G4VGQ0_SCHMA Loading...

Coiled-coil domain-containing protein 86

AlphaFold DB , UniProt , Accession G4VGQ0, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 100 aa.

						>G4VGQ0_SCHMA|G4VGQ0
MKQGQTKDKGGTIRKTSKNDSKKEKEQNTKKNKFYELIARQKQMKNIKLEKKKAIEKKREERLHNRKERNISMQKLTRKGQPVMKHRIKLLLKQLCPGDS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.1	Low	47.6	Very low	243 Å²	243	151.8 Å²	151.8	100%	1.197	83%	0.826	S	S	*	*				0	114	0	-68.4	-171.1	177.4	0	0	109.7
2	K	42.8	Very low	48.4	Very low	214 Å²	214	149.9 Å²	149.9	93%	0.93	82%	0.824	S	S	*	*			trans	-174	111.8	140.4	-103.8	-179.7	-175.9	-177.8	0	107.6
3	Q	47.1	Very low	48.7	Very low	194 Å²	194	149.1 Å²	149.1	91%	0.907	82%	0.815	S	S	*	*			trans	-77.6	149.4	176	-66.6	172.7	-3.4	0	0	109.9
4	G	44.4	Very low	49.2	Very low	67 Å²	67	154.1 Å²	154.1	69%	0.691	82%	0.816	S	S	*	*			trans	73.7	119.7	131.8	0	0	0	0	0	118.3
5	Q	54.5	Low	49.4	Very low	164 Å²	164	156.1 Å²	156.1	77%	0.766	82%	0.815	S	S	*	*				177.6	85.3	109.7	-91.2	175.6	48.2	0	0	108.6	K7	Q5-K7 PolarHBondContact O-N 3.16Å; Q5-K7 VanDerWaalsContact O-N 3.16Å
6	T	48.2	Very low	49.9	Very low	128 Å²	128	151.1 Å²	151.1	79%	0.785	79%	0.793	S	S	*	*			trans	-71.8	97.7	158.8	44.7	0	0	0	0	107.1	D8	T6-D8 PolarHBondContact O-N 3.02Å
7	K	53.1	Low	50.6	Low	173 Å²	173	147.3 Å²	147.3	75%	0.752	78%	0.782	S	S	*	*			trans	-76.4	87	166.1	-73.7	-174.8	179.4	177.2	0	107.3	Q5 K9	Q5-K7 PolarHBondContact O-N 3.16Å; Q5-K7 VanDerWaalsContact O-N 3.16Å; K7-K9 PolarHBondContact O-N 3.11Å; K7-K9 VanDerWaalsContact O-N 3.11Å
8	D	47.6	Very low	51	Low	146 Å²	146	148.6 Å²	148.6	78%	0.781	78%	0.78	S	S	*	*			trans	-51.8	117.1	163.2	-77	-41.3	0	0	0	107.8	T6 G10	T6-D8 PolarHBondContact O-N 3.02Å; D8-G10 PolarHBondContact O-N 2.75Å
9	K	49.8	Very low	51.3	Low	207 Å²	207	146.1 Å²	146.1	90%	0.9	77%	0.767	S	S	*	*			trans	-62.7	93.9	171.6	-66	177.9	-177.8	174.5	0	105.6	K7 G11	K7-K9 PolarHBondContact O-N 3.11Å; K7-K9 VanDerWaalsContact O-N 3.11Å; K9-G11 VanDerWaalsContact C-N 3.27Å; K9-G11 PolarHBondContact O-N 2.8Å
10	G	40.1	Very low	51.9	Low	70 Å²	70	142.5 Å²	142.5	72%	0.722	75%	0.749	S	S	*	*			trans	-50.9	97.1	171.6	0	0	0	0	0	107.9	D8 T12	D8-G10 PolarHBondContact O-N 2.75Å; G10-T12 PolarHBondContact O-N 2.85Å
11	G	46.2	Very low	52.6	Low	64 Å²	64	138.2 Å²	138.2	66%	0.66	73%	0.73	S	S	*	*			trans	-61.3	109.7	177.7	0	0	0	0	0	106.4	K9 I13	K9-G11 VanDerWaalsContact C-N 3.27Å; K9-G11 PolarHBondContact O-N 2.8Å; G11-I13 PolarHBondContact O-N 2.99Å
12	T	56.7	Low	53.5	Low	129 Å²	129	133.2 Å²	133.2	79%	0.791	70%	0.702	S	S	*	*			trans	-49.4	107.6	170.3	-54.5	0	0	0	0	107.1	G10 R14	G10-T12 PolarHBondContact O-N 2.85Å; T12-R14 VanDerWaalsContact C-N 3.31Å; T12-R14 PolarHBondContact O-N 2.75Å
13	I	53.1	Low	54.8	Low	139 Å²	139	129.3 Å²	129.3	71%	0.713	69%	0.685	S	S	*	*			trans	-57.7	100.4	175.6	-60.2	173.6	0	0	0	105.5	G11 K15	G11-I13 PolarHBondContact O-N 2.99Å; I13-K15 HydrophobicContact CG2-CG 3.91Å; I13-K15 PolarHBondContact O-N 2.78Å
14	R	54.6	Low	55.9	Low	220 Å²	220	125.8 Å²	125.8	83%	0.83	67%	0.669	S	S	*	*			trans	-65	84.2	173.2	-87.4	-172.9	174.8	-170.6	-0.4	107.7	T12 T16	T12-R14 VanDerWaalsContact C-N 3.31Å; T12-R14 PolarHBondContact O-N 2.75Å; R14-T16 PolarHBondContact O-N 3.02Å
