å²	99	47%	0.471	52%	0.521	S	S	.	.	H	α-helix	trans	-62.4	-45	175	0	0	0	0	0	111.9	S69 R70 L76 E77	S69-A73 WeakPolarHBondContact O-CB 3.3Å; S69-A73 PolarHBondContact O-N 3.48Å; R70-A73 PolarHBondContact O-N 3.27Å; A73-L76 PolarHBondContact O-N 3.46Å; A73-E77 PolarHBondContact O-N 2.93Å
74	E	91.5	Very high	89.7	Confident	91 Å²	91	99.7 Å²	99.7	43%	0.425	53%	0.525	S	S	.	.	H	α-helix	trans	-61.1	-44.7	176.3	-173.2	168.9	-163.2	0	0	111.6	R70 L76 E77 E78	R70-E74 PolarHBondContact O-N 3.33Å; E74-L76 VanDerWaalsContact C-N 3.3Å; E74-L76 PolarHBondContact O-N 3.47Å; E74-E77 PolarHBondContact O-N 3.27Å; E74-E78 WeakPolarHBondContact O-CG 3.46Å; E74-E78 PolarHBondContact O-N 3.03Å
75	F	92.7	Very high	88.8	Confident	117 Å²	117	104.8 Å²	104.8	51%	0.513	54%	0.543	S	S	.	.	H	α-helix	trans	-61.6	-35.8	175.3	178.2	-99.3	0	0	0	113	N71 G72 N79	N71-F75 VanDerWaalsContact O-CB 3.32Å; N71-F75 WeakPolarHBondContact O-CB 3.41Å; N71-F75 PolarHBondContact O-N 3.2Å; G72-F75 PolarHBondContact O-N 2.81Å; F75-N79 WeakPolarHBondContact CE2-ND2 3.26Å; F75-N79 PolarHBondContact O-N 3.29Å; F75-N79 PolarHBondContact O-ND2 3.43Å
76	L	90.8	Very high	87.5	Confident	56 Å²	56	111 Å²	111	29%	0.293	57%	0.569	S	S	.	*	H	α-helix	trans	-72.4	-35.3	178	-71.1	171.9	0	0	0	112.4	G72 A73 E74 E80 I81 F82	G72-L76 WeakPolarHBondContact O-CG 3.45Å; G72-L76 PolarHBondContact O-N 3.05Å; A73-L76 PolarHBondContact O-N 3.46Å; E74-L76 VanDerWaalsContact C-N 3.3Å; E74-L76 PolarHBondContact O-N 3.47Å; L76-E80 PolarHBondContact O-N 3.3Å; L76-I81 HydrophobicContact CD2-CB 4.11Å; L76-I81 HydrophobicContact CD2-CD1 4.06Å; L76-I81 HydrophobicContact CD2-CG2 4.11Å; L76-I81 PolarHBondContact O-N 3.43Å; L76-F82 HydrophobicContact CB-CB 4.29Å; L76-F82 HydrophobicContact CB-CD2 3.9Å; L76-F82 HydrophobicContact CD1-CD2 3.63Å; L76-F82 HydrophobicContact CD1-CE2 3.96Å; L76-F82 HydrophobicContact CD2-CD2 3.81Å; L76-F82 HydrophobicContact CD2-CE2 4.02Å; L76-F82 HydrophobicContact CG-CD2 3.95Å; L76-F82 HydrophobicContact CG-CE2 4.46Å; L76-F82 PolarHBondContact O-N 3.49Å
77	E	87.7	Confident	85.4	Confident	136 Å²	136	119 Å²	119	64%	0.636	60%	0.604	S	S	*	*	H	α-helix	trans	-66.8	-45.9	173.8	-173.2	178.7	170.9	0	0	110.9	A73 E74 N79 E80	A73-E77 PolarHBondContact O-N 2.93Å; E74-E77 PolarHBondContact O-N 3.27Å; E77-N79 PolarHBondContact O-N 2.98Å; E77-E80 PolarHBondContact O-N 3.04Å; E77-E80 VanDerWaalsContact O-N 3.1Å
78	E	88.8	Confident	84.7	Confident	142 Å²	142	116.4 Å²	116.4	66%	0.664	60%	0.601	S	S	*	*	H	α-helix	trans	-60	-27.2	177.7	-74.8	178.3	174.5	0	0	113.9	E74	E74-E78 WeakPolarHBondContact O-CG 3.46Å; E74-E78 PolarHBondContact O-N 3.03Å
79	N	88.8	Confident	84.1	Confident	83 Å²	83	117 Å²	117	44%	0.444	61%	0.605	S	S	.	*	T	Hydrogen-bonded Turn	trans	-99.9	9.4	180	-71.4	-87.8	0	0	0	113.4	F75 E77 I81	F75-N79 WeakPolarHBondContact CE2-ND2 3.26Å; F75-N79 PolarHBondContact O-N 3.29Å; F75-N79 PolarHBondContact O-ND2 3.43Å; E77-N79 PolarHBondContact O-N 2.98Å; N79-I81 HydrophobicContact CB-CD1 3.62Å; N79-I81 HydrophobicContact CB-CG1 3.71Å; N79-I81 PolarHBondContact O-N 3.34Å
80	E	80.8	Confident	83.4	Confident	170 Å²	170	118.8 Å²	118.8	79%	0.794	61%	0.606	S	S	*	*	T	Hydrogen-bonded Turn	trans	53	21.6	-174.5	-59.3	-175.3	167.8	0	0	113.9	L76 E77	L76-E80 PolarHBondContact O-N 3.3Å; E77-E80 PolarHBondContact O-N 3.04Å; E77-E80 VanDerWaalsContact O-N 3.1Å
81	I	84.3	Confident	82.6	Confident	97 Å²	97	115.1 Å²	115.1	50%	0.497	60%	0.601	S	S	.	*	S	Bend	trans	-76.9	-33	-178.2	-57.9	169	0	0	0	109.5	L76 N79	L76-I81 HydrophobicContact CD2-CB 4.11Å; L76-I81 HydrophobicContact CD2-CD1 4.06Å; L76-I81 HydrophobicContact CD2-CG2 4.11Å; L76-I81 PolarHBondContact O-N 3.43Å; N79-I81 HydrophobicContact CB-CD1 3.62Å; N79-I81 HydrophobicContact CB-CG1 3.71Å; N79-I81 PolarHBondContact O-N 3.34Å
82	F	74.2	Confident	81.8	Confident	132 Å²	132	118.1 Å²	118.1	58%	0.579	62%	0.616	S	S	*	*			trans	-136.8	122	174.9	-70.7	-84.6	0	0	0	109.6	L76	L76-F82 HydrophobicContact CB-CB 4.29Å; L76-F82 HydrophobicContact CB-CD2 3.9Å; L76-F82 HydrophobicContact CD1-CD2 3.63Å; L76-F82 HydrophobicContact CD1-CE2 3.96Å; L76-F82 HydrophobicContact CD2-CD2 3.81Å; L76-F82 HydrophobicContact CD2-CE2 4.02Å; L76-F82 HydrophobicContact CG-CD2 3.95Å; L76-F82 HydrophobicContact CG-CE2 4.46Å; L76-F82 PolarHBondContact O-N 3.49Å
83	V	68.3	Low	81	Confident	114 Å²	114	124 Å²	124	69%	0.691	64%	0.636	S	S	*	*			trans	-114.1	120.3	167.3	-179	0	0	0	0	105.7	E85	V83-E85 PolarHBondContact O-N 3.44Å
84	P	71.5	Confident	80.2	Confident	93 Å²	93	128.8 Å²	128.8	60%	0.604	65%	0.648	S	S	*	*			trans	-65.2	135.2	173.3	27.1	-31.1	0	0	0	109.2	D86	P84-D86 PolarHBondContact O-N 2.87Å
85	E	78.8	Confident	79.3	Confident	182 Å²	182	131.7 Å²	131.7	85%	0.85	67%	0.665	S	S	*	*			trans	-73.9	119.1	167.1	-65.6	178.9	173.2	0	0	107.5	V83 D87	V83-E85 PolarHBondContact O-N 3.44Å; E85-D87 PolarHBondContact O-N 2.76Å
86	D	71.5	Confident	78.2	Confident	162 Å²	162	132.9 Å²	132.9	87%	0.866	68%	0.678	S	S	*	*			trans	-75.4	62.5	180	-78.7	-38.2	0	0	0	112.1	P84	P84-D86 PolarHBondContact O-N 2.87Å
87	D	53.3	Low	77.1	Confident	228 Å²	228	139.9 Å²	139.9	100%	1.219	71%	0.713	S	S	*	*			trans	-121.7	0	168.8	-82.9	-30.8	0	0	0	112.9	E85	E85-D87 PolarHBondContact O-N 2.76Å

Retrieved 87 of 87 residues in 183.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).