G4VGM1_SCHMA Loading...

Putative galectin

AlphaFold DB , UniProt , Accession G4VGM1, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 39 aa.

						>G4VGM1_SCHMA|G4VGM1
MQIGQFDNEVKELEQFSHDKPWSDSEATENLTLTASVNV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48	Very low	60.4	Low	224 Å²	224	121.5 Å²	121.5	100%	1.103	62%	0.617	S	S	*	*				0	108.5	0	-154.5	175.9	-75.2	0	106.3
2	Q	49.9	Very low	61.1	Low	161 Å²	161	120.5 Å²	120.5	75%	0.752	61%	0.609	S	S	*	*			trans	-90.6	105.7	-170.2	-167.1	170.3	1.7	0	108.5	G4	Q2-G4 PolarHBondContact O-N 2.68Å
3	I	60.3	Low	61.6	Low	128 Å²	128	120.2 Å²	120.2	66%	0.656	61%	0.609	S	S	*	*	G	3₁₀ helix	trans	-67.2	-19.4	-171.4	-57.3	167.8	0	0	111.9	Q5 F6	I3-Q5 VanDerWaalsContact C-N 3.34Å; I3-Q5 PolarHBondContact O-N 3.3Å; I3-F6 PolarHBondContact O-N 3.02Å
4	G	59.5	Low	61.9	Low	52 Å²	52	119.9 Å²	119.9	54%	0.536	60%	0.604	S	S	.	*	G	3₁₀ helix	trans	-71.7	-12.8	-176.4	0	0	0	0	117	Q2	Q2-G4 PolarHBondContact O-N 2.68Å
5	Q	56.2	Low	62.1	Low	139 Å²	139	120 Å²	120	65%	0.65	60%	0.602	S	S	*	*	G	3₁₀ helix	trans	-80	-33.4	172.1	-91.6	-177.7	-40.6	0	112.1	I3 D7 N8 E9	I3-Q5 VanDerWaalsContact C-N 3.34Å; I3-Q5 PolarHBondContact O-N 3.3Å; Q5-D7 VanDerWaalsContact C-N 3.34Å; Q5-D7 PolarHBondContact O-N 3.13Å; Q5-N8 PolarHBondContact O-N 3.36Å; Q5-E9 PolarHBondContact O-N 3.19Å
6	F	59.4	Low	62.2	Low	127 Å²	127	121.8 Å²	121.8	56%	0.557	61%	0.605	S	S	*	*	H	α-helix	trans	-65.7	-38.1	178.7	-80.1	-82	0	0	111.8	I3 N8 E9 V10	I3-F6 PolarHBondContact O-N 3.02Å; F6-N8 PolarHBondContact O-N 3.05Å; F6-E9 PolarHBondContact O-N 2.73Å; F6-V10 VanDerWaalsContact O-CG2 3.3Å; F6-V10 WeakPolarHBondContact O-CG2 3.34Å; F6-V10 PolarHBondContact O-N 3.26Å
7	D	61.1	Low	62.2	Low	96 Å²	96	118 Å²	118	51%	0.513	59%	0.593	S	S	.	*	H	α-helix	trans	-64.1	-27.4	179.4	-65.3	-34.2	0	0	112.8	Q5 K11	Q5-D7 VanDerWaalsContact C-N 3.34Å; Q5-D7 PolarHBondContact O-N 3.13Å; D7-K11 VanDerWaalsContact O-CG 3.27Å; D7-K11 WeakPolarHBondContact O-CG 3.5Å; D7-K11 PolarHBondContact O-N 3.34Å
8	N	65.4	Low	62.2	Low	88 Å²	88	119.7 Å²	119.7	47%	0.471	60%	0.598	S	S	.	*	H	α-helix	trans	-77.9	-44.2	177.2	-166.3	67	0	0	111.4	Q5 F6 V10 K11 E12	Q5-N8 PolarHBondContact O-N 3.36Å; F6-N8 PolarHBondContact O-N 3.05Å; N8-V10 VanDerWaalsContact C-N 3.33Å; N8-V10 PolarHBondContact O-N 3.35Å; N8-K11 PolarHBondContact O-N 2.93Å; N8-E12 PolarHBondContact O-N 3.5Å; N8-E12 PolarHBondContact ND2-OE1 2.95Å; N8-E12 WeakPolarHBondContact O-CG 3.48Å