15	K	53.3	Low	57.4	Low	183 Å²	183	129.8 Å²	129.8	80%	0.796	67%	0.667	S	S	*	*			trans	-77.7	59.2	161.1	-67.6	-172.3	-178.9	175.9	0	108.9	I13	I13-K15 HydrophobicContact CG2-CG 3.91Å; I13-K15 PolarHBondContact O-N 2.78Å
16	T	57	Low	58.4	Low	76 Å²	76	127.4 Å²	127.4	47%	0.466	66%	0.656	S	S	.	*			trans	-131.3	82.1	172.5	58.3	0	0	0	0	107.8	R14	R14-T16 PolarHBondContact O-N 3.02Å
17	S	60.8	Low	59.8	Low	87 Å²	87	126.8 Å²	126.8	61%	0.608	64%	0.644	S	S	*	*	S	Bend	trans	-140.2	-32.8	166.8	70.7	0	0	0	0	111.3	N19 S21	S17-N19 VanDerWaalsContact C-N 3.33Å; S17-N19 PolarHBondContact O-N 3.46Å; S17-S21 PolarHBondContact O-N 3.13Å; S17-S21 PolarHBondContact O-OG 3.08Å; S17-S21 VanDerWaalsContact O-OG 3.12Å
18	K	58.2	Low	61	Low	171 Å²	171	122.6 Å²	122.6	74%	0.743	63%	0.63	S	S	*	*	H	α-helix	trans	-69	-26.4	172.5	-67	-168.8	-177.2	-176.6	0	113.7	S21	K18-S21 PolarHBondContact O-OG 3.41Å
19	N	57.1	Low	62.8	Low	100 Å²	100	119 Å²	119	54%	0.535	61%	0.614	S	S	.	*	H	α-helix	trans	-81.8	-34.6	178.4	-74.6	-8.6	0	0	0	112.6	S17 K22 K23	S17-N19 VanDerWaalsContact C-N 3.33Å; S17-N19 PolarHBondContact O-N 3.46Å; N19-K22 PolarHBondContact O-N 3.37Å; N19-K23 PolarHBondContact O-N 2.84Å; N19-K23 VanDerWaalsContact O-N 3.08Å
20	D	62.6	Low	64.5	Low	75 Å²	75	116.1 Å²	116.1	40%	0.401	60%	0.601	S	S	.	*	H	α-helix	trans	-70.9	-42.5	-179.4	-58.5	-43.4	0	0	0	111	K22 K23 E24	D20-K22 VanDerWaalsContact C-N 3.3Å; D20-K22 PolarHBondContact O-N 3.32Å; D20-K23 PolarHBondContact O-N 3.31Å; D20-K23 VanDerWaalsContact O-N 3.13Å; D20-E24 WeakPolarHBondContact O-CG 3.27Å; D20-E24 PolarHBondContact O-N 3.12Å
21	S	66.4	Low	66.9	Low	52 Å²	52	118.3 Å²	118.3	36%	0.364	59%	0.59	S	S	.	*	H	α-helix	trans	-61.6	-33.2	174.1	54.1	0	0	0	0	113.8	S17 K18 K25	S17-S21 PolarHBondContact O-N 3.13Å; S17-S21 PolarHBondContact O-OG 3.08Å; S17-S21 VanDerWaalsContact O-OG 3.12Å; K18-S21 PolarHBondContact O-OG 3.41Å; S21-K25 WeakPolarHBondContact O-CB 3.48Å; S21-K25 VanDerWaalsContact O-CG 3.27Å; S21-K25 WeakPolarHBondContact O-CG 3.34Å; S21-K25 PolarHBondContact O-N 3.33Å; S21-K25 VanDerWaalsContact O-N 3.15Å
22	K	70.5	Confident	69	Low	138 Å²	138	119.9 Å²	119.9	60%	0.6	58%	0.584	S	S	*	*	H	α-helix	trans	-68.4	-45.4	171.7	-77.6	-173.9	-179.6	-176.7	0	111.6	N19 D20 K25 E26	N19-K22 PolarHBondContact O-N 3.37Å; D20-K22 VanDerWaalsContact C-N 3.3Å; D20-K22 PolarHBondContact O-N 3.32Å; K22-K25 PolarHBondContact O-N 3.34Å; K22-E26 WeakPolarHBondContact O-CG 3.5Å; K22-E26 PolarHBondContact O-N 3.21Å
23	K	69.6	Low	70.7	Confident	132 Å²	132	119.9 Å²	119.9	57%	0.574	57%	0.573	S	S	*	*	H	α-helix	trans	-62.7	-41.7	177.3	-74.9	-176.8	-179.8	178.9	0	112.4	N19 D20 E26 Q27	N19-K23 PolarHBondContact O-N 2.84Å; N19-K23 VanDerWaalsContact O-N 3.08Å; D20-K23 PolarHBondContact O-N 3.31Å; D20-K23 VanDerWaalsContact O-N 3.13Å; K23-E26 PolarHBondContact O-N 2.88Å; K23-Q27 WeakPolarHBondContact O-CG 3.45Å; K23-Q27 PolarHBondContact O-N 3.28Å
24	E	71	Confident	72.6	Confident	121 Å²	121	119 Å²	119	57%	0.565	56%	0.564	S	S	*	*	H	α-helix	trans	-63	-44.1	175.6	-75.9	-179.9	177.5	0	0	111.8	D20 E26 Q27 N28	D20-E24 WeakPolarHBondContact O-CG 3.27Å; D20-E24 PolarHBondContact O-N 3.12Å; E24-E26 PolarHBondContact O-N 2.87Å; E24-Q27 PolarHBondContact O-N 3.06Å; E24-N28 WeakPolarHBondContact O-CB 3.37Å; E24-N28 PolarHBondContact O-N 3.32Å; E24-N28 PolarHBondContact O-ND2 3.47Å
