G4VG85_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession G4VG85, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 67 aa.

						>G4VG85_SCHMA|G4VG85
MYVSLDGVNISLNSNHILTMENRHCTTTISLTSPNEQEIATQTGYREGTVLCRSQLSYRSQQAVEED
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	91.4	Very high	93.9	Very high	169 Å²	169	85.7 Å²	85.7	83%	0.833	48%	0.476	S	S	*	.				0	145.6	0	179.3	-175.7	-74.2	0	0	108.4	S11 L12	M1-S11 CarbonylContact O-C 3.48Å; M1-S11 WeakPolarHBondContact O-CA 3.3Å; M1-L12 HydrophobicContact CB-CB 4.24Å; M1-L12 PolarHBondContact N-O 3.49Å; M1-L12 PolarHBondContact O-N 2.93Å
2	Y	93.6	Very high	94.1	Very high	141 Å²	141	83.1 Å²	83.1	55%	0.553	46%	0.46	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-142.3	135.7	177	178.2	-91	0	0	0	110	N9 I10	Y2-N9 HydrophobicContact CE2-CB 4.03Å; Y2-N9 PolarHBondContact OH-OD1 2.98Å; Y2-I10 CarbonylContact C-O 3.55Å; Y2-I10 WeakPolarHBondContact CA-O 3.46Å
3	V	94.4	Very high	94.2	Very high	61 Å²	61	81.9 Å²	81.9	37%	0.37	45%	0.453	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.9	139.4	175.2	-171.6	0	0	0	0	107.8	L5 I10	V3-L5 HydrophobicContact CG1-CD1 4.33Å; V3-L5 HydrophobicContact CG1-CD2 3.93Å; V3-L5 HydrophobicContact CG1-CG 3.83Å; V3-I10 PolarHBondContact N-O 3.27Å; V3-I10 PolarHBondContact O-N 3.49Å; V3-I10 VanDerWaalsContact O-O 3.11Å
4	S	93	Very high	94.2	Very high	66 Å²	66	83.8 Å²	83.8	46%	0.462	47%	0.474	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.9	125.3	169.4	-167.9	0	0	0	0	108.5	V8 N9	S4-V8 WeakPolarHBondContact CA-O 3.33Å; S4-N9 PolarHBondContact OG-OD1 3.27Å
5	L	90.6	Very high	94.2	Very high	97 Å²	97	85.6 Å²	85.6	51%	0.508	48%	0.482	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.2	120.4	-179.8	-61.7	176.4	0	0	0	108.7	V3 G7 V8 I10	V3-L5 HydrophobicContact CG1-CD1 4.33Å; V3-L5 HydrophobicContact CG1-CD2 3.93Å; V3-L5 HydrophobicContact CG1-CG 3.83Å; L5-G7 VanDerWaalsContact C-N 3.26Å; L5-G7 PolarHBondContact O-N 2.73Å; L5-G7 VanDerWaalsContact O-N 3.08Å; L5-V8 PolarHBondContact N-O 3.13Å; L5-V8 WeakPolarHBondContact O-CA 3.47Å; L5-V8 WeakPolarHBondContact O-CB 3.33Å; L5-V8 PolarHBondContact O-N 3.41Å; L5-I10 HydrophobicContact CD1-CD1 4.07Å
6	D	91.2	Very high	94.2	Very high	177 Å²	177	86.8 Å²	86.8	95%	0.947	48%	0.482	S	S	*	.	T	Hydrogen-bonded Turn	trans	47.1	43.9	170.7	-60.9	-22.8	0	0	0	115	V8	D6-V8 VanDerWaalsContact C-N 3.3Å; D6-V8 PolarHBondContact O-N 3.37Å
7	G	91.5	Very high	94.4	Very high	49 Å²	49	85 Å²	85	51%	0.505	47%	0.471	S	S	.	.	T	Hydrogen-bonded Turn	trans	77.8	12.3	-179.8	0	0	0	0	0	114.9	L5	L5-G7 VanDerWaalsContact C-N 3.26Å; L5-G7 PolarHBondContact O-N 2.73Å; L5-G7 VanDerWaalsContact O-N 3.08Å
8	V	95.5	Very high	94.6	Very high	44 Å²	44	82.4 Å²	82.4	27%	0.267	46%	0.456	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.5	118.2	170.5	-168.8	0	0	0	0	109.5	S4 L5 D6 I10 M20 E21 N22	S4-V8 WeakPolarHBondContact CA-O 3.33Å; L5-V8 PolarHBondContact N-O 3.13Å; L5-V8 WeakPolarHBondContact O-CA 3.47Å; L5-V8 WeakPolarHBondContact O-CB 3.33Å; L5-V8 PolarHBondContact O-N 3.41Å; D6-V8 VanDerWaalsContact C-N 3.3Å; D6-V8 PolarHBondContact O-N 3.37Å; V8-I10 HydrophobicContact CG1-CG1 4.05Å; V8-M20 HydrophobicContact CG1-CB 4.38Å; V8-E21 CarbonylContact C-O 3.55Å; V8-E21 WeakPolarHBondContact CA-O 3.5Å; V8-N22 HydrophobicContact CG2-CB 4.07Å
9	N	96.7	Very high	94.7	Very high	54 Å²	54	79.6 Å²	79.6	29%	0.289	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.7	118.4	171.4	-64.6	-25.5	0	0	0	109.1	Y2 S4 M20 E21	Y2-N9 HydrophobicContact CE2-CB 4.03Å; Y2-N9 PolarHBondContact OH-OD1 2.98Å; S4-N9 PolarHBondContact OG-OD1 3.27Å; N9-M20 CarbonylContact O-C 3.59Å; N9-M20 WeakPolarHBondContact O-CA 3.17Å; N9-E21 HydrophobicContact CB-CB 4.45Å; N9-E21 PolarHBondContact N-O 2.69Å; N9-E21 PolarHBondContact O-N 3.23Å
10	I	97.5	Very high	94.9	Very high	46 Å²	46	78.6 Å²	78.6	24%	0.236	43%	0.434	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	120.5	-179.8	-54.7	173.2	0	0	0	107.6	Y2 V3 L5 V8 L18 T19 M20	Y2-I10 CarbonylContact C-O 3.55Å; Y2-I10 WeakPolarHBondContact CA-O 3.46Å; V3-I10 PolarHBondContact N-O 3.27Å; V3-I10 PolarHBondContact O-N 3.49Å; V3-I10 VanDerWaalsContact O-O 3.11Å; L5-I10 HydrophobicContact CD1-CD1 4.07Å; V8-I10 HydrophobicContact CG1-CG1 4.05Å; I10-L18 HydrophobicContact CG2-CD1 3.72Å; I10-T19 CarbonylContact C-O 3.52Å; I10-T19 WeakPolarHBondContact CA-O 3.35Å; I10-M20 HydrophobicContact CG1-CG 4.24Å; I10-M20 HydrophobicContact CG2-CG 4.26Å
11	S	97.4	Very high	95	Very high	39 Å²	39	78.9 Å²	78.9	27%	0.273	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131	144	178.9	66.3	0	0	0	0	111.3	M1 L18 T19	M1-S11 CarbonylContact O-C 3.48Å; M1-S11 WeakPolarHBondContact O-CA 3.3Å; S11-L18 CarbonylContact O-C 3.56Å; S11-L18 WeakPolarHBondContact O-CA 3.43Å; S11-T19 PolarHBondContact N-O 3.11Å; S11-T19 PolarHBondContact O-N 2.85Å
12	L	96.6	Very high	95.1	Very high	54 Å²	54	74 Å²	74	28%	0.283	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.6	118.9	171.4	178.5	64.2	0	0	0	107.9	M1 L18 L31	M1-L12 HydrophobicContact CB-CB 4.24Å; M1-L12 PolarHBondContact N-O 3.49Å; M1-L12 PolarHBondContact O-N 2.93Å; L12-L18 HydrophobicContact CD1-CB 4.43Å; L12-L31 HydrophobicContact CD1-CD1 3.84Å
13	N	94.7	Very high	94.9	Very high	68 Å²	68	76.3 Å²	76.3	36%	0.364	42%	0.417	S	S	.	.			trans	-89.2	175.3	179.7	75	15.1	0	0	0	112.4	N15 H16 I17	N13-N15 PolarHBondContact O-N 2.99Å; N13-N15 WeakPolarHBondContact OD1-CA 3.11Å; N13-N15 WeakPolarHBondContact OD1-CB 3.24Å; N13-N15 PolarHBondContact OD1-N 3.25Å; N13-H16 PolarHBondContact O-N 3.42Å; N13-H16 VanDerWaalsContact O-N 3.13Å; N13-H16 PolarHBondContact OD1-N 2.93Å; N13-I17 PolarHBondContact N-O 3.42Å; N13-I17 VanDerWaalsContact N-O 3.14Å; N13-I17 PolarHBondContact OD1-N 2.97Å
14	S	94.6	Very high	94.8	Very high	108 Å²	108	78 Å²	78	76%	0.755	42%	0.421	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.7	-18.5	179.7	55.8	0	0	0	0	114.1	H16	S14-H16 PolarHBondContact O-N 3.28Å
15	N	94	Very high	95	Very high	111 Å²	111	76.3 Å²	76.3	59%	0.594	41%	0.408	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.4	12	178.2	-61.5	-14	0	0	0	111.9	N13 I17	N13-N15 PolarHBondContact O-N 2.99Å; N13-N15 WeakPolarHBondContact OD1-CA 3.11Å; N13-N15 WeakPolarHBondContact OD1-CB 3.24Å; N13-N15 PolarHBondContact OD1-N 3.25Å; N15-I17 HydrophobicContact CB-CG1 4.34Å; N15-I17 PolarHBondContact O-N 3.43Å
16	H	94.5	Very high	95.3	Very high	104 Å²	104	73.8 Å²	73.8	48%	0.481	40%	0.397	S	S	.	.			trans	60.5	27.6	-176.1	-52.8	85.8	0	0	0	113.2	N13 S14 L31	N13-H16 PolarHBondContact O-N 3.42Å; N13-H16 VanDerWaalsContact O-N 3.13Å; N13-H16 PolarHBondContact OD1-N 2.93Å; S14-H16 PolarHBondContact O-N 3.28Å; H16-L31 HydrophobicContact CB-CB 4.25Å; H16-L31 WeakPolarHBondContact O-CA 3.31Å; H16-L31 VanDerWaalsContact O-CB 3.24Å; H16-L31 WeakPolarHBondContact O-CB 3.3Å; H16-L31 PolarHBondContact O-N 2.05Å
17	I	97.4	Very high	95.6	Very high	57 Å²	57	67 Å²	67	29%	0.292	36%	0.362	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.2	119.5	171.9	-55.9	180	0	0	0	108.3	N13 N15	N13-I17 PolarHBondContact N-O 3.42Å; N13-I17 VanDerWaalsContact N-O 3.14Å; N13-I17 PolarHBondContact OD1-N 2.97Å; N15-I17 HydrophobicContact CB-CG1 4.34Å; N15-I17 PolarHBondContact O-N 3.43Å
18	L	97.5	Very high	95.9	Very high	38 Å²	38	66.4 Å²	66.4	20%	0.199	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.4	121	170	-177.8	70.2	0	0	0	108.6	I10 S11 L12 M20 T28 I29 L31	I10-L18 HydrophobicContact CG2-CD1 3.72Å; S11-L18 CarbonylContact O-C 3.56Å; S11-L18 WeakPolarHBondContact O-CA 3.43Å; L12-L18 HydrophobicContact CD1-CB 4.43Å; L18-M20 HydrophobicContact CD2-SD 4.47Å; L18-M20 HydrophobicContact CG-CG 4.42Å; L18-T28 CarbonylContact O-C 3.53Å; L18-T28 VanDerWaalsContact O-CA 3.3Å; L18-T28 WeakPolarHBondContact O-CA 3.34Å; L18-I29 PolarHBondContact N-O 2.93Å; L18-I29 PolarHBondContact O-N 3.42Å; L18-L31 HydrophobicContact CB-CD1 3.95Å; L18-L31 HydrophobicContact CB-CD2 4.42Å; L18-L31 HydrophobicContact CB-CG 4.02Å
19	T	97.9	Very high	96	Very high	30 Å²	30	67 Å²	67	18%	0.184	35%	0.35	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112	126.2	173.6	-57.8	0	0	0	0	109.1	I10 S11 T26 T27 T28	I10-T19 CarbonylContact C-O 3.52Å; I10-T19 WeakPolarHBondContact CA-O 3.35Å; S11-T19 PolarHBondContact N-O 3.11Å; S11-T19 PolarHBondContact O-N 2.85Å; T19-T26 HydrophobicContact CG2-CG2 3.75Å; T19-T27 CarbonylContact C-O 3.43Å; T19-T27 VanDerWaalsContact CA-O 3.31Å; T19-T27 WeakPolarHBondContact CA-O 3.29Å; T19-T28 HydrophobicContact CG2-CG2 4.28Å
20	M	97.5	Very high	96	Very high	59 Å²	59	65.7 Å²	65.7	29%	0.291	35%	0.345	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117	116	172.4	-60.2	176.6	-69.6	0	0	108.2	V8 N9 I10 L18 T27 I29	V8-M20 HydrophobicContact CG1-CB 4.38Å; N9-M20 CarbonylContact O-C 3.59Å; N9-M20 WeakPolarHBondContact O-CA 3.17Å; I10-M20 HydrophobicContact CG1-CG 4.24Å; I10-M20 HydrophobicContact CG2-CG 4.26Å; L18-M20 HydrophobicContact CD2-SD 4.47Å; L18-M20 HydrophobicContact CG-CG 4.42Å; M20-T27 HydrophobicContact CE-CG2 3.87Å; M20-T27 PolarHBondContact N-O 2.93Å; M20-T27 PolarHBondContact O-N 2.83Å; M20-I29 HydrophobicContact CE-CD1 3.99Å
21	E	96.7	Very high	95.9	Very high	85 Å²	85	67.2 Å²	67.2	40%	0.397	35%	0.353	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.9	123.7	-177.2	179.3	179	-175.1	0	0	109.6	V8 N9 C25 T26	V8-E21 CarbonylContact C-O 3.55Å; V8-E21 WeakPolarHBondContact CA-O 3.5Å; N9-E21 HydrophobicContact CB-CB 4.45Å; N9-E21 PolarHBondContact N-O 2.69Å; N9-E21 PolarHBondContact O-N 3.23Å; E21-C25 WeakPolarHBondContact CA-O 3.09Å; E21-T26 HydrophobicContact CB-CG2 4.49Å
22	N	94.2	Very high	95.6	Very high	65 Å²	65	69.3 Å²	69.3	35%	0.348	37%	0.365	S	S	.	.			trans	-113.6	-175.3	165.8	69.6	30.8	0	0	0	109.5	V8 H24 C25	V8-N22 HydrophobicContact CG2-CB 4.07Å; N22-H24 PolarHBondContact O-N 3.16Å; N22-H24 WeakPolarHBondContact OD1-CA 3.25Å; N22-H24 PolarHBondContact OD1-N 2.93Å; N22-C25 PolarHBondContact N-O 2.75Å; N22-C25 PolarHBondContact OD1-N 2.73Å; N22-C25 PolarHBondContact OD1-O 2.95Å
23	R	90.5	Very high	95.4	Very high	191 Å²	191	71.2 Å²	71.2	72%	0.721	38%	0.382	S	S	*	.	S	Bend	trans	-55.1	-24.9	179.7	-69	-171.9	179.9	-162.6	-0	114.2	R53	R23-R53 VanDerWaalsContact O-CD 3.31Å; R23-R53 WeakPolarHBondContact O-CD 3.22Å; R23-R53 PolarHBondContact O-NE 3.11Å; R23-R53 VanDerWaalsContact O-NE 3.16Å
24	H	92.1	Very high	95.5	Very high	97 Å²	97	71.3 Å²	71.3	45%	0.449	39%	0.386	S	S	.	.	S	Bend	trans	-114.6	-31.8	-169	-56.6	-57	0	0	0	113.6	N22 C52 R53	N22-H24 PolarHBondContact O-N 3.16Å; N22-H24 WeakPolarHBondContact OD1-CA 3.25Å; N22-H24 PolarHBondContact OD1-N 2.93Å; H24-C52 CarbonylContact O-C 3.52Å; H24-C52 VanDerWaalsContact O-CA 3.32Å; H24-C52 WeakPolarHBondContact O-CA 3.25Å; H24-R53 WeakPolarHBondContact O-CB 3.24Å; H24-R53 WeakPolarHBondContact O-CG 3.37Å; H24-R53 PolarHBondContact O-N 3.36Å
25	C	95.9	Very high	95.5	Very high	29 Å²	29	70.4 Å²	70.4	20%	0.196	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.5	142	-171.3	-58.1	0	0	0	0	111.4	E21 N22 L51 C52	E21-C25 WeakPolarHBondContact CA-O 3.09Å; N22-C25 PolarHBondContact N-O 2.75Å; N22-C25 PolarHBondContact OD1-N 2.73Å; N22-C25 PolarHBondContact OD1-O 2.95Å; C25-L51 CarbonylContact C-O 3.56Å; C25-L51 VanDerWaalsContact CA-O 3.29Å; C25-L51 WeakPolarHBondContact CA-O 2.97Å; C25-C52 HydrophobicContact CB-CB 4.12Å; C25-C52 WeakPolarHBondContact CB-SG 3.39Å; C25-C52 WeakPolarHBondContact SG-CB 3.41Å; C25-C52 CovalentContact SG-SG 2.05Å; C25-C52 PolarHBondContact SG-SG 3.1Å
26	T	97.5	Very high	95.7	Very high	45 Å²	45	73.3 Å²	73.3	28%	0.276	38%	0.383	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.6	120.5	165.3	-52.3	0	0	0	0	107.8	T19 E21 T28 L51	T19-T26 HydrophobicContact CG2-CG2 3.75Å; E21-T26 HydrophobicContact CB-CG2 4.49Å; T26-T28 HydrophobicContact CG2-CG2 4.49Å; T26-L51 PolarHBondContact N-O 2.84Å; T26-L51 PolarHBondContact O-N 3.22Å
27	T	97.8	Very high	95.8	Very high	33 Å²	33	74.7 Å²	74.7	20%	0.202	39%	0.39	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.8	133.9	172.7	-57.9	0	0	0	0	108.8	T19 M20 I29 T49 V50	T19-T27 CarbonylContact C-O 3.43Å; T19-T27 VanDerWaalsContact CA-O 3.31Å; T19-T27 WeakPolarHBondContact CA-O 3.29Å; M20-T27 HydrophobicContact CE-CG2 3.87Å; M20-T27 PolarHBondContact N-O 2.93Å; M20-T27 PolarHBondContact O-N 2.83Å; T27-I29 HydrophobicContact CG2-CD1 4.38Å; T27-I29 HydrophobicContact CG2-CG1 4.21Å; T27-T49 CarbonylContact C-O 3.55Å; T27-T49 VanDerWaalsContact CA-O 3.29Å; T27-T49 WeakPolarHBondContact CA-O 3.07Å; T27-V50 HydrophobicContact CG2-CG2 4.06Å
28	T	97.8	Very high	95.8	Very high	37 Å²	37	73.4 Å²	73.4	23%	0.227	38%	0.383	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.9	140	171.2	71	0	0	0	0	109.7	L18 T19 T26 G48 T49	L18-T28 CarbonylContact O-C 3.53Å; L18-T28 VanDerWaalsContact O-CA 3.3Å; L18-T28 WeakPolarHBondContact O-CA 3.34Å; T19-T28 HydrophobicContact CG2-CG2 4.28Å; T26-T28 HydrophobicContact CG2-CG2 4.49Å; T28-G48 CarbonylContact O-C 3.51Å; T28-G48 WeakPolarHBondContact O-CA 3.43Å; T28-T49 PolarHBondContact N-O 2.67Å; T28-T49 PolarHBondContact O-N 3.3Å; T28-T49 PolarHBondContact OG1-N 3.34Å; T28-T49 PolarHBondContact OG1-OG1 3.39Å
29	I	97.5	Very high	95.8	Very high	58 Å²	58	76.8 Å²	76.8	30%	0.297	40%	0.4	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.4	129	176.3	-58.4	170.7	0	0	0	107.7	L18 M20 T27 L31 R46	L18-I29 PolarHBondContact N-O 2.93Å; L18-I29 PolarHBondContact O-N 3.42Å; M20-I29 HydrophobicContact CE-CD1 3.99Å; T27-I29 HydrophobicContact CG2-CD1 4.38Å; T27-I29 HydrophobicContact CG2-CG1 4.21Å; I29-L31 HydrophobicContact CG2-CD2 4.26Å; I29-R46 HydrophobicContact CG2-CB 4.17Å
30	S	96.2	Very high	95.8	Very high	26 Å²	26	79.1 Å²	79.1	18%	0.182	42%	0.422	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.8	128	169.1	-178	0	0	0	0	110.6	T32 R46 E47	S30-T32 PolarHBondContact OG-N 2.79Å; S30-T32 PolarHBondContact OG-OG1 3.29Å; S30-R46 VanDerWaalsContact O-CB 3.25Å; S30-R46 WeakPolarHBondContact O-CB 3.46Å; S30-R46 VanDerWaalsContact O-CD 3.25Å; S30-R46 WeakPolarHBondContact O-CD 3.32Å; S30-R46 VanDerWaalsContact O-CG 3.22Å; S30-R46 WeakPolarHBondContact O-CG 3.36Å; S30-E47 PolarHBondContact N-O 3.4Å
31	L	94.6	Very high	95.9	Very high	77 Å²	77	79.2 Å²	79.2	40%	0.403	43%	0.426	S	S	.	.			trans	-102.3	32.3	170.7	-53.2	-175.6	0	0	0	111.2	L12 H16 L18 I29 S33	L12-L31 HydrophobicContact CD1-CD1 3.84Å; H16-L31 HydrophobicContact CB-CB 4.25Å; H16-L31 WeakPolarHBondContact O-CA 3.31Å; H16-L31 VanDerWaalsContact O-CB 3.24Å; H16-L31 WeakPolarHBondContact O-CB 3.3Å; H16-L31 PolarHBondContact O-N 2.05Å; L18-L31 HydrophobicContact CB-CD1 3.95Å; L18-L31 HydrophobicContact CB-CD2 4.42Å; L18-L31 HydrophobicContact CB-CG 4.02Å; I29-L31 HydrophobicContact CG2-CD2 4.26Å; L31-S33 PolarHBondContact O-N 2.78Å
32	T	91.7	Very high	95.8	Very high	84 Å²	84	83.9 Å²	83.9	52%	0.515	45%	0.448	S	S	.	.	P	Polyproline II helix	trans	-51.5	135.3	172.6	-55.6	0	0	0	0	110.3	S30 R46	S30-T32 PolarHBondContact OG-N 2.79Å; S30-T32 PolarHBondContact OG-OG1 3.29Å; T32-R46 PolarHBondContact O-NE 3.39Å; T32-R46 PolarHBondContact O-NH2 3.13Å; T32-R46 VanDerWaalsContact O-NH2 3.16Å
33	S	93.6	Very high	95.9	Very high	93 Å²	93	85 Å²	85	65%	0.65	46%	0.457	S	S	*	.	P	Polyproline II helix	trans	-52.5	142.5	177	-59	0	0	0	0	111.3	L31	L31-S33 PolarHBondContact O-N 2.78Å
34	P	95.2	Very high	96	Very high	70 Å²	70	78 Å²	78	46%	0.455	44%	0.444	S	S	.	.	P	Polyproline II helix	trans	-64.9	143.9	178.2	29.2	-34.9	0	0	0	111.8	E38 I39 R46	P34-E38 WeakPolarHBondContact CA-OE2 3.39Å; P34-E38 HydrophobicContact CB-CB 3.97Å; P34-I39 HydrophobicContact CB-CG1 3.98Å; P34-I39 HydrophobicContact CG-CD1 4.33Å; P34-I39 HydrophobicContact CG-CG1 3.91Å; P34-R46 VanDerWaalsContact CA-NH2 3.26Å
35	N	95.3	Very high	96.1	Very high	89 Å²	89	83.5 Å²	83.5	48%	0.476	46%	0.462	S	S	.	.	P	Polyproline II helix	trans	-81.8	170.9	171.6	69.8	47.4	0	0	0	111.1	Q37 E38 I39	N35-Q37 VanDerWaalsContact C-N 3.27Å; N35-Q37 PolarHBondContact O-N 2.86Å; N35-Q37 WeakPolarHBondContact OD1-CA 3.39Å; N35-Q37 WeakPolarHBondContact OD1-CB 3.45Å; N35-Q37 PolarHBondContact OD1-N 2.82Å; N35-E38 PolarHBondContact N-OE2 3.31Å; N35-E38 PolarHBondContact O-N 2.83Å; N35-E38 VanDerWaalsContact O-N 3.11Å; N35-E38 PolarHBondContact OD1-N 2.85Å; N35-I39 WeakPolarHBondContact O-CG1 3.29Å; N35-I39 PolarHBondContact O-N 3.13Å
36	E	97.6	Very high	96	Very high	173 Å²	173	86.2 Å²	86.2	81%	0.808	47%	0.469	S	S	*	.	H	α-helix	trans	-56.9	-38.3	-177.4	-65.4	-178.6	177	0	0	113.3	I39 A40	E36-I39 PolarHBondContact O-N 3.48Å; E36-A40 WeakPolarHBondContact O-CB 3.46Å; E36-A40 PolarHBondContact O-N 2.94Å
37	Q	97.2	Very high	95.8	Very high	132 Å²	132	92 Å²	92	62%	0.617	49%	0.493	S	S	*	.	H	α-helix	trans	-65.9	-43.9	177.6	-176.6	62.9	36.4	0	0	111.1	N35 I39 A40 T41	N35-Q37 VanDerWaalsContact C-N 3.27Å; N35-Q37 PolarHBondContact O-N 2.86Å; N35-Q37 WeakPolarHBondContact OD1-CA 3.39Å; N35-Q37 WeakPolarHBondContact OD1-CB 3.45Å; N35-Q37 PolarHBondContact OD1-N 2.82Å; Q37-I39 VanDerWaalsContact C-N 3.33Å; Q37-I39 PolarHBondContact O-N 2.87Å; Q37-A40 PolarHBondContact O-N 2.77Å; Q37-T41 WeakPolarHBondContact O-CG2 3.32Å; Q37-T41 PolarHBondContact O-N 2.74Å; Q37-T41 PolarHBondContact O-OG1 3.46Å; Q37-T41 VanDerWaalsContact O-OG1 3.13Å
38	E	97.9	Very high	95.8	Very high	31 Å²	31	92.5 Å²	92.5	15%	0.145	50%	0.504	C	S	.	.	H	α-helix	trans	-65.4	-37.1	178	-65.6	-175.2	135	0	0	112.2	P34 N35 Q42 T43 G44 Y45 R46	P34-E38 WeakPolarHBondContact CA-OE2 3.39Å; P34-E38 HydrophobicContact CB-CB 3.97Å; N35-E38 PolarHBondContact N-OE2 3.31Å; N35-E38 PolarHBondContact O-N 2.83Å; N35-E38 VanDerWaalsContact O-N 3.11Å; N35-E38 PolarHBondContact OD1-N 2.85Å; E38-Q42 VanDerWaalsContact O-CA 3.3Å; E38-Q42 WeakPolarHBondContact O-CA 3.44Å; E38-Q42 PolarHBondContact O-N 2.82Å; E38-T43 VanDerWaalsContact CA-O 3.24Å; E38-T43 WeakPolarHBondContact CA-O 3.44Å; E38-T43 WeakPolarHBondContact CB-O 3.43Å; E38-T43 WeakPolarHBondContact CG-O 3.39Å; E38-T43 PolarHBondContact O-N 2.89Å; E38-G44 WeakPolarHBondContact OE1-CA 3.33Å; E38-Y45 PolarHBondContact OE1-N 3.49Å; E38-R46 VanDerWaalsContact CD-NH1 3.26Å; E38-R46 IonicContact OE1-CZ 3.72Å; E38-R46 IonicContact OE1-NH1 2.69Å; E38-R46 PolarHBondContact OE1-NH1 3.14Å; E38-R46 IonicContact OE1-NH2 3.88Å; E38-R46 IonicContact OE2-CZ 3.41Å; E38-R46 IonicContact OE2-NH1 3.11Å; E38-R46 PolarHBondContact OE2-NH1 2.94Å; E38-R46 VanDerWaalsContact OE2-NH1 3.11Å; E38-R46 IonicContact OE2-NH2 2.85Å; E38-R46 PolarHBondContact OE2-NH2 3.31Å
39	I	97.9	Very high	95.8	Very high	109 Å²	109	94.1 Å²	94.1	56%	0.559	51%	0.514	S	S	*	.	H	α-helix	trans	-64.2	-46.1	173.9	-65.9	167.5	0	0	0	109.9	P34 N35 E36 Q37 T41 Q42	P34-I39 HydrophobicContact CB-CG1 3.98Å; P34-I39 HydrophobicContact CG-CD1 4.33Å; P34-I39 HydrophobicContact CG-CG1 3.91Å; N35-I39 WeakPolarHBondContact O-CG1 3.29Å; N35-I39 PolarHBondContact O-N 3.13Å; E36-I39 PolarHBondContact O-N 3.48Å; Q37-I39 VanDerWaalsContact C-N 3.33Å; Q37-I39 PolarHBondContact O-N 2.87Å; I39-T41 PolarHBondContact O-N 2.82Å; I39-Q42 PolarHBondContact O-N 2.78Å
40	A	97.9	Very high	95.8	Very high	78 Å²	78	96 Å²	96	65%	0.645	53%	0.528	S	S	*	.	H	α-helix	trans	-65.4	-37.8	-177.8	0	0	0	0	0	112.9	E36 Q37	E36-A40 WeakPolarHBondContact O-CB 3.46Å; E36-A40 PolarHBondContact O-N 2.94Å; Q37-A40 PolarHBondContact O-N 2.77Å
41	T	98	Very high	95.8	Very high	62 Å²	62	100.6 Å²	100.6	38%	0.38	55%	0.55	S	S	.	.	H	α-helix	trans	-91.3	-10.7	179.7	62.9	0	0	0	0	113.8	Q37 I39 T43	Q37-T41 WeakPolarHBondContact O-CG2 3.32Å; Q37-T41 PolarHBondContact O-N 2.74Å; Q37-T41 PolarHBondContact O-OG1 3.46Å; Q37-T41 VanDerWaalsContact O-OG1 3.13Å; I39-T41 PolarHBondContact O-N 2.82Å; T41-T43 WeakPolarHBondContact CB-OG1 3.38Å; T41-T43 PolarHBondContact O-N 3.01Å; T41-T43 PolarHBondContact OG1-N 2.93Å; T41-T43 PolarHBondContact OG1-O 2.81Å; T41-T43 PolarHBondContact OG1-OG1 3.04Å
42	Q	95.9	Very high	95.8	Very high	182 Å²	182	100.5 Å²	100.5	85%	0.85	56%	0.555	S	S	*	*	T	Hydrogen-bonded Turn	trans	55.9	28.9	-169.7	-55	-174.9	-17.4	0	0	113.2	E38 I39	E38-Q42 VanDerWaalsContact O-CA 3.3Å; E38-Q42 WeakPolarHBondContact O-CA 3.44Å; E38-Q42 PolarHBondContact O-N 2.82Å; I39-Q42 PolarHBondContact O-N 2.78Å
43	T	95.1	Very high	95.8	Very high	89 Å²	89	102.4 Å²	102.4	55%	0.546	55%	0.552	S	S	.	*			trans	-135.7	143.2	179.6	63.8	0	0	0	0	109.8	E38 T41	E38-T43 VanDerWaalsContact CA-O 3.24Å; E38-T43 WeakPolarHBondContact CA-O 3.44Å; E38-T43 WeakPolarHBondContact CB-O 3.43Å; E38-T43 WeakPolarHBondContact CG-O 3.39Å; E38-T43 PolarHBondContact O-N 2.89Å; T41-T43 WeakPolarHBondContact CB-OG1 3.38Å; T41-T43 PolarHBondContact O-N 3.01Å; T41-T43 PolarHBondContact OG1-N 2.93Å; T41-T43 PolarHBondContact OG1-O 2.81Å; T41-T43 PolarHBondContact OG1-OG1 3.04Å
44	G	93.5	Very high	95.7	Very high	43 Å²	43	101.3 Å²	101.3	44%	0.443	54%	0.544	S	S	.	.			trans	-162.1	162.5	175.8	0	0	0	0	0	111.2	E38	E38-G44 WeakPolarHBondContact OE1-CA 3.33Å
45	Y	93.7	Very high	95.1	Very high	213 Å²	213	105 Å²	105	84%	0.835	56%	0.556	S	S	*	*			trans	-120.1	145.8	174.2	-64.5	-84.8	0	0	0	108.8	E38	E38-Y45 PolarHBondContact OE1-N 3.49Å
46	R	94.6	Very high	94.4	Very high	87 Å²	87	107.6 Å²	107.6	33%	0.328	57%	0.569	S	S	.	*			trans	-122.5	132.8	175.7	-65.1	-64	174.7	-89.2	7.7	108.4	I29 S30 T32 P34 E38	I29-R46 HydrophobicContact CG2-CB 4.17Å; S30-R46 VanDerWaalsContact O-CB 3.25Å; S30-R46 WeakPolarHBondContact O-CB 3.46Å; S30-R46 VanDerWaalsContact O-CD 3.25Å; S30-R46 WeakPolarHBondContact O-CD 3.32Å; S30-R46 VanDerWaalsContact O-CG 3.22Å; S30-R46 WeakPolarHBondContact O-CG 3.36Å; T32-R46 PolarHBondContact O-NE 3.39Å; T32-R46 PolarHBondContact O-NH2 3.13Å; T32-R46 VanDerWaalsContact O-NH2 3.16Å; P34-R46 VanDerWaalsContact CA-NH2 3.26Å; E38-R46 VanDerWaalsContact CD-NH1 3.26Å; E38-R46 IonicContact OE1-CZ 3.72Å; E38-R46 IonicContact OE1-NH1 2.69Å; E38-R46 PolarHBondContact OE1-NH1 3.14Å; E38-R46 IonicContact OE1-NH2 3.88Å; E38-R46 IonicContact OE2-CZ 3.41Å; E38-R46 IonicContact OE2-NH1 3.11Å; E38-R46 PolarHBondContact OE2-NH1 2.94Å; E38-R46 VanDerWaalsContact OE2-NH1 3.11Å; E38-R46 IonicContact OE2-NH2 2.85Å; E38-R46 PolarHBondContact OE2-NH2 3.31Å
47	E	93.9	Very high	93.4	Very high	167 Å²	167	101.1 Å²	101.1	78%	0.78	54%	0.542	S	S	*	.			trans	-62.5	141.4	170.8	-70	-63.4	154.4	0	0	109.6	S30	S30-E47 PolarHBondContact N-O 3.4Å
48	G	96.4	Very high	92	Very high	43 Å²	43	99.6 Å²	99.6	44%	0.443	53%	0.532	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-161.5	160.9	179.1	0	0	0	0	0	111.5	T28	T28-G48 CarbonylContact O-C 3.51Å; T28-G48 WeakPolarHBondContact O-CA 3.43Å
49	T	97.7	Very high	90.5	Very high	70 Å²	70	107 Å²	107	43%	0.429	56%	0.558	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-129.9	148.8	176.5	65.4	0	0	0	0	110.2	T27 T28	T27-T49 CarbonylContact C-O 3.55Å; T27-T49 VanDerWaalsContact CA-O 3.29Å; T27-T49 WeakPolarHBondContact CA-O 3.07Å; T28-T49 PolarHBondContact N-O 2.67Å; T28-T49 PolarHBondContact O-N 3.3Å; T28-T49 PolarHBondContact OG1-N 3.34Å; T28-T49 PolarHBondContact OG1-OG1 3.39Å
50	V	97.5	Very high	89.1	Confident	97 Å²	97	105.2 Å²	105.2	59%	0.588	56%	0.556	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-124.5	115.9	168.7	-179.7	0	0	0	0	106.9	T27	T27-V50 HydrophobicContact CG2-CG2 4.06Å
51	L	96.7	Very high	87.4	Confident	123 Å²	123	105.9 Å²	105.9	64%	0.644	55%	0.546	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-115.4	108.3	176.3	-65	177.5	0	0	0	108.1	C25 T26	C25-L51 CarbonylContact C-O 3.56Å; C25-L51 VanDerWaalsContact CA-O 3.29Å; C25-L51 WeakPolarHBondContact CA-O 2.97Å; T26-L51 PolarHBondContact N-O 2.84Å; T26-L51 PolarHBondContact O-N 3.22Å
52	C	95.4	Very high	85.7	Confident	75 Å²	75	106.5 Å²	106.5	51%	0.507	54%	0.544	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.3	143.4	177	-66.1	0	0	0	0	111.2	H24 C25	H24-C52 CarbonylContact O-C 3.52Å; H24-C52 VanDerWaalsContact O-CA 3.32Å; H24-C52 WeakPolarHBondContact O-CA 3.25Å; C25-C52 HydrophobicContact CB-CB 4.12Å; C25-C52 WeakPolarHBondContact CB-SG 3.39Å; C25-C52 WeakPolarHBondContact SG-CB 3.41Å; C25-C52 CovalentContact SG-SG 2.05Å; C25-C52 PolarHBondContact SG-SG 3.1Å
53	R	91.3	Very high	84.4	Confident	125 Å²	125	101 Å²	101	47%	0.472	53%	0.529	S	S	.	.			trans	-58.7	137	171.8	-72.8	-173	-176.6	-140.9	0	110.1	R23 H24 S57	R23-R53 VanDerWaalsContact O-CD 3.31Å; R23-R53 WeakPolarHBondContact O-CD 3.22Å; R23-R53 PolarHBondContact O-NE 3.11Å; R23-R53 VanDerWaalsContact O-NE 3.16Å; H24-R53 WeakPolarHBondContact O-CB 3.24Å; H24-R53 WeakPolarHBondContact O-CG 3.37Å; H24-R53 PolarHBondContact O-N 3.36Å; R53-S57 WeakPolarHBondContact CB-OG 3.31Å
54	S	90.9	Very high	83.2	Confident	69 Å²	69	101.9 Å²	101.9	48%	0.483	54%	0.535	S	S	.	.			trans	-75.6	155.7	174.2	73.9	0	0	0	0	110.8	L56 S57 Y58	S54-L56 PolarHBondContact O-N 3.16Å; S54-L56 VanDerWaalsContact O-N 3.13Å; S54-S57 PolarHBondContact N-OG 3.21Å; S54-S57 PolarHBondContact O-N 2.82Å; S54-S57 PolarHBondContact O-OG 3.46Å; S54-Y58 PolarHBondContact O-N 2.8Å
55	Q	82.7	Confident	81.9	Confident	148 Å²	148	107 Å²	107	69%	0.692	55%	0.547	S	S	*	.	H	α-helix	trans	-56.4	-28.7	175.2	-67.8	-67.8	-20.5	0	0	113.2	Y58 R59	Q55-Y58 WeakPolarHBondContact O-CB 3.38Å; Q55-Y58 PolarHBondContact O-N 2.89Å; Q55-R59 PolarHBondContact O-N 3.08Å
56	L	81.7	Confident	80.5	Confident	144 Å²	144	104.7 Å²	104.7	75%	0.754	54%	0.544	S	S	*	.	H	α-helix	trans	-65.4	-41.7	176.5	-67.2	170.3	0	0	0	111.6	S54 Y58 R59	S54-L56 PolarHBondContact O-N 3.16Å; S54-L56 VanDerWaalsContact O-N 3.13Å; L56-Y58 PolarHBondContact O-N 2.73Å; L56-R59 PolarHBondContact O-N 2.76Å
57	S	75.5	Confident	78.7	Confident	36 Å²	36	110.6 Å²	110.6	25%	0.252	58%	0.582	S	S	.	*	H	α-helix	trans	-69.7	-22	176.8	68	0	0	0	0	113.5	R53 S54 S60	R53-S57 WeakPolarHBondContact CB-OG 3.31Å; S54-S57 PolarHBondContact N-OG 3.21Å; S54-S57 PolarHBondContact O-N 2.82Å; S54-S57 PolarHBondContact O-OG 3.46Å; S57-S60 PolarHBondContact O-OG 3.35Å
58	Y	68.6	Low	77.9	Confident	100 Å²	100	107.8 Å²	107.8	39%	0.392	57%	0.572	S	S	.	*	H	α-helix	trans	-69.6	-47.8	176	-176.7	-102.1	0	0	0	111.4	S54 Q55 L56 S60 Q61 Q62	S54-Y58 PolarHBondContact O-N 2.8Å; Q55-Y58 WeakPolarHBondContact O-CB 3.38Å; Q55-Y58 PolarHBondContact O-N 2.89Å; L56-Y58 PolarHBondContact O-N 2.73Å; Y58-S60 VanDerWaalsContact C-N 3.31Å; Y58-S60 PolarHBondContact O-N 2.94Å; Y58-Q61 PolarHBondContact O-N 3.41Å; Y58-Q62 HydrophobicContact CD1-CG 4.49Å; Y58-Q62 HydrophobicContact CE1-CG 4.14Å; Y58-Q62 PolarHBondContact O-N 3.29Å; Y58-Q62 PolarHBondContact OH-NE2 3.19Å; Y58-Q62 VanDerWaalsContact OH-NE2 3.1Å
59	R	66.6	Low	77	Confident	187 Å²	187	111.2 Å²	111.2	71%	0.706	58%	0.579	S	S	*	*	H	α-helix	trans	-62.8	-35.9	-178.8	-69.3	-174.8	178.5	-173.2	-1.5	113.1	Q55 L56 Q61 A63	Q55-R59 PolarHBondContact O-N 3.08Å; L56-R59 PolarHBondContact O-N 2.76Å; R59-Q61 VanDerWaalsContact C-N 3.29Å; R59-Q61 PolarHBondContact O-N 2.95Å; R59-A63 PolarHBondContact O-N 2.89Å
60	S	68.1	Low	75.8	Confident	71 Å²	71	113.4 Å²	113.4	50%	0.497	59%	0.587	S	S	.	*	H	α-helix	trans	-67.8	-26.1	178.8	52.8	0	0	0	0	113.7	S57 Y58 V64	S57-S60 PolarHBondContact O-OG 3.35Å; Y58-S60 VanDerWaalsContact C-N 3.31Å; Y58-S60 PolarHBondContact O-N 2.94Å; S60-V64 VanDerWaalsContact O-CG2 3.32Å; S60-V64 WeakPolarHBondContact O-CG2 3.32Å
61	Q	61.2	Low	74.5	Confident	93 Å²	93	114.4 Å²	114.4	44%	0.435	59%	0.587	S	S	.	*	H	α-helix	trans	-85	-38.7	177.7	-70	-167	-41	0	0	112.4	Y58 R59 A63 V64 E65	Y58-Q61 PolarHBondContact O-N 3.41Å; R59-Q61 VanDerWaalsContact C-N 3.29Å; R59-Q61 PolarHBondContact O-N 2.95Å; Q61-A63 VanDerWaalsContact C-N 3.26Å; Q61-A63 PolarHBondContact O-N 3.1Å; Q61-V64 PolarHBondContact O-N 3.19Å; Q61-E65 PolarHBondContact O-N 3.24Å
62	Q	62.6	Low	73.1	Confident	75 Å²	75	113.9 Å²	113.9	35%	0.35	58%	0.583	S	S	.	*	H	α-helix	trans	-59.3	-40.6	173.8	-67.2	-172.4	-55.9	0	0	111.4	Y58 V64 E65 E66	Y58-Q62 HydrophobicContact CD1-CG 4.49Å; Y58-Q62 HydrophobicContact CE1-CG 4.14Å; Y58-Q62 PolarHBondContact O-N 3.29Å; Y58-Q62 PolarHBondContact OH-NE2 3.19Å; Y58-Q62 VanDerWaalsContact OH-NE2 3.1Å; Q62-V64 PolarHBondContact O-N 3Å; Q62-E65 PolarHBondContact O-N 3.01Å; Q62-E66 WeakPolarHBondContact O-CG 3.41Å; Q62-E66 PolarHBondContact O-N 3.37Å; Q62-E66 VanDerWaalsContact O-N 3.1Å
63	A	69	Low	71.7	Confident	65 Å²	65	116.5 Å²	116.5	54%	0.537	59%	0.588	S	S	.	*	H	α-helix	trans	-64.5	-21.4	175.5	0	0	0	0	0	114.1	R59 Q61	R59-A63 PolarHBondContact O-N 2.89Å; Q61-A63 VanDerWaalsContact C-N 3.26Å; Q61-A63 PolarHBondContact O-N 3.1Å
64	V	70.5	Confident	70.3	Confident	109 Å²	109	115.9 Å²	115.9	66%	0.661	60%	0.597	S	S	*	*	H	α-helix	trans	-90.9	-25.6	175.9	174.5	0	0	0	0	111.5	S60 Q61 Q62	S60-V64 VanDerWaalsContact O-CG2 3.32Å; S60-V64 WeakPolarHBondContact O-CG2 3.32Å; Q61-V64 PolarHBondContact O-N 3.19Å; Q62-V64 PolarHBondContact O-N 3Å
65	E	65.5	Low	68.7	Low	149 Å²	149	119.5 Å²	119.5	70%	0.696	61%	0.605	S	S	*	*	H	α-helix	trans	-82.2	-17.1	175.8	-71.6	179.6	174.3	0	0	113	Q61 Q62	Q61-E65 PolarHBondContact O-N 3.24Å; Q62-E65 PolarHBondContact O-N 3.01Å
66	E	65.1	Low	67.5	Low	166 Å²	166	117.1 Å²	117.1	78%	0.776	60%	0.598	S	S	*	*			trans	-91.9	-3.9	-179.5	-73.7	179.1	179.2	0	0	115	Q62	Q62-E66 WeakPolarHBondContact O-CG 3.41Å; Q62-E66 PolarHBondContact O-N 3.37Å; Q62-E66 VanDerWaalsContact O-N 3.1Å
67	D	55.7	Low	66.2	Low	210 Å²	210	114.6 Å²	114.6	100%	1.123	58%	0.584	S	S	*	*			trans	-113	0	-180	-147.7	28.1	0	0	0	111.2

Retrieved 67 of 67 residues in 14.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).