9	E	63.8	Low	62.4	Low	108 Å²	108	120.2 Å²	120.2	51%	0.505	60%	0.603	S	S	.	*	H	α-helix	trans	-62.9	-39.7	176.9	-67.4	177.1	-177.4	0	111.7	Q5 F6 E12 L13	Q5-E9 PolarHBondContact O-N 3.19Å; F6-E9 PolarHBondContact O-N 2.73Å; E9-E12 PolarHBondContact O-N 3.42Å; E9-L13 WeakPolarHBondContact O-CB 3.27Å; E9-L13 WeakPolarHBondContact O-CD1 3.37Å; E9-L13 VanDerWaalsContact O-CG 3.25Å; E9-L13 WeakPolarHBondContact O-CG 3.45Å; E9-L13 PolarHBondContact O-N 3.45Å
10	V	70.6	Confident	62.4	Low	71 Å²	71	120.2 Å²	120.2	43%	0.43	60%	0.599	S	S	.	*	H	α-helix	trans	-64	-41.7	175.9	173	0	0	0	111.2	F6 N8 L13 E14	F6-V10 VanDerWaalsContact O-CG2 3.3Å; F6-V10 WeakPolarHBondContact O-CG2 3.34Å; F6-V10 PolarHBondContact O-N 3.26Å; N8-V10 VanDerWaalsContact C-N 3.33Å; N8-V10 PolarHBondContact O-N 3.35Å; V10-L13 PolarHBondContact O-N 3.02Å; V10-E14 WeakPolarHBondContact O-CB 3.42Å; V10-E14 PolarHBondContact O-N 2.83Å; V10-E14 WeakPolarHBondContact O-CG 3.43Å; V10-E14 HydrophobicContact CG1-CG 4.38Å
11	K	70.5	Confident	62.5	Low	142 Å²	142	118.9 Å²	118.9	62%	0.617	60%	0.599	S	S	*	*	H	α-helix	trans	-64	-41.1	176.7	-77.1	174.1	-176.2	178	112.7	D7 N8 L13 E14 Q15	D7-K11 VanDerWaalsContact O-CG 3.27Å; D7-K11 WeakPolarHBondContact O-CG 3.5Å; D7-K11 PolarHBondContact O-N 3.34Å; N8-K11 PolarHBondContact O-N 2.93Å; K11-L13 VanDerWaalsContact C-N 3.32Å; K11-E14 PolarHBondContact O-N 3.24Å; K11-Q15 WeakPolarHBondContact O-CB 3.47Å; K11-Q15 PolarHBondContact O-N 3.34Å
12	E	68.5	Low	63.3	Low	110 Å²	110	117.5 Å²	117.5	51%	0.514	58%	0.582	S	S	.	*	H	α-helix	trans	-65.1	-38.8	176.6	-71.1	175.6	-168.6	0	111.2	N8 E9 Q15 F16	N8-E12 PolarHBondContact O-N 3.5Å; N8-E12 PolarHBondContact ND2-OE1 2.95Å; N8-E12 WeakPolarHBondContact O-CG 3.48Å; E9-E12 PolarHBondContact O-N 3.42Å; E12-Q15 PolarHBondContact O-N 3.3Å; E12-F16 WeakPolarHBondContact O-CB 3.25Å; E12-F16 PolarHBondContact O-N 3.38Å
13	L	67.4	Low	63.9	Low	117 Å²	117	112.8 Å²	112.8	61%	0.613	57%	0.567	S	S	*	*	H	α-helix	trans	-68.9	-41.4	175.4	-73.7	166	0	0	112.6	E9 V10 K11 Q15 F16 S17	E9-L13 WeakPolarHBondContact O-CB 3.27Å; E9-L13 WeakPolarHBondContact O-CD1 3.37Å; E9-L13 VanDerWaalsContact O-CG 3.25Å; E9-L13 WeakPolarHBondContact O-CG 3.45Å; E9-L13 PolarHBondContact O-N 3.45Å; V10-L13 PolarHBondContact O-N 3.02Å; K11-L13 VanDerWaalsContact C-N 3.32Å; L13-Q15 PolarHBondContact O-N 3.34Å; L13-Q15 VanDerWaalsContact C-N 3.32Å; L13-F16 PolarHBondContact O-N 3.03Å; L13-S17 PolarHBondContact O-N 3.31Å; L13-S17 WeakPolarHBondContact O-CB 3.42Å