25	K	74.1	Confident	74.5	Confident	151 Å²	151	115.8 Å²	115.8	66%	0.657	55%	0.553	S	S	*	*	H	α-helix	trans	-59	-45.9	173.7	-76.1	177.2	-178.7	-174.9	0	111.4	S21 K22 N28 T29	S21-K25 WeakPolarHBondContact O-CB 3.48Å; S21-K25 VanDerWaalsContact O-CG 3.27Å; S21-K25 WeakPolarHBondContact O-CG 3.34Å; S21-K25 PolarHBondContact O-N 3.33Å; S21-K25 VanDerWaalsContact O-N 3.15Å; K22-K25 PolarHBondContact O-N 3.34Å; K25-N28 PolarHBondContact O-N 3.15Å; K25-T29 WeakPolarHBondContact O-CG2 3.46Å; K25-T29 PolarHBondContact O-N 2.97Å
26	E	75.8	Confident	76.5	Confident	114 Å²	114	113.4 Å²	113.4	53%	0.533	55%	0.545	S	S	.	.	H	α-helix	trans	-62.3	-43.7	176.2	-75.8	178.4	-163	0	0	112.6	K22 K23 E24 N28 T29 K30	K22-E26 WeakPolarHBondContact O-CG 3.5Å; K22-E26 PolarHBondContact O-N 3.21Å; K23-E26 PolarHBondContact O-N 2.88Å; E24-E26 PolarHBondContact O-N 2.87Å; E26-N28 VanDerWaalsContact C-N 3.35Å; E26-N28 PolarHBondContact O-N 3.01Å; E26-T29 PolarHBondContact O-N 3.48Å; E26-T29 PolarHBondContact O-OG1 2.97Å; E26-K30 WeakPolarHBondContact O-CG 3.36Å; E26-K30 PolarHBondContact O-N 3.32Å
27	Q	77.3	Confident	78.3	Confident	115 Å²	115	114.6 Å²	114.6	54%	0.537	55%	0.548	S	S	.	.	H	α-helix	trans	-62.1	-41.7	175.3	-73.7	-179	5.7	0	0	111.9	K23 E24 K30 K31	K23-Q27 WeakPolarHBondContact O-CG 3.45Å; K23-Q27 PolarHBondContact O-N 3.28Å; E24-Q27 PolarHBondContact O-N 3.06Å; Q27-K30 PolarHBondContact O-N 3.48Å; Q27-K31 WeakPolarHBondContact O-CG 3.49Å; Q27-K31 PolarHBondContact O-N 3.47Å
28	N	79.7	Confident	80	Confident	85 Å²	85	113 Å²	113	46%	0.455	53%	0.531	S	S	.	.	H	α-helix	trans	-63.4	-41.1	176.5	-73	-21.2	0	0	0	111.6	E24 K25 E26 K30 K31 N32	E24-N28 WeakPolarHBondContact O-CB 3.37Å; E24-N28 PolarHBondContact O-N 3.32Å; E24-N28 PolarHBondContact O-ND2 3.47Å; K25-N28 PolarHBondContact O-N 3.15Å; E26-N28 VanDerWaalsContact C-N 3.35Å; E26-N28 PolarHBondContact O-N 3.01Å; N28-K30 PolarHBondContact O-N 2.96Å; N28-K31 PolarHBondContact O-N 2.94Å; N28-N32 VanDerWaalsContact O-CG 3.27Å; N28-N32 PolarHBondContact O-N 3.32Å; N28-N32 PolarHBondContact O-OD1 2.76Å
29	T	84.2	Confident	81.8	Confident	71 Å²	71	107 Å²	107	44%	0.436	52%	0.515	S	S	.	.	H	α-helix	trans	-64.3	-38.6	174.7	63.7	0	0	0	0	113	K25 E26 N32 K33	K25-T29 WeakPolarHBondContact O-CG2 3.46Å; K25-T29 PolarHBondContact O-N 2.97Å; E26-T29 PolarHBondContact O-N 3.48Å; E26-T29 PolarHBondContact O-OG1 2.97Å; T29-N32 PolarHBondContact O-N 3.42Å; T29-K33 WeakPolarHBondContact O-CG 3.28Å; T29-K33 PolarHBondContact O-N 2.99Å
30	K	87	Confident	83.6	Confident	146 Å²	146	110 Å²	110	64%	0.635	52%	0.518	S	S	*	.	H	α-helix	trans	-64.2	-42.5	174.8	-71.7	177.3	-177.2	177.9	0	111.8	E26 Q27 N28 K33 F34	E26-K30 WeakPolarHBondContact O-CG 3.36Å; E26-K30 PolarHBondContact O-N 3.32Å; Q27-K30 PolarHBondContact O-N 3.48Å; N28-K30 PolarHBondContact O-N 2.96Å; K30-K33 PolarHBondContact O-N 3.32Å; K30-F34 PolarHBondContact O-N 3.45Å
31	K	88.6	Confident	85.2	Confident	115 Å²	115	112.5 Å²	112.5	50%	0.5	53%	0.527	S	S	.	.	H	α-helix	trans	-61.7	-45.9	175	-73.8	179.2	-179.6	177.9	0	111.7	Q27 N28 K33 F34 Y35	Q27-K31 WeakPolarHBondContact O-CG 3.49Å; Q27-K31 PolarHBondContact O-N 3.47Å; N28-K31 PolarHBondContact O-N 2.94Å; K31-K33 PolarHBondContact O-N 3.16Å; K31-F34 WeakPolarHBondContact O-CB 3.07Å; K31-F34 PolarHBondContact O-N 3.49Å; K31-F34 VanDerWaalsContact O-N 3.16Å; K31-Y35 HydrophobicContact CB-CE2 4.38Å; K31-Y35 WeakPolarHBondContact O-CD2 3.39Å; K31-Y35 PolarHBondContact O-N 3.01Å
32	N	90.7	Very high	86.7	Confident	97 Å²	97	116.6 Å²	116.6	52%	0.519	54%	0.539	S	S	.	.	H	α-helix	trans	-61.1	-46.6	178.2	-69.1	-5.4	0	0	0	111.7	N28 T29 F34 Y35 E36	N28-N32 VanDerWaalsContact O-CG 3.27Å; N28-N32 PolarHBondContact O-N 3.32Å; N28-N32 PolarHBondContact O-OD1 2.76Å; T29-N32 PolarHBondContact O-N 3.42Å; N32-F34 VanDerWaalsContact C-N 3.28Å; N32-F34 PolarHBondContact O-N 3.17Å; N32-Y35 PolarHBondContact O-N 3.46Å; N32-Y35 VanDerWaalsContact O-N 3.17Å; N32-E36 WeakPolarHBondContact O-CG 3.34Å; N32-E36 PolarHBondContact O-N 3.33Å
33	K	92.7	Very high	87.9	Confident	130 Å²	130	116 Å²	116	57%	0.565	54%	0.538	S	S	*	.	H	α-helix	trans	-57.5	-40	174	-73.8	177.7	179.3	-176.5	0	112.4	T29 K30 K31 E36 L37	T29-K33 WeakPolarHBondContact O-CG 3.28Å; T29-K33 PolarHBondContact O-N 2.99Å; K30-K33 PolarHBondContact O-N 3.32Å; K31-K33 PolarHBondContact O-N 3.16Å; K33-E36 PolarHBondContact O-N 3.01Å; K33-L37 VanDerWaalsContact O-CG 3.28Å; K33-L37 WeakPolarHBondContact O-CG 3.35Å; K33-L37 PolarHBondContact O-N 3.34Å
34	F	94	Very high	89.2	Confident	119 Å²	119	114.1 Å²	114.1	52%	0.522	53%	0.533	S	S	.	.	H	α-helix	trans	-62.4	-47.9	176	176.6	-98.2	0	0	0	111.7	K30 K31 N32 E36 L37 I38	K30-F34 PolarHBondContact O-N 3.45Å; K31-F34 WeakPolarHBondContact O-CB 3.07Å; K31-F34 PolarHBondContact O-N 3.49Å; K31-F34 VanDerWaalsContact O-N 3.16Å; N32-F34 VanDerWaalsContact C-N 3.28Å; N32-F34 PolarHBondContact O-N 3.17Å; F34-E36 VanDerWaalsContact C-N 3.34Å; F34-E36 PolarHBondContact O-N 3.24Å; F34-L37 PolarHBondContact O-N 3.44Å; F34-I38 HydrophobicContact CD1-CG1 4.27Å; F34-I38 HydrophobicContact CE1-CD1 4.48Å; F34-I38 HydrophobicContact CE1-CG1 3.87Å; F34-I38 HydrophobicContact CE2-CD1 4.26Å; F34-I38 HydrophobicContact CE2-CG1 4.22Å; F34-I38 HydrophobicContact CZ-CD1 3.98Å; F34-I38 HydrophobicContact CZ-CG1 3.84Å; F34-I38 WeakPolarHBondContact O-CG1 3.39Å; F34-I38 PolarHBondContact O-N 3.37Å
35	Y	94	Very high	90.5	Very high	154 Å²	154	115.8 Å²	115.8	60%	0.604	54%	0.538	S	S	*	.	H	α-helix	trans	-62.6	-39.4	177.3	-70.4	-61.9	0	0	0	112.7	K31 N32 I38 A39	K31-Y35 HydrophobicContact CB-CE2 4.38Å; K31-Y35 WeakPolarHBondContact O-CD2 3.39Å; K31-Y35 PolarHBondContact O-N 3.01Å; N32-Y35 PolarHBondContact O-N 3.46Å; N32-Y35 VanDerWaalsContact O-N 3.17Å; Y35-I38 PolarHBondContact O-N 2.91Å; Y35-A39 WeakPolarHBondContact O-CB 3.41Å; Y35-A39 PolarHBondContact O-N 2.93Å
36	E	94.8	Very high	91.5	Very high	132 Å²	132	113.3 Å²	113.3	62%	0.617	53%	0.532	S	S	*	.	H	α-helix	trans	-60	-44.8	173.7	-73.9	172	-172.9	0	0	112	N32 K33 F34 A39 R40	N32-E36 WeakPolarHBondContact O-CG 3.34Å; N32-E36 PolarHBondContact O-N 3.33Å; K33-E36 PolarHBondContact O-N 3.01Å; F34-E36 VanDerWaalsContact C-N 3.34Å; F34-E36 PolarHBondContact O-N 3.24Å; E36-A39 PolarHBondContact O-N 3.48Å; E36-R40 WeakPolarHBondContact O-CB 3.39Å; E36-R40 PolarHBondContact O-N 3.34Å
37	L	95.6	Very high	92.5	Very high	101 Å²	101	112.5 Å²	112.5	53%	0.529	53%	0.53	S	S	.	.	H	α-helix	trans	-63.3	-42.6	177	-71.9	172.5	0	0	0	111.8	K33 F34 R40 Q41	K33-L37 VanDerWaalsContact O-CG 3.28Å; K33-L37 WeakPolarHBondContact O-CG 3.35Å; K33-L37 PolarHBondContact O-N 3.34Å; F34-L37 PolarHBondContact O-N 3.44Å; L37-R40 PolarHBondContact O-N 3.02Å; L37-Q41 WeakPolarHBondContact O-CG 3.4Å; L37-Q41 PolarHBondContact O-N 2.87Å
38	I	95.6	Very high	93.5	Very high	53 Å²	53	113.9 Å²	113.9	27%	0.272	53%	0.534	S	S	.	.	H	α-helix	trans	-63.7	-43.6	176	-66.4	-64.9	0	0	0	111	F34 Y35 R40 Q41 K42	F34-I38 HydrophobicContact CD1-CG1 4.27Å; F34-I38 HydrophobicContact CE1-CD1 4.48Å; F34-I38 HydrophobicContact CE1-CG1 3.87Å; F34-I38 HydrophobicContact CE2-CD1 4.26Å; F34-I38 HydrophobicContact CE2-CG1 4.22Å; F34-I38 HydrophobicContact CZ-CD1 3.98Å; F34-I38 HydrophobicContact CZ-CG1 3.84Å; F34-I38 WeakPolarHBondContact O-CG1 3.39Å; F34-I38 PolarHBondContact O-N 3.37Å; Y35-I38 PolarHBondContact O-N 2.91Å; I38-R40 VanDerWaalsContact C-N 3.35Å; I38-R40 PolarHBondContact O-N 2.98Å; I38-Q41 PolarHBondContact O-N 2.96Å; I38-K42 HydrophobicContact CG2-CD 4.37Å; I38-K42 WeakPolarHBondContact O-CG 3.41Å; I38-K42 PolarHBondContact O-N 2.9Å
39	A	95.8	Very high	94.3	Very high	47 Å²	47	113.7 Å²	113.7	39%	0.388	53%	0.533	S	S	.	.	H	α-helix	trans	-60.6	-45.5	176.4	0	0	0	0	0	111.1	Y35 E36 Q41 K42 Q43	Y35-A39 WeakPolarHBondContact O-CB 3.41Å; Y35-A39 PolarHBondContact O-N 2.93Å; E36-A39 PolarHBondContact O-N 3.48Å; A39-Q41 PolarHBondContact O-N 3.32Å; A39-K42 PolarHBondContact O-N 2.98Å; A39-Q43 WeakPolarHBondContact O-CG 3.33Å; A39-Q43 PolarHBondContact O-N 3.27Å
40	R	96.5	Very high	94.9	Very high	162 Å²	162	115.2 Å²	115.2	61%	0.611	54%	0.535	S	S	*	.	H	α-helix	trans	-60.9	-43.9	176	-170.9	179.2	-177.1	-170.4	1.9	112.2	E36 L37 I38 K42 Q43 M44	E36-R40 WeakPolarHBondContact O-CB 3.39Å; E36-R40 PolarHBondContact O-N 3.34Å; L37-R40 PolarHBondContact O-N 3.02Å; I38-R40 VanDerWaalsContact C-N 3.35Å; I38-R40 PolarHBondContact O-N 2.98Å; R40-K42 PolarHBondContact O-N 3.33Å; R40-Q43 PolarHBondContact O-N 3.33Å; R40-M44 WeakPolarHBondContact O-CG 3.36Å; R40-M44 PolarHBondContact O-N 3.4Å
41	Q	96.2	Very high	95.4	Very high	127 Å²	127	114.8 Å²	114.8	59%	0.593	53%	0.533	S	S	*	.	H	α-helix	trans	-61.5	-43	176.3	-76.2	179.5	0.9	0	0	112.1	L37 I38 A39 M44 K45	L37-Q41 WeakPolarHBondContact O-CG 3.4Å; L37-Q41 PolarHBondContact O-N 2.87Å; I38-Q41 PolarHBondContact O-N 2.96Å; A39-Q41 PolarHBondContact O-N 3.32Å; Q41-M44 PolarHBondContact O-N 3.47Å; Q41-K45 PolarHBondContact O-N 3.49Å
42	K	96.8	Very high	95.9	Very high	138 Å²	138	115.9 Å²	115.9	60%	0.6	54%	0.538	S	S	*	.	H	α-helix	trans	-60.6	-46.4	175.3	-73.6	177.7	179.3	-178.5	0	111.6	I38 A39 R40 M44 K45 N46	I38-K42 HydrophobicContact CG2-CD 4.37Å; I38-K42 WeakPolarHBondContact O-CG 3.41Å; I38-K42 PolarHBondContact O-N 2.9Å; A39-K42 PolarHBondContact O-N 2.98Å; R40-K42 PolarHBondContact O-N 3.33Å; K42-M44 PolarHBondContact O-N 2.99Å; K42-K45 PolarHBondContact O-N 3.46Å; K42-N46 PolarHBondContact O-N 3.05Å
43	Q	96.4	Very high	96.2	Very high	125 Å²	125	116.1 Å²	116.1	58%	0.584	54%	0.535	S	S	*	.	H	α-helix	trans	-59	-46.3	176	-72	175.8	-16	0	0	111.8	A39 R40 K45 N46 I47	A39-Q43 WeakPolarHBondContact O-CG 3.33Å; A39-Q43 PolarHBondContact O-N 3.27Å; R40-Q43 PolarHBondContact O-N 3.33Å; Q43-K45 VanDerWaalsContact C-N 3.33Å; Q43-K45 PolarHBondContact O-N 2.98Å; Q43-N46 PolarHBondContact O-N 2.96Å; Q43-I47 WeakPolarHBondContact O-CG1 3.49Å; Q43-I47 PolarHBondContact O-N 3.25Å
44	M	96.5	Very high	96.4	Very high	94 Å²	94	112.5 Å²	112.5	46%	0.463	53%	0.529	S	S	.	.	H	α-helix	trans	-61.7	-39.5	177.5	-72	-177.4	72.5	0	0	112.7	R40 Q41 K42 I47 K48	R40-M44 WeakPolarHBondContact O-CG 3.36Å; R40-M44 PolarHBondContact O-N 3.4Å; Q41-M44 PolarHBondContact O-N 3.47Å; K42-M44 PolarHBondContact O-N 2.99Å; M44-I47 PolarHBondContact O-N 3.46Å; M44-K48 WeakPolarHBondContact O-CB 3.36Å; M44-K48 WeakPolarHBondContact O-CG 3.5Å; M44-K48 PolarHBondContact O-N 2.96Å
45	K	97.4	Very high	96.6	Very high	155 Å²	155	111 Å²	111	67%	0.674	53%	0.525	S	S	*	.	H	α-helix	trans	-61.7	-44.9	175.9	-175.7	178.6	177.9	-178.8	0	111.1	Q41 K42 Q43 K48 L49	Q41-K45 PolarHBondContact O-N 3.49Å; K42-K45 PolarHBondContact O-N 3.46Å; Q43-K45 VanDerWaalsContact C-N 3.33Å; Q43-K45 PolarHBondContact O-N 2.98Å; K45-K48 PolarHBondContact O-N 3.23Å; K45-L49 WeakPolarHBondContact O-CB 3.36Å; K45-L49 PolarHBondContact O-N 3.33Å
46	N	96.5	Very high	96.8	Very high	100 Å²	100	108.2 Å²	108.2	54%	0.535	52%	0.518	S	S	.	.	H	α-helix	trans	-63.2	-45.8	178.1	-69.1	-7.5	0	0	0	111.5	K42 Q43 K48 L49 E50	K42-N46 PolarHBondContact O-N 3.05Å; Q43-N46 PolarHBondContact O-N 2.96Å; N46-K48 VanDerWaalsContact C-N 3.32Å; N46-K48 PolarHBondContact O-N 2.83Å; N46-L49 WeakPolarHBondContact O-CB 3.47Å; N46-L49 PolarHBondContact O-N 2.95Å; N46-L49 VanDerWaalsContact O-N 3.17Å; N46-E50 WeakPolarHBondContact O-CG 3.49Å; N46-E50 PolarHBondContact O-N 3.17Å
47	I	96.8	Very high	96.9	Very high	96 Å²	96	108.1 Å²	108.1	49%	0.492	52%	0.515	S	S	.	.	H	α-helix	trans	-59.2	-43.6	176.4	-66.7	165.8	0	0	0	111.3	Q43 M44 L49 E50 K51	Q43-I47 WeakPolarHBondContact O-CG1 3.49Å; Q43-I47 PolarHBondContact O-N 3.25Å; M44-I47 PolarHBondContact O-N 3.46Å; I47-L49 VanDerWaalsContact C-N 3.34Å; I47-E50 PolarHBondContact O-N 2.96Å; I47-K51 HydrophobicContact CG2-CD 4.3Å; I47-K51 WeakPolarHBondContact O-CB 3.46Å; I47-K51 WeakPolarHBondContact O-CG 3.47Å; I47-K51 PolarHBondContact O-N 3.17Å
48	K	97.6	Very high	97	Very high	144 Å²	144	109.2 Å²	109.2	63%	0.626	52%	0.516	S	S	*	.	H	α-helix	trans	-62.4	-42	176.9	-76.5	179.2	179	-176.4	0	111.9	M44 K45 N46 K51 K52	M44-K48 WeakPolarHBondContact O-CB 3.36Å; M44-K48 WeakPolarHBondContact O-CG 3.5Å; M44-K48 PolarHBondContact O-N 2.96Å; K45-K48 PolarHBondContact O-N 3.23Å; N46-K48 VanDerWaalsContact C-N 3.32Å; N46-K48 PolarHBondContact O-N 2.83Å; K48-K51 PolarHBondContact O-N 3.37Å; K48-K52 WeakPolarHBondContact O-CB 3.34Å; K48-K52 PolarHBondContact O-N 2.95Å
49	L	97.3	Very high	97.1	Very high	82 Å²	82	114.5 Å²	114.5	43%	0.429	53%	0.532	S	S	.	.	H	α-helix	trans	-62.9	-47.3	178.5	-176.5	64.9	0	0	0	111.3	K45 N46 I47 K51 K52 K53	K45-L49 WeakPolarHBondContact O-CB 3.36Å; K45-L49 PolarHBondContact O-N 3.33Å; N46-L49 WeakPolarHBondContact O-CB 3.47Å; N46-L49 PolarHBondContact O-N 2.95Å; N46-L49 VanDerWaalsContact O-N 3.17Å; I47-L49 VanDerWaalsContact C-N 3.34Å; L49-K51 PolarHBondContact O-N 3.36Å; L49-K52 WeakPolarHBondContact O-CB 3.49Å; L49-K52 PolarHBondContact O-N 3.49Å; L49-K53 WeakPolarHBondContact O-CG 3.45Å; L49-K53 PolarHBondContact O-N 2.89Å
50	E	96.7	Very high	97.2	Very high	102 Å²	102	118 Å²	118	48%	0.477	54%	0.541	S	S	.	.	H	α-helix	trans	-63.8	-41.2	178.4	-69	-55	126.1	0	0	112	N46 I47 K52 K53 A54	N46-E50 WeakPolarHBondContact O-CG 3.49Å; N46-E50 PolarHBondContact O-N 3.17Å; I47-E50 PolarHBondContact O-N 2.96Å; E50-K52 VanDerWaalsContact C-N 3.33Å; E50-K52 PolarHBondContact O-N 3.47Å; E50-K53 PolarHBondContact O-N 3.29Å; E50-K53 IonicContact OE1-NZ 2.83Å; E50-K53 PolarHBondContact OE1-NZ 2.94Å; E50-A54 WeakPolarHBondContact O-CB 3.46Å; E50-A54 PolarHBondContact O-N 3.43Å
51	K	97.5	Very high	97.2	Very high	138 Å²	138	114.6 Å²	114.6	60%	0.6	53%	0.532	S	S	*	.	H	α-helix	trans	-60.2	-42.5	172.3	-74	-176.1	-177.7	-172	0	112	I47 K48 L49 A54 I55	I47-K51 HydrophobicContact CG2-CD 4.3Å; I47-K51 WeakPolarHBondContact O-CB 3.46Å; I47-K51 WeakPolarHBondContact O-CG 3.47Å; I47-K51 PolarHBondContact O-N 3.17Å; K48-K51 PolarHBondContact O-N 3.37Å; L49-K51 PolarHBondContact O-N 3.36Å; K51-A54 PolarHBondContact O-N 2.95Å; K51-I55 WeakPolarHBondContact O-CD1 3.26Å; K51-I55 VanDerWaalsContact O-CG1 3.26Å; K51-I55 WeakPolarHBondContact O-CG1 3.31Å; K51-I55 PolarHBondContact O-N 3.42Å
52	K	97.8	Very high	97.2	Very high	137 Å²	137	114.3 Å²	114.3	60%	0.596	53%	0.525	S	S	*	.	H	α-helix	trans	-61.5	-49.2	177.9	-175.4	-179.4	174.6	-174.3	0	110.8	K48 L49 E50 A54 I55 E56	K48-K52 WeakPolarHBondContact O-CB 3.34Å; K48-K52 PolarHBondContact O-N 2.95Å; L49-K52 WeakPolarHBondContact O-CB 3.49Å; L49-K52 PolarHBondContact O-N 3.49Å; E50-K52 VanDerWaalsContact C-N 3.33Å; E50-K52 PolarHBondContact O-N 3.47Å; K52-A54 VanDerWaalsContact C-N 3.34Å; K52-A54 PolarHBondContact O-N 2.99Å; K52-I55 PolarHBondContact O-N 3.47Å; K52-E56 WeakPolarHBondContact O-CB 3.49Å; K52-E56 PolarHBondContact O-N 3.4Å
53	K	97.7	Very high	97.2	Very high	103 Å²	103	112.2 Å²	112.2	45%	0.448	52%	0.52	S	S	.	.	H	α-helix	trans	-57.4	-44.9	176.4	-70.6	176.2	-176.2	167.7	0	112.1	L49 E50 I55 E56 K57	L49-K53 WeakPolarHBondContact O-CG 3.45Å; L49-K53 PolarHBondContact O-N 2.89Å; E50-K53 PolarHBondContact O-N 3.29Å; E50-K53 IonicContact OE1-NZ 2.83Å; E50-K53 PolarHBondContact OE1-NZ 2.94Å; K53-I55 VanDerWaalsContact C-N 3.34Å; K53-I55 PolarHBondContact O-N 3.19Å; K53-E56 PolarHBondContact O-N 2.9Å; K53-K57 WeakPolarHBondContact O-CB 3.45Å; K53-K57 PolarHBondContact O-N 3.15Å
54	A	97.5	Very high	97.2	Very high	54 Å²	54	111.4 Å²	111.4	45%	0.446	52%	0.516	S	S	.	.	H	α-helix	trans	-63.6	-38.6	178.4	0	0	0	0	0	112.6	E50 K51 K52 K58	E50-A54 WeakPolarHBondContact O-CB 3.46Å; E50-A54 PolarHBondContact O-N 3.43Å; K51-A54 PolarHBondContact O-N 2.95Å; K52-A54 VanDerWaalsContact C-N 3.34Å; K52-A54 PolarHBondContact O-N 2.99Å; A54-K58 WeakPolarHBondContact O-CG 3.5Å; A54-K58 PolarHBondContact O-N 3.35Å; A54-K58 VanDerWaalsContact O-N 3.15Å
55	I	97.4	Very high	97.1	Very high	86 Å²	86	111.9 Å²	111.9	44%	0.441	52%	0.521	S	S	.	.	H	α-helix	trans	-68	-42.3	175.8	-70.1	166.1	0	0	0	110.8	K51 K52 K53 K58 R59	K51-I55 WeakPolarHBondContact O-CD1 3.26Å; K51-I55 VanDerWaalsContact O-CG1 3.26Å; K51-I55 WeakPolarHBondContact O-CG1 3.31Å; K51-I55 PolarHBondContact O-N 3.42Å; K52-I55 PolarHBondContact O-N 3.47Å; K53-I55 VanDerWaalsContact C-N 3.34Å; K53-I55 PolarHBondContact O-N 3.19Å; I55-K58 PolarHBondContact O-N 3Å; I55-R59 HydrophobicContact CG2-CG 4.48Å; I55-R59 VanDerWaalsContact O-CG 3.31Å; I55-R59 WeakPolarHBondContact O-CG 3.38Å; I55-R59 PolarHBondContact O-N 3.43Å
56	E	97.7	Very high	96.9	Very high	97 Å²	97	111.3 Å²	111.3	45%	0.453	51%	0.514	S	S	.	.	H	α-helix	trans	-62.7	-48.5	178.9	-171.7	157.7	-141.3	0	0	111.3	K52 K53 K58 R59 E60	K52-E56 WeakPolarHBondContact O-CB 3.49Å; K52-E56 PolarHBondContact O-N 3.4Å; K53-E56 PolarHBondContact O-N 2.9Å; E56-K58 VanDerWaalsContact C-N 3.34Å; E56-K58 PolarHBondContact O-N 3.33Å; E56-R59 WeakPolarHBondContact O-CA 3.48Å; E56-R59 VanDerWaalsContact O-CB 3.31Å; E56-R59 WeakPolarHBondContact O-CB 3.4Å; E56-R59 PolarHBondContact O-N 3.31Å; E56-E60 PolarHBondContact O-N 2.94Å
57	K	97.8	Very high	96.9	Very high	129 Å²	129	112.5 Å²	112.5	56%	0.561	51%	0.514	S	S	*	.	H	α-helix	trans	-54	-47.7	172.2	-176.2	176.6	177.8	179.3	0	112.2	K53 R59 E60 E61	K53-K57 WeakPolarHBondContact O-CB 3.45Å; K53-K57 PolarHBondContact O-N 3.15Å; K57-R59 VanDerWaalsContact C-N 3.27Å; K57-R59 PolarHBondContact O-N 2.92Å; K57-E60 PolarHBondContact O-N 3.43Å; K57-E61 WeakPolarHBondContact CE-OE1 3.31Å; K57-E61 WeakPolarHBondContact CG-OE1 3.11Å; K57-E61 WeakPolarHBondContact O-CG 3.38Å; K57-E61 PolarHBondContact O-N 2.82Å
58	K	98.1	Very high	96.7	Very high	124 Å²	124	112.5 Å²	112.5	54%	0.539	51%	0.513	S	S	.	.	H	α-helix	trans	-63.2	-30.4	175.6	-73.9	-177.8	179.5	-174.4	0	113.1	A54 I55 E56 R62	A54-K58 WeakPolarHBondContact O-CG 3.5Å; A54-K58 PolarHBondContact O-N 3.35Å; A54-K58 VanDerWaalsContact O-N 3.15Å; I55-K58 PolarHBondContact O-N 3Å; E56-K58 VanDerWaalsContact C-N 3.34Å; E56-K58 PolarHBondContact O-N 3.33Å; K58-R62 WeakPolarHBondContact O-CB 3.42Å; K58-R62 VanDerWaalsContact O-CG 3.28Å; K58-R62 WeakPolarHBondContact O-CG 3.44Å; K58-R62 PolarHBondContact O-N 3.11Å; K58-R62 VanDerWaalsContact O-N 3.13Å
59	R	97.6	Very high	96.4	Very high	164 Å²	164	109.5 Å²	109.5	62%	0.619	50%	0.497	S	S	*	.	H	α-helix	trans	-70.5	-44.4	175.8	-74.3	171	179.5	-161.9	-0.9	110.5	I55 E56 K57 R62 L63	I55-R59 HydrophobicContact CG2-CG 4.48Å; I55-R59 VanDerWaalsContact O-CG 3.31Å; I55-R59 WeakPolarHBondContact O-CG 3.38Å; I55-R59 PolarHBondContact O-N 3.43Å; E56-R59 WeakPolarHBondContact O-CA 3.48Å; E56-R59 VanDerWaalsContact O-CB 3.31Å; E56-R59 WeakPolarHBondContact O-CB 3.4Å; E56-R59 PolarHBondContact O-N 3.31Å; K57-R59 VanDerWaalsContact C-N 3.27Å; K57-R59 PolarHBondContact O-N 2.92Å; R59-R62 VanDerWaalsContact CG-NH2 3.3Å; R59-R62 PolarHBondContact O-N 2.92Å; R59-L63 WeakPolarHBondContact O-CB 3.4Å; R59-L63 PolarHBondContact O-N 3.4Å
60	E	97.5	Very high	96.1	Very high	121 Å²	121	110.2 Å²	110.2	57%	0.565	50%	0.501	S	S	*	.	H	α-helix	trans	-61.9	-48.4	176.5	-68.9	174.3	175.1	0	0	111.3	E56 K57 R62 L63 H64	E56-E60 PolarHBondContact O-N 2.94Å; K57-E60 PolarHBondContact O-N 3.43Å; E60-R62 PolarHBondContact O-N 3.44Å; E60-L63 PolarHBondContact O-N 3.4Å; E60-L63 VanDerWaalsContact O-N 3.11Å; E60-H64 WeakPolarHBondContact O-CB 3.4Å; E60-H64 PolarHBondContact O-N 3.48Å
61	E	97.1	Very high	95.9	Very high	91 Å²	91	110.2 Å²	110.2	43%	0.425	50%	0.504	S	S	.	.	H	α-helix	trans	-57.3	-46.1	175.6	-72.9	169.3	-176.5	0	0	111.7	K57 L63 H64 N65	K57-E61 WeakPolarHBondContact CE-OE1 3.31Å; K57-E61 WeakPolarHBondContact CG-OE1 3.11Å; K57-E61 WeakPolarