G4VFY4_SCHMA Loading...

Putative histone H3

AlphaFold DB , UniProt , Accession G4VFY4, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 87 aa.

						>G4VFY4_SCHMA|G4VFY4
MAHTKQTARKSTGGKTTRKQLATKAARKSVPATSGVKKPHRYRPGTGFTLLIADETNEKSASLNRCFQEDYVKAGNLKLAELRLDNL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.8	Low	75.9	Confident	252 Å²	252	166 Å²	166	100%	1.241	88%	0.875	S	S	*	*				0	115.1	0	-171.1	154.2	165.5	0	0	107.5
2	A	69.6	Low	75.3	Confident	102 Å²	102	163.8 Å²	163.8	84%	0.843	87%	0.873	S	S	*	*	P	Polyproline II helix	trans	-100.8	129.2	-169.5	0	0	0	0	0	111.1
3	H	78.3	Confident	74.7	Confident	193 Å²	193	156.2 Å²	156.2	89%	0.894	86%	0.858	S	S	*	*	P	Polyproline II helix	trans	-86.3	126.8	-179.1	-132.8	-52.5	0	0	0	110.3
4	T	79.2	Confident	74.4	Confident	128 Å²	128	150.2 Å²	150.2	79%	0.785	85%	0.85	S	S	*	*	P	Polyproline II helix	trans	-94.5	139.3	173	54.7	0	0	0	0	110.3
5	K	81.2	Confident	73.9	Confident	193 Å²	193	154.1 Å²	154.1	84%	0.839	85%	0.854	S	S	*	*	P	Polyproline II helix	trans	-90.1	121.2	175.7	-173.7	-178.4	-178.8	-171.3	0	109.6	T7	K5-T7 PolarHBondContact O-N 3.45Å
6	Q	84.8	Confident	73.5	Confident	190 Å²	190	152.6 Å²	152.6	89%	0.888	85%	0.851	S	S	*	*	P	Polyproline II helix	trans	-69.1	122.3	172	-174.2	131.5	17.3	0	0	110.2
7	T	77.3	Confident	73.4	Confident	102 Å²	102	151.9 Å²	151.9	63%	0.626	85%	0.851	S	S	*	*	P	Polyproline II helix	trans	-102.1	142.4	172.3	54.8	0	0	0	0	110.2	K5 R9	K5-T7 PolarHBondContact O-N 3.45Å; T7-R9 PolarHBondContact O-N 3.33Å
8	A	77.4	Confident	73.2	Confident	108 Å²	108	156 Å²	156	89%	0.893	85%	0.851	S	S	*	*	P	Polyproline II helix	trans	-66.4	125.2	177.2	0	0	0	0	0	110.2
9	R	77.4	Confident	73.1	Confident	234 Å²	234	157.6 Å²	157.6	88%	0.883	85%	0.849	S	S	*	*	P	Polyproline II helix	trans	-102.2	132.1	175.5	-60.1	178.7	79.6	-172.8	5.1	108.9	T7	T7-R9 PolarHBondContact O-N 3.33Å
10	K	75	Confident	72.9	Confident	201 Å²	201	159.6 Å²	159.6	87%	0.874	85%	0.853	S	S	*	*	P	Polyproline II helix	trans	-71.9	130.1	174.2	-58.5	-179.6	-176	-178.9	0	109	T12	K10-T12 PolarHBondContact O-N 3.49Å
11	S	74.3	Confident	72.9	Confident	123 Å²	123	159.4 Å²	159.4	86%	0.86	85%	0.851	S	S	*	*			trans	-80.6	104.1	168.6	47.9	0	0	0	0	109
12	T	68.8	Low	73.4	Confident	139 Å²	139	152.3 Å²	152.3	85%	0.853	83%	0.833	S	S	*	*			trans	-87.9	111.6	173.5	-54.2	0	0	0	0	109.3	K10	K10-T12 PolarHBondContact O-N 3.49Å
13	G	66.7	Low	73.1	Confident	65 Å²	65	154.3 Å²	154.3	67%	0.67	83%	0.834	S	S	*	*			trans	90.3	78.8	153.6	0	0	0	0	0	115.5	K15	G13-K15 PolarHBondContact O-N 3.48Å
14	G	70.2	Confident	72.7	Confident	73 Å²	73	155 Å²	155	75%	0.753	84%	0.835	S	S	*	*			trans	-56.5	124.5	153.3	0	0	0	0	0	108.7	T16	G14-T16 PolarHBondContact O-N 3.22Å
15	K	67	Low	72.4	Confident	208 Å²	208	152.7 Å²	152.7	90%	0.904	83%	0.828	S	S	*	*			trans	-54.3	109.9	171.6	-84.9	175.8	176.1	173.1	0	107.4	G13 T17	G13-K15 PolarHBondContact O-N 3.48Å; K15-T17 PolarHBondContact O-N 3.26Å
16	T	68.7	Low	71.7	Confident	131 Å²	131	148.1 Å²	148.1	80%	0.804	83%	0.827	S	S	*	*			trans	-57.2	128.3	176	43.5	0	0	0	0	108.7	G14 R18	G14-T16 PolarHBondContact O-N 3.22Å; T16-R18 VanDerWaalsContact C-N 3.34Å; T16-R18 PolarHBondContact O-N 2.95Å
17	T	70.8	Confident	70.9	Confident	141 Å²	141	150 Å²	150	87%	0.865	83%	0.826	S	S	*	*			trans	-62.9	99.3	173.3	-35.6	0	0	0	0	106.8	K15 K19	K15-T17 PolarHBondContact O-N 3.26Å; T17-K19 PolarHBondContact O-N 2.74Å
18	R	71.1	Confident	70.2	Confident	225 Å²	225	154.7 Å²	154.7	85%	0.849	84%	0.838	S	S	*	*			trans	-57.9	114	178.9	-175.9	-178.5	-67.5	-105	1	107	T16 Q20	T16-R18 VanDerWaalsContact C-N 3.34Å; T16-R18 PolarHBondContact O-N 2.95Å; R18-Q20 PolarHBondContact O-N 3.01Å
19	K	69.7	Low	69.6	Low	186 Å²	186	154.5 Å²	154.5	81%	0.809	83%	0.83	S	S	*	*			trans	-44.5	115	168.9	-79.5	-178.5	173.5	-179.6	0	107.7	T17 L21	T17-K19 PolarHBondContact O-N 2.74Å; K19-L21 PolarHBondContact O-N 3.1Å
20	Q	69.4	Low	69.1	Low	197 Å²	197	149.5 Å²	149.5	92%	0.921	83%	0.825	S	S	*	*			trans	-66.1	101	172.1	-80.6	-168.2	0.6	0	0	107.4	R18	R18-Q20 PolarHBondContact O-N 3.01Å
21	L	72.3	Confident	68.7	Low	157 Å²	157	144.5 Å²	144.5	82%	0.822	81%	0.813	S	S	*	*			trans	-71.3	125.7	165.8	-68.5	171.9	0	0	0	107.3	K19 T23	K19-L21 PolarHBondContact O-N 3.1Å; L21-T23 PolarHBondContact O-N 2.97Å
22	A	73.1	Confident	68.1	Low	103 Å²	103	143 Å²	143	85%	0.851	81%	0.808	S	S	*	*			trans	-54	126.7	179.2	0	0	0	0	0	110.6	K24	A22-K24 PolarHBondContact O-N 3.02Å
23	T	62.3	Low	67.9	Low	143 Å²	143	142.2 Å²	142.2	88%	0.877	80%	0.803	S	S	*	*			trans	-72.9	110.9	177.5	34.4	0	0	0	0	110.2	L21	L21-T23 PolarHBondContact O-N 2.97Å
24	K	71	Confident	67.6	Low	208 Å²	208	144.6 Å²	144.6	90%	0.904	81%	0.809	S	S	*	*			trans	-101.8	82.2	166.6	-154.5	174.2	-175.2	-179.5	0	109.5	A22 A26	A22-K24 PolarHBondContact O-N 3.02Å; K24-A26 PolarHBondContact O-N 2.88Å
25	A	71.3	Confident	67.2	Low	79 Å²	79	144.5 Å²	144.5	65%	0.653	81%	0.809	S	S	*	*			trans	-80.6	103	167.3	0	0	0	0	0	108.8	R27	A25-R27 VanDerWaalsContact C-N 3.28Å; A25-R27 PolarHBondContact O-N 2.88Å
26	A	67	Low	67	Low	97 Å²	97	140.6 Å²	140.6	80%	0.802	80%	0.802	S	S	*	*			trans	-74.3	87.7	165.1	0	0	0	0	0	108.3	K24 K28	K24-A26 PolarHBondContact O-N 2.88Å; A26-K28 PolarHBondContact O-N 3.19Å; A26-K28 VanDerWaalsContact O-N 3.16Å
27	R	67.3	Low	67.2	Low	229 Å²	229	143.9 Å²	143.9	86%	0.864	81%	0.805	S	S	*	*			trans	-67.1	108.7	169.6	-70.5	-176.2	-93.7	-170.5	-5.6	107.5	A25 S29	A25-R27 VanDerWaalsContact C-N 3.28Å; A25-R27 PolarHBondContact O-N 2.88Å; R27-S29 PolarHBondContact O-N 3.42Å; R27-S29 VanDerWaalsContact O-N 3.15Å
28	K	64.3	Low	67.3	Low	202 Å²	202	146.7 Å²	146.7	88%	0.878	81%	0.805	S	S	*	*			trans	-68.3	108.2	159.1	-71.4	-171.2	-179	-177.5	0	106.1	A26 V30	A26-K28 PolarHBondContact O-N 3.19Å; A26-K28 VanDerWaalsContact O-N 3.16Å; K28-V30 PolarHBondContact O-N 3.43Å; K28-V30 VanDerWaalsContact O-N 3.11Å
29	S	63.9	Low	67.5	Low	104 Å²	104	141.4 Å²	141.4	73%	0.727	80%	0.8	S	S	*	*			trans	-59.3	114.2	164.8	58.3	0	0	0	0	107.1	R27 P31	R27-S29 PolarHBondContact O-N 3.42Å; R27-S29 VanDerWaalsContact O-N 3.15Å; S29-P31 VanDerWaalsContact O-CD 3.3Å; S29-P31 WeakPolarHBondContact O-CD 3.37Å
30	V	66.4	Low	67.8	Low	128 Å²	128	140.9 Å²	140.9	78%	0.776	80%	0.8	S	S	*	*			trans	-62.6	117.5	160.5	-174.8	0	0	0	0	104.8	K28 A32	K28-V30 PolarHBondContact O-N 3.43Å; K28-V30 VanDerWaalsContact O-N 3.11Å; V30-A32 PolarHBondContact O-N 2.89Å; V30-A32 VanDerWaalsContact O-N 3.14Å
31	P	66.4	Low	68.1	Low	97 Å²	97	142.6 Å²	142.6	63%	0.63	80%	0.798	S	S	*	*			trans	-63	121.5	168.9	26.1	-27.3	0	0	0	105.5	S29 T33	S29-P31 VanDerWaalsContact O-CD 3.3Å; S29-P31 WeakPolarHBondContact O-CD 3.37Å; P31-T33 VanDerWaalsContact C-N 3.3Å; P31-T33 PolarHBondContact O-N 3.41Å
32	A	63.6	Low	68.2	Low	91 Å²	91	144 Å²	144	75%	0.752	79%	0.794	S	S	*	*			trans	-57.4	100.7	171.7	0	0	0	0	0	107.3	V30 S34	V30-A32 PolarHBondContact O-N 2.89Å; V30-A32 VanDerWaalsContact O-N 3.14Å; A32-S34 PolarHBondContact O-N 3.41Å
33	T	63.4	Low	68.2	Low	123 Å²	123	150 Å²	150	76%	0.755	79%	0.794	S	S	*	*			trans	-72.2	78.9	179.7	32	0	0	0	0	108.9	P31	P31-T33 VanDerWaalsContact C-N 3.3Å; P31-T33 PolarHBondContact O-N 3.41Å
34	S	61.3	Low	68.5	Low	114 Å²	114	148.6 Å²	148.6	80%	0.797	79%	0.788	S	S	*	*			trans	-108	94.8	163.6	50	0	0	0	0	108.8	A32	A32-S34 PolarHBondContact O-N 3.41Å
35	G	62	Low	68.2	Low	72 Å²	72	141.1 Å²	141.1	74%	0.742	77%	0.77	S	S	*	*			trans	119.4	68.4	168.4	0	0	0	0	0	115.1	K37	G35-K37 PolarHBondContact O-N 2.97Å
36	V	62	Low	67.6	Low	126 Å²	126	144.5 Å²	144.5	76%	0.764	78%	0.783	S	S	*	*			trans	-72.9	91.4	169.9	-169.7	0	0	0	0	108.9
37	K	71.8	Confident	67.3	Low	200 Å²	200	142.9 Å²	142.9	87%	0.87	78%	0.775	S	S	*	*			trans	-67.2	135.4	166.6	-149.7	179.6	-173	-179	0	107.9	G35	G35-K37 PolarHBondContact O-N 2.97Å
38	K	74.6	Confident	66.9	Low	200 Å²	200	140.5 Å²	140.5	87%	0.87	77%	0.771	S	S	*	*			trans	-44.8	125.6	-175.8	-82.1	178.7	177.3	176.4	0	111.3	H40	K38-H40 PolarHBondContact O-N 2.98Å; K38-H40 VanDerWaalsContact O-N 3.08Å
39	P	75.2	Confident	66.5	Low	114 Å²	114	137.2 Å²	137.2	74%	0.74	77%	0.769	S	S	*	*			trans	-63.8	115.3	178.2	3.1	0.3	0	0	0	109.6	R41	P39-R41 PolarHBondContact O-N 3.4Å; P39-R41 VanDerWaalsContact O-N 3.14Å
40	H	75.1	Confident	66	Low	174 Å²	174	139 Å²	139	81%	0.806	77%	0.769	S	S	*	*			trans	-65.6	110	169.2	-179	-87.3	0	0	0	107.4	K38 Y42	K38-H40 PolarHBondContact O-N 2.98Å; K38-H40 VanDerWaalsContact O-N 3.08Å; H40-Y42 PolarHBondContact O-N 3.26Å
41	R	76.4	Confident	65.6	Low	233 Å²	233	139.9 Å²	139.9	88%	0.879	77%	0.769	S	S	*	*			trans	-57.3	110	178.6	-79.7	-177.8	173.9	-177.2	-2.5	108.9	P39	P39-R41 PolarHBondContact O-N 3.4Å; P39-R41 VanDerWaalsContact O-N 3.14Å
42	Y	74.4	Confident	65.5	Low	186 Å²	186	143.8 Å²	143.8	73%	0.729	78%	0.782	S	S	*	*			trans	-73.8	127.8	171	-158.6	-96.4	0	0	0	108.3	H40 P44	H40-Y42 PolarHBondContact O-N 3.26Å; Y42-P44 WeakPolarHBondContact O-CD 3.41Å
43	R	72.3	Confident	65.4	Low	230 Å²	230	143.1 Å²	143.1	87%	0.868	78%	0.777	S	S	*	*			trans	-83.4	113.4	167.8	-69.4	-173.2	175	-142.4	0.5	106.8	G45	R43-G45 PolarHBondContact O-N 2.97Å
44	P	69.2	Low	65.3	Low	113 Å²	113	143.8 Å²	143.8	73%	0.734	78%	0.776	S	S	*	*			trans	-70.2	100.3	177.9	27.8	-31.3	0	0	0	108.9	Y42	Y42-P44 WeakPolarHBondContact O-CD 3.41Å
45	G	64.5	Low	65.3	Low	52 Å²	52	146.3 Å²	146.3	54%	0.536	78%	0.775	S	S	.	*			trans	-96.8	109.2	166.6	0	0	0	0	0	108.3	R43 G47	R43-G45 PolarHBondContact O-N 2.97Å; G45-G47 PolarHBondContact O-N 2.97Å
46	T	59.4	Low	65.1	Low	150 Å²	150	148.8 Å²	148.8	92%	0.92	78%	0.776	S	S	*	*	S	Bend	trans	41.2	4.6	154.9	-20.4	0	0	0	0	120.8
47	G	60.7	Low	65	Low	62 Å²	62	148 Å²	148	64%	0.639	77%	0.767	S	S	*	*	S	Bend	trans	-128.3	4.3	-169.9	0	0	0	0	0	114.3	G45	G45-G47 PolarHBondContact O-N 2.97Å
48	F	58.1	Low	64.6	Low	180 Å²	180	145.3 Å²	145.3	79%	0.789	76%	0.758	S	S	*	*	S	Bend	trans	-110	2.6	-178.8	-150.5	-96.3	0	0	0	113.8
49	T	55.4	Low	64.1	Low	133 Å²	133	142.7 Å²	142.7	82%	0.816	75%	0.746	S	S	*	*			trans	-102.8	58.3	172.7	54.3	0	0	0	0	109.4
50	L	53.1	Low	63.5	Low	141 Å²	141	139.7 Å²	139.7	74%	0.738	73%	0.728	S	S	*	*			trans	-120.6	103.6	173.5	-164.2	68.4	0	0	0	108.6
51	L	59.9	Low	63.3	Low	147 Å²	147	132.8 Å²	132.8	77%	0.77	70%	0.701	S	S	*	*			trans	65.7	70.9	153.4	-53	173.2	0	0	0	117.8
52	I	64.3	Low	63.2	Low	179 Å²	179	124.3 Å²	124.3	92%	0.918	68%	0.678	S	S	*	*			trans	-125.6	72.7	148.5	-50.6	176.3	0	0	0	107.7
53	A	61.3	Low	63.3	Low	77 Å²	77	120.5 Å²	120.5	64%	0.636	67%	0.67	S	S	*	*			trans	-148.9	122	168.3	0	0	0	0	0	105.7
54	D	59.9	Low	63.4	Low	136 Å²	136	114.6 Å²	114.6	73%	0.727	66%	0.655	S	S	*	*	S	Bend	trans	165.5	-27.5	145.2	-81	-23.8	0	0	0	113.8	T56	D54-T56 VanDerWaalsContact C-N 3.34Å; D54-T56 PolarHBondContact O-N 3.46Å
55	E	62.4	Low	63.8	Low	167 Å²	167	116.2 Å²	116.2	78%	0.78	65%	0.647	S	S	*	*	H	α-helix	trans	-72.2	-17.1	-172.1	-76.7	-169.9	165.5	0	0	116.2
56	T	57.1	Low	64.3	Low	124 Å²	124	117.2 Å²	117.2	76%	0.761	65%	0.645	S	S	*	*	H	α-helix	trans	-89.1	-22	-177.5	55.8	0	0	0	0	113.5	D54 S60	D54-T56 VanDerWaalsContact C-N 3.34Å; D54-T56 PolarHBondContact O-N 3.46Å; T56-S60 PolarHBondContact O-OG 3.38Å
57	N	60.6	Low	65.3	Low	109 Å²	109	116 Å²	116	58%	0.583	63%	0.627	S	S	*	*	H	α-helix	trans	-78.6	-34.7	-176.5	-169.7	2.2	0	0	0	112.3	K59 S60 A61	N57-K59 PolarHBondContact O-N 2.76Å; N57-S60 PolarHBondContact O-N 3.5Å; N57-S60 PolarHBondContact O-OG 2.88Å; N57-A61 WeakPolarHBondContact O-CB 3.33Å; N57-A61 PolarHBondContact O-N 3.44Å
58	E	62.8	Low	66.1	Low	144 Å²	144	119.3 Å²	119.3	67%	0.673	63%	0.625	S	S	*	*	H	α-helix	trans	-69.6	-34.5	-176.3	-164.1	172.1	-167.3	0	0	112.9	A61 S62	E58-A61 PolarHBondContact O-N 2.9Å; E58-S62 PolarHBondContact O-N 2.99Å; E58-S62 PolarHBondContact O-OG 3.46Å
59	K	64.5	Low	67	Low	145 Å²	145	116.9 Å²	116.9	63%	0.63	62%	0.617	S	S	*	*	H	α-helix	trans	-71.8	-36.7	176.9	-68.9	174.9	-176	162.7	0	112.6	N57 S62 L63	N57-K59 PolarHBondContact O-N 2.76Å; K59-S62 PolarHBondContact O-OG 3.49Å; K59-S62 VanDerWaalsContact O-OG 3.07Å; K59-L63 WeakPolarHBondContact O-CG 3.44Å; K59-L63 PolarHBondContact O-N 3.42Å
60	S	62	Low	68.3	Low	52 Å²	52	115.1 Å²	115.1	36%	0.364	60%	0.602	S	S	.	*	H	α-helix	trans	-71.4	-37.7	174.2	58.3	0	0	0	0	110.8	T56 N57 N64	T56-S60 PolarHBondContact O-OG 3.38Å; N57-S60 PolarHBondContact O-N 3.5Å; N57-S60 PolarHBondContact O-OG 2.88Å; S60-N64 PolarHBondContact O-N 3.41Å; S60-N64 PolarHBondContact O-ND2 3.19Å
61	A	71.2	Confident	69.3	Low	29 Å²	29	117.1 Å²	117.1	24%	0.24	60%	0.601	C	S	.	*	H	α-helix	trans	-63.9	-40.9	175.5	0	0	0	0	0	112.6	N57 E58 R65	N57-A61 WeakPolarHBondContact O-CB 3.33Å; N57-A61 PolarHBondContact O-N 3.44Å; E58-A61 PolarHBondContact O-N 2.9Å; A61-R65 WeakPolarHBondContact O-CG 3.45Å; A61-R65 PolarHBondContact O-N 3.1Å
62	S	74.2	Confident	70.1	Confident	54 Å²	54	113.7 Å²	113.7	38%	0.378	59%	0.586	S	S	.	*	H	α-helix	trans	-68.4	-39.2	178.5	68.4	0	0	0	0	113.1	E58 K59 R65 C66	E58-S62 PolarHBondContact O-N 2.99Å; E58-S62 PolarHBondContact O-OG 3.46Å; K59-S62 PolarHBondContact O-OG 3.49Å; K59-S62 VanDerWaalsContact O-OG 3.07Å; S62-R65 PolarHBondContact O-N 3.13Å; S62-C66 WeakPolarHBondContact O-CB 3.37Å; S62-C66 PolarHBondContact O-N 3.33Å
63	L	76	Confident	70.9	Confident	107 Å²	107	111.7 Å²	111.7	56%	0.56	57%	0.571	S	S	*	*	H	α-helix	trans	-62.9	-47.2	174	-77.5	169.6	0	0	0	111.4	K59 R65 C66 F67	K59-L63 WeakPolarHBondContact O-CG 3.44Å; K59-L63 PolarHBondContact O-N 3.42Å; L63-R65 VanDerWaalsContact C-N 3.33Å; L63-R65 PolarHBondContact O-N 3.47Å; L63-C66 WeakPolarHBondContact O-CB 3.41Å; L63-C66 PolarHBondContact O-N 2.98Å; L63-F67 WeakPolarHBondContact O-CD2 3.47Å; L63-F67 PolarHBondContact O-N 3.01Å
64	N	74.4	Confident	71.6	Confident	106 Å²	106	110.8 Å²	110.8	57%	0.567	56%	0.563	S	S	*	*	H	α-helix	trans	-61.4	-40.3	177.7	-76.2	-56.5	0	0	0	112.2	S60 F67 Q68	S60-N64 PolarHBondContact O-N 3.41Å; S60-N64 PolarHBondContact O-ND2 3.19Å; N64-F67 PolarHBondContact O-N 2.97Å; N64-Q68 WeakPolarHBondContact O-CB 3.46Å; N64-Q68 PolarHBondContact O-N 3.43Å
65	R	77.5	Confident	72.5	Confident	147 Å²	147	106.2 Å²	106.2	56%	0.555	55%	0.548	S	S	*	.	H	α-helix	trans	-60.2	-47.2	172.7	-74.8	-171.5	-63	-106.9	4.8	111.7	A61 S62 L63 F67 Q68 E69	A61-R65 WeakPolarHBondContact O-CG 3.45Å; A61-R65 PolarHBondContact O-N 3.1Å; S62-R65 PolarHBondContact O-N 3.13Å; L63-R65 VanDerWaalsContact C-N 3.33Å; L63-R65 PolarHBondContact O-N 3.47Å; R65-F67 VanDerWaalsContact C-N 3.34Å; R65-F67 PolarHBondContact O-N 3.34Å; R65-Q68 PolarHBondContact O-N 3.48Å; R65-E69 WeakPolarHBondContact O-CG 3.39Å; R65-E69 PolarHBondContact O-N 3.43Å
66	C	76.6	Confident	73.2	Confident	73 Å²	73	103 Å²	103	49%	0.493	54%	0.536	S	S	.	.	H	α-helix	trans	-56.7	-47.4	178.1	-164.6	0	0	0	0	111.7	S62 L63 Q68 E69 D70	S62-C66 WeakPolarHBondContact O-CB 3.37Å; S62-C66 PolarHBondContact O-N 3.33Å; L63-C66 WeakPolarHBondContact O-CB 3.41Å; L63-C66 PolarHBondContact O-N 2.98Å; C66-Q68 PolarHBondContact O-N 3.19Å; C66-E69 PolarHBondContact O-N 2.98Å; C66-D70 PolarHBondContact O-N 2.95Å; C66-D70 VanDerWaalsContact O-N 3.13Å
67	F	78.7	Confident	74	Confident	125 Å²	125	101.7 Å²	101.7	55%	0.548	52%	0.524	S	S	.	.	H	α-helix	trans	-61.5	-44.2	176	-79.4	-68.8	0	0	0	112.6	L63 N64 R65 E69 D70 Y71	L63-F67 WeakPolarHBondContact O-CD2 3.47Å; L63-F67 PolarHBondContact O-N 3.01Å; N64-F67 PolarHBondContact O-N 2.97Å; R65-F67 VanDerWaalsContact C-N 3.34Å; R65-F67 PolarHBondContact O-N 3.34Å; F67-E69 PolarHBondContact O-N 3.07Å; F67-D70 PolarHBondContact O-N 3.4Å; F67-Y71 VanDerWaalsContact O-CD2 3.24Å; F67-Y71 WeakPolarHBondContact O-CD2 3.49Å; F67-Y71 PolarHBondContact O-N 3.17Å
68	Q	78	Confident	74.8	Confident	130 Å²	130	102 Å²	102	61%	0.607	52%	0.521	S	S	*	.	H	α-helix	trans	-60.6	-45.4	179.4	-164.8	87.2	20.8	0	0	111.7	N64 R65 C66 D70 Y71 V72	N64-Q68 WeakPolarHBondContact O-CB 3.46Å; N64-Q68 PolarHBondContact O-N 3.43Å; R65-Q68 PolarHBondContact O-N 3.48Å; C66-Q68 PolarHBondContact O-N 3.19Å; Q68-D70 VanDerWaalsContact C-N 3.35Å; Q68-D70 PolarHBondContact O-N 3.47Å; Q68-Y71 PolarHBondContact O-N 3.42Å; Q68-V72 WeakPolarHBondContact O-CG2 3.27Å; Q68-V72 PolarHBondContact O-N 3.41Å; Q68-V72 VanDerWaalsContact O-N 3.1Å
69	E	77.9	Confident	75.3	Confident	130 Å²	130	98.7 Å²	98.7	61%	0.607	51%	0.507	S	S	*	.	H	α-helix	trans	-62	-40.4	178.6	-67.8	-61.2	141.2	0	0	111.8	R65 C66 F67 Y71 V72 K73	R65-E69 WeakPolarHBondContact O-CG 3.39Å; R65-E69 PolarHBondContact O-N 3.43Å; C66-E69 PolarHBondContact O-N 2.98Å; F67-E69 PolarHBondContact O-N 3.07Å; E69-Y71 PolarHBondContact O-N 3Å; E69-V72 PolarHBondContact O-N 3.48Å; E69-K73 VanDerWaalsContact O-CB 3.27Å; E69-K73 WeakPolarHBondContact O-CB 3.4Å; E69-K73 PolarHBondContact O-N 2.9Å
70	D	81.1	Confident	75.9	Confident	95 Å²	95	93.9 Å²	93.9	51%	0.508	49%	0.494	S	S	.	.	H	α-helix	trans	-63.4	-41.5	177.4	-76.6	-24.8	0	0	0	112.2	C66 F67 Q68 K73 A74	C66-D70 PolarHBondContact O-N 2.95Å; C66-D70 VanDerWaalsContact O-N 3.13Å; F67-D70 PolarHBondContact O-N 3.4Å; Q68-D70 VanDerWaalsContact C-N 3.35Å; Q68-D70 PolarHBondContact O-N 3.47Å; D70-K73 PolarHBondContact O-N 3.27Å; D70-A74 VanDerWaalsContact O-CB 3.31Å; D70-A74 WeakPolarHBondContact O-CB 3.49Å; D70-A74 PolarHBondContact O-N 3.46Å
71	Y	74.6	Confident	76.6	Confident	184 Å²	184	95.8 Å²	95.8	72%	0.722	50%	0.497	S	S	*	.	H	α-helix	trans	-65.3	-43.4	175.9	-84.9	-75	0	0	0	112.4	F67 Q68 E69 K73 A74 G75	F67-Y71 VanDerWaalsContact O-CD2 3.24Å; F67-Y71 WeakPolarHBondContact O-CD2 3.49Å; F67-Y71 PolarHBondContact O-N 3.17Å; Q68-Y71 PolarHBondContact O-N 3.42Å; E69-Y71 PolarHBondContact O-N 3Å; Y71-K73 VanDerWaalsContact C-N 3.35Å; Y71-A74 PolarHBondContact O-N 3.21Å; Y71-G75 PolarHBondContact O-N 3.37Å
72	V	76.7	Confident	76.8	Confident	74 Å²	74	98.4 Å²	98.4	45%	0.448	51%	0.507	S	S	.	.	H	α-helix	trans	-64.6	-42	177.6	173.8	0	0	0	0	110.5	Q68 E69 G75 N76	Q68-V72 WeakPolarHBondContact O-CG2 3.27Å; Q68-V72 PolarHBondContact O-N 3.41Å; Q68-V72 VanDerWaalsContact O-N 3.1Å; E69-V72 PolarHBondContact O-N 3.48Å; V72-G75 PolarHBondContact O-N 3.38Å; V72-N76 WeakPolarHBondContact O-CB 3.36Å; V72-N76 PolarHBondContact O-N 2.99Å; V72-N76 PolarHBondContact O-ND2 3.28Å
73	K	80.4	Confident	77	Confident	138 Å²	138	103.6 Å²	103.6	60%	0.6	52%	0.518	S	S	*	.	H	α-helix	trans	-64.7	-44.2	177.1	-171.4	176.3	-178.8	-179.4	0	111.9	E69 D70 Y71 N76 L77	E69-K73 VanDerWaalsContact O-CB 3.27Å; E69-K73 WeakPolarHBondContact O-CB 3.4Å; E69-K73 PolarHBondContact O-N 2.9Å; D70-K73 PolarHBondContact O-N 3.27Å; Y71-K73 VanDerWaalsContact C-N 3.35Å; K73-N76 PolarHBondContact O-N 3.07Å; K73-L77 HydrophobicContact CG-CD1 4.1Å; K73-L77 WeakPolarHBondContact O-CB 3.31Å; K73-L77 WeakPolarHBondContact O-CD1 3.47Å; K73-L77 WeakPolarHBondContact O-CG 3.34Å; K73-L77 PolarHBondContact O-N 2.83Å
74	A	76.6	Confident	77	Confident	58 Å²	58	104.3 Å²	104.3	48%	0.479	52%	0.522	S	S	.	.	H	α-helix	trans	-62.1	-41.6	176.1	0	0	0	0	0	112.1	D70 Y71 L77 K78	D70-A74 VanDerWaalsContact O-CB 3.31Å; D70-A74 WeakPolarHBondContact O-CB 3.49Å; D70-A74 PolarHBondContact O-N 3.46Å; Y71-A74 PolarHBondContact O-N 3.21Å; A74-L77 PolarHBondContact O-N 2.87Å; A74-K78 WeakPolarHBondContact O-CB 3.24Å; A74-K78 PolarHBondContact O-N 2.93Å
75	G	80.2	Confident	77.1	Confident	40 Å²	40	105.2 Å²	105.2	41%	0.412	53%	0.527	S	S	.	.	H	α-helix	trans	-64.5	-43.9	176.2	0	0	0	0	0	113	Y71 V72 K78 L79	Y71-G75 PolarHBondContact O-N 3.37Å; V72-G75 PolarHBondContact O-N 3.38Å; G75-K78 PolarHBondContact O-N 3.39Å; G75-L79 WeakPolarHBondContact O-CB 3.4Å; G75-L79 PolarHBondContact O-N 3.27Å
76	N	76.2	Confident	76.9	Confident	99 Å²	99	104.7 Å²	104.7	53%	0.529	54%	0.535	S	S	.	.	H	α-helix	trans	-66.1	-38.2	177.2	-79.3	-30.5	0	0	0	112.5	V72 K73 L79 A80	V72-N76 WeakPolarHBondContact O-CB 3.36Å; V72-N76 PolarHBondContact O-N 2.99Å; V72-N76 PolarHBondContact O-ND2 3.28Å; K73-N76 PolarHBondContact O-N 3.07Å; N76-L79 PolarHBondContact O-N 2.99Å; N76-A80 WeakPolarHBondContact O-CB 3.16Å; N76-A80 PolarHBondContact O-N 3.37Å
77	L	73.2	Confident	76.6	Confident	97 Å²	97	110.8 Å²	110.8	51%	0.508	56%	0.562	S	S	.	*	H	α-helix	trans	-61.5	-45.9	171.6	-78.9	159.6	0	0	0	110.9	K73 A74 L79 A80 E81	K73-L77 HydrophobicContact CG-CD1 4.1Å; K73-L77 WeakPolarHBondContact O-CB 3.31Å; K73-L77 WeakPolarHBondContact O-CD1 3.47Å; K73-L77 WeakPolarHBondContact O-CG 3.34Å; K73-L77 PolarHBondContact O-N 2.83Å; A74-L77 PolarHBondContact O-N 2.87Å; L77-L79 VanDerWaalsContact C-N 3.33Å; L77-L79 PolarHBondContact O-N 2.99Å; L77-A80 PolarHBondContact O-N 3.37Å; L77-E81 WeakPolarHBondContact O-CG 3.34Å; L77-E81 PolarHBondContact O-N 3.28Å
78	K	77.2	Confident	76.5	Confident	116 Å²	116	110.1 Å²	110.1	50%	0.504	56%	0.563	S	S	.	*	H	α-helix	trans	-63.7	-38	177.9	-163.5	72.2	-150.4	153.5	0	112.8	A74 G75 E81 L82	A74-K78 WeakPolarHBondContact O-CB 3.24Å; A74-K78 PolarHBondContact O-N 2.93Å; G75-K78 PolarHBondContact O-N 3.39Å; K78-E81 IonicContact NZ-OE2 2.76Å; K78-E81 PolarHBondContact NZ-OE2 2.62Å; K78-L82 WeakPolarHBondContact O-CG 3.47Å; K78-L82 PolarHBondContact O-N 3.01Å
79	L	75.2	Confident	76.4	Confident	74 Å²	74	109.1 Å²	109.1	39%	0.387	56%	0.56	S	S	.	*	H	α-helix	trans	-69.9	-35.2	175.1	-175.4	62.5	0	0	0	112.2	G75 N76 L77 R83	G75-L79 WeakPolarHBondContact O-CB 3.4Å; G75-L79 PolarHBondContact O-N 3.27Å; N76-L79 PolarHBondContact O-N 2.99Å; L77-L79 VanDerWaalsContact C-N 3.33Å; L77-L79 PolarHBondContact O-N 2.99Å; L79-R83 WeakPolarHBondContact O-CB 3.48Å; L79-R83 WeakPolarHBondContact O-CG 3.36Å; L79-R83 PolarHBondContact O-N 2.95Å
80	A	76.7	Confident	76.3	Confident	44 Å²	44	107.9 Å²	107.9	36%	0.364	56%	0.558	S	S	.	*	H	α-helix	trans	-67.4	-42.8	174.1	0	0	0	0	0	111.5	N76 L77 R83 L84	N76-A80 WeakPolarHBondContact O-CB 3.16Å; N76-A80 PolarHBondContact O-N 3.37Å; L77-A80 PolarHBondContact O-N 3.37Å; A80-R83 PolarHBondContact O-N 3.15Å; A80-L84 WeakPolarHBondContact O-CG 3.3Å; A80-L84 PolarHBondContact O-N 2.98Å
81	E	76.2	Confident	76	Confident	91 Å²	91	108.6 Å²	108.6	43%	0.425	56%	0.56	S	S	.	*	H	α-helix	trans	-56.9	-51.4	171.8	-73	175.9	179.1	0	0	110.9	L77 K78 R83 L84 D85	L77-E81 WeakPolarHBondContact O-CG 3.34Å; L77-E81 PolarHBondContact O-N 3.28Å; K78-E81 IonicContact NZ-OE2 2.76Å; K78-E81 PolarHBondContact NZ-OE2 2.62Å; E81-R83 VanDerWaalsContact C-N 3.26Å; E81-R83 PolarHBondContact O-N 3.11Å; E81-L84 PolarHBondContact O-N 3.14Å; E81-L84 VanDerWaalsContact O-N 3.1Å; E81-D85 PolarHBondContact O-N 2.79Å
82	L	75.3	Confident	76.1	Confident	85 Å²	85	103.9 Å²	103.9	45%	0.445	55%	0.55	S	S	.	*	H	α-helix	trans	-61.6	-31.5	177.2	-74.3	167.5	0	0	0	113.3	K78 N86	K78-L82 WeakPolarHBondContact O-CG 3.47Å; K78-L82 PolarHBondContact O-N 3.01Å; L82-N86 PolarHBondContact O-N 3.14Å; L82-N86 PolarHBondContact O-ND2 3.16Å
83	R	78.6	Confident	76.1	Confident	162 Å²	162	105.9 Å²	105.9	61%	0.611	56%	0.557	S	S	*	*	H	α-helix	trans	-72.9	-34.9	175.3	-84.1	-178.9	177.7	131.9	-0.9	112.5	L79 A80 E81 N86	L79-R83 WeakPolarHBondContact O-CB 3.48Å; L79-R83 WeakPolarHBondContact O-CG 3.36Å; L79-R83 PolarHBondContact O-N 2.95Å; A80-R83 PolarHBondContact O-N 3.15Å; E81-R83 VanDerWaalsContact C-N 3.26Å; E81-R83 PolarHBondContact O-N 3.11Å; R83-N86 PolarHBondContact O-N 3.08Å
84	L	76.4	Confident	75.8	Confident	122 Å²	122	103.6 Å²	103.6	64%	0.639	55%	0.554	S	S	*	*	H	α-helix	trans	-71	-35.5	176.2	-70.2	172.3	0	0	0	111.6	A80 E81 N86 L87	A80-L84 WeakPolarHBondContact O-CG 3.3Å; A80-L84 PolarHBondContact O-N 2.98Å; E81-L84 PolarHBondContact O-N 3.14Å; E81-L84 VanDerWaalsContact O-N 3.1Å; L84-N86 PolarHBondContact O-N 2.97Å; L84-L87 PolarHBondContact O-N 2.87Å
85	D	75.5	Confident	75.7	Confident	126 Å²	126	107.2 Å²	107.2	67%	0.674	56%	0.56	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.3	-15.1	177.3	-64.5	-29	0	0	0	113.5	E81	E81-D85 PolarHBondContact O-N 2.79Å
86	N	74.7	Confident	75.3	Confident	136 Å²	136	112.8 Å²	112.8	73%	0.727	57%	0.572	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.9	9	179.9	-78.1	-57	0	0	0	113.9	L82 R83 L84	L82-N86 PolarHBondContact O-N 3.14Å; L82-N86 PolarHBondContact O-ND2 3.16Å; R83-N86 PolarHBondContact O-N 3.08Å; L84-N86 PolarHBondContact O-N 2.97Å
87	L	69	Low	75.3	Confident	201 Å²	201	114 Å²	114	100%	1.052	58%	0.576	S	S	*	*			trans	-105.6	0	173.4	-73.8	168.9	0	0	0	110.4	L84	L84-L87 PolarHBondContact O-N 2.87Å

Retrieved 87 of 87 residues in 19.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).