14	E	66.6	Low	64	Low	115 Å²	115	112.4 Å²	112.4	54%	0.537	57%	0.566	S	S	.	*	H	α-helix	trans	-59.8	-45.1	172.9	-76	-176.7	165.1	0	110.1	V10 K11 S17 H18	V10-E14 WeakPolarHBondContact O-CB 3.42Å; V10-E14 PolarHBondContact O-N 2.83Å; V10-E14 WeakPolarHBondContact O-CG 3.43Å; V10-E14 HydrophobicContact CG1-CG 4.38Å; K11-E14 PolarHBondContact O-N 3.24Å; E14-S17 PolarHBondContact O-N 3.34Å; E14-H18 PolarHBondContact O-N 3.26Å; E14-H18 PolarHBondContact O-ND1 3.29Å
15	Q	64.9	Low	64	Low	122 Å²	122	115 Å²	115	57%	0.57	58%	0.576	S	S	*	*	H	α-helix	trans	-62.4	-44	176.5	-172.2	170.3	30.6	0	112.4	K11 E12 L13 S17 H18 D19	K11-Q15 WeakPolarHBondContact O-CB 3.47Å; K11-Q15 PolarHBondContact O-N 3.34Å; E12-Q15 PolarHBondContact O-N 3.3Å; L13-Q15 PolarHBondContact O-N 3.34Å; L13-Q15 VanDerWaalsContact C-N 3.32Å; Q15-S17 VanDerWaalsContact C-N 3.3Å; Q15-S17 PolarHBondContact O-N 2.96Å; Q15-H18 PolarHBondContact O-N 2.82Å; Q15-H18 VanDerWaalsContact O-N 3.13Å; Q15-D19 PolarHBondContact O-N 3.5Å
16	F	63.6	Low	64.1	Low	148 Å²	148	114.8 Å²	114.8	65%	0.649	58%	0.575	S	S	*	*	H	α-helix	trans	-61.4	-37	178.1	-171.6	-96.5	0	0	112.8	E12 L13 H18 K20	E12-F16 WeakPolarHBondContact O-CB 3.25Å; E12-F16 PolarHBondContact O-N 3.38Å; L13-F16 PolarHBondContact O-N 3.03Å; F16-H18 VanDerWaalsContact C-N 3.34Å; F16-K20 PolarHBondContact O-N 3.45Å
17	S	62.3	Low	64.2	Low	58 Å²	58	112.3 Å²	112.3	41%	0.406	58%	0.578	S	S	.	*	H	α-helix	trans	-67.5	-30.9	176.1	-169.6	0	0	0	113	L13 E14 Q15	L13-S17 PolarHBondContact O-N 3.31Å; L13-S17 WeakPolarHBondContact O-CB 3.42Å; E14-S17 PolarHBondContact O-N 3.34Å; Q15-S17 VanDerWaalsContact C-N 3.3Å; Q15-S17 PolarHBondContact O-N 2.96Å
18	H	61.5	Low	64.1	Low	149 Å²	149	112.8 Å²	112.8	69%	0.69	58%	0.584	S	S	*	*	H	α-helix	trans	-82.1	-35.7	177.8	-67	105.6	0	0	113.1	E14 Q15 F16	E14-H18 PolarHBondContact O-N 3.26Å; E14-H18 PolarHBondContact O-ND1 3.29Å; Q15-H18 PolarHBondContact O-N 2.82Å; Q15-H18 VanDerWaalsContact O-N 3.13Å; F16-H18 VanDerWaalsContact C-N 3.34Å
19	D	65.7	Low	64.1	Low	128 Å²	128	117 Å²	117	68%	0.684	60%	0.601	S	S	*	*	H	α-helix	trans	-74.2	-28.8	-178	-76.2	-28.8	0	0	112.7	Q15	Q15-D19 PolarHBondContact O-N 3.5Å
20	K	62.5	Low	64.4	Low	121 Å²	121	118.5 Å²	118.5	53%	0.526	61%	0.613	S	S	.	*	S	Bend	trans	-126.1	89.3	174.5	-165.4	171.1	-179	175.5	108.3	F16 W22 E26	F16-K20 PolarHBondContact O-N 3.45Å; K20-W22 PolarHBondContact O-N 2.88Å; K20-E26 IonicContact NZ-OE2 3.34Å; K20-E26 PolarHBondContact NZ-OE2 3.28Å
21	P	65.3	Low	64.5	Low	93 Å²	93	122.1 Å²	122.1	60%	0.604	63%	0.629	S	S	*	*			trans	-50.3	133.2	168	21.7	-31.7	0	0	106.8	S23	P21-S23 VanDerWaalsContact C-N 3.28Å; P21-S23 PolarHBondContact O-N 3.1Å
22	W	65.1	Low	64.7	Low	195 Å²	195	120.7 Å²	120.7	74%	0.739	63%	0.632	S	S	*	*			trans	-54	104.3	173	57.7	86.3	0	0	105.9	K20 D24	K20-W22 PolarHBondContact O-N 2.88Å; W22-D24 PolarHBondContact O-N 3.43Å
23	S	62.4	Low	65.1	Low	62 Å²	62	122.5 Å²	122.5	43%	0.434	65%	0.645	S	S	.	*			trans	-75.3	106.2	175.3	-165.9	0	0	0	103.1	P21 S25 E26 A27	P21-S23 VanDerWaalsContact C-N 3.28Å; P21-S23 PolarHBondContact O-N 3.1Å; S23-S25 PolarHBondContact O-N 2.97Å; S23-S25 WeakPolarHBondContact OG-CB 3.3Å; S23-E26 PolarHBondContact O-N 3.47Å; S23-A27 PolarHBondContact O-N 3.23Å
24	D	61.5	Low	65.7	Low	120 Å²	120	122.5 Å²	122.5	64%	0.642	65%	0.65	S	S	*	*	T	Hydrogen-bonded Turn	trans	-49.5	-21	170.4	-74.1	-22.9	0	0	111	W22 E26 A27	W22-D24 PolarHBondContact O-N 3.43Å; D24-E26 VanDerWaalsContact C-N 3.35Å; D24-E26 PolarHBondContact O-N 2.86Å; D24-A27 PolarHBondContact O-N 3.45Å
25	S	59.6	Low	66.2	Low	106 Å²	106	121.5 Å²	121.5	74%	0.741	66%	0.661	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.7	-23.4	173.8	-160.4	0	0	0	115.5	S23	S23-S25 PolarHBondContact O-N 2.97Å; S23-S25 WeakPolarHBondContact OG-CB 3.3Å
26	E	58.7	Low	66.7	Low	134 Å²	134	121.1 Å²	121.1	63%	0.626	67%	0.672	S	S	*	*	T	Hydrogen-bonded Turn	trans	-106.9	-12.9	174.9	-65.6	-159.4	124.8	0	112.9	K20 S23 D24 T28	K20-E26 IonicContact NZ-OE2 3.34Å; K20-E26 PolarHBondContact NZ-OE2 3.28Å; S23-E26 PolarHBondContact O-N 3.47Å; D24-E26 VanDerWaalsContact C-N 3.35Å; D24-E26 PolarHBondContact O-N 2.86Å; E26-T28 PolarHBondContact O-N 3.29Å; E26-T28 VanDerWaalsContact O-N 3.1Å
27	A	61	Low	67.2	Low	75 Å²	75	120.1 Å²	120.1	62%	0.62	68%	0.677	S	S	*	*			trans	-75.1	4.3	-175.9	0	0	0	0	114.6	S23 D24 E29	S23-A27 PolarHBondContact O-N 3.23Å; D24-A27 PolarHBondContact O-N 3.45Å; A27-E29 VanDerWaalsContact C-N 3.25Å; A27-E29 PolarHBondContact O-N 3.37Å
28	T	59.3	Low	67.6	Low	106 Å²	106	125.1 Å²	125.1	65%	0.65	70%	0.7	S	S	*	*			trans	-91.2	49.6	178.4	-40.9	0	0	0	111.3	E26 N30	E26-T28 PolarHBondContact O-N 3.29Å; E26-T28 VanDerWaalsContact O-N 3.1Å; T28-N30 PolarHBondContact O-N 3.21Å
29	E	65.4	Low	67.6	Low	178 Å²	178	127.4 Å²	127.4	83%	0.832	72%	0.723	S	S	*	*			trans	-82.3	102.1	160.2	-67.9	-161.6	153.8	0	107.5	A27 L31	A27-E29 VanDerWaalsContact C-N 3.25Å; A27-E29 PolarHBondContact O-N 3.37Å; E29-L31 VanDerWaalsContact C-N 3.33Å; E29-L31 PolarHBondContact O-N 2.82Å
30	N	69.2	Low	67.7	Low	139 Å²	139	127.4 Å²	127.4	74%	0.743	73%	0.725	S	S	*	*			trans	-61.7	92.4	174.8	-74.8	-43.1	0	0	109.8	T28 T32	T28-N30 PolarHBondContact O-N 3.21Å; N30-T32 PolarHBondContact O-N 3Å
31	L	73.3	Confident	68	Low	146 Å²	146	127.7 Å²	127.7	76%	0.764	74%	0.736	S	S	*	*			trans	-68.7	98.6	171.6	-178.1	68	0	0	109	E29 L33	E29-L31 VanDerWaalsContact C-N 3.33Å; E29-L31 PolarHBondContact O-N 2.82Å; L31-L33 HydrophobicContact CD2-CD1 4.14Å; L31-L33 HydrophobicContact CD2-CG 4.27Å; L31-L33 HydrophobicContact CG-CG 4.19Å; L31-L33 PolarHBondContact O-N 3.4Å
32	T	75.1	Confident	68.1	Low	113 Å²	113	129.6 Å²	129.6	69%	0.693	74%	0.743	S	S	*	*			trans	-90.7	100.8	173.7	-58	0	0	0	109.4	N30 T34	N30-T32 PolarHBondContact O-N 3Å; T32-T34 PolarHBondContact O-N 3.46Å
33	L	76.3	Confident	68.3	Low	148 Å²	148	125.8 Å²	125.8	78%	0.775	74%	0.743	S	S	*	*			trans	-82.4	104.7	171.3	-71.8	156.9	0	0	108.9	L31	L31-L33 HydrophobicContact CD2-CD1 4.14Å; L31-L33 HydrophobicContact CD2-CG 4.27Å; L31-L33 HydrophobicContact CG-CG 4.19Å; L31-L33 PolarHBondContact O-N 3.4Å
34	T	79.6	Confident	68.7	Low	117 Å²	117	129.8 Å²	129.8	72%	0.718	76%	0.763	S	S	*	*			trans	-93.4	102.7	172.8	-40.6	0	0	0	108.5	T32	T32-T34 PolarHBondContact O-N 3.46Å
35	A	77.7	Confident	69.1	Low	93 Å²	93	130.4 Å²	130.4	77%	0.769	77%	0.771	S	S	*	*			trans	-89.1	101.9	172.1	0	0	0	0	109.2	V37	A35-V37 PolarHBondContact O-N 3.4Å
36	S	76.5	Confident	69.8	Low	114 Å²	114	132.1 Å²	132.1	80%	0.797	77%	0.773	S	S	*	*			trans	-80.4	109.6	171.6	-61.3	0	0	0	109.5
37	V	72.7	Confident	70.7	Confident	127 Å²	127	132 Å²	132	77%	0.77	78%	0.784	S	S	*	*			trans	-90.1	118.5	167.5	-179.6	0	0	0	107.9	A35	A35-V37 PolarHBondContact O-N 3.4Å
38	N	71.7	Confident	71.5	Confident	164 Å²	164	136.8 Å²	136.8	88%	0.877	80%	0.798	S	S	*	*			trans	-90.3	122.5	170.7	-150.8	38.1	0	0	108
39	V	61	Low	72.6	Confident	196 Å²	196	139.5 Å²	139.5	100%	1.188	81%	0.811	S	S	*	*			trans	-96.3	0	173.8	-168.1	0	0	0	109.5

Retrieved 39 of 39 residues in 8.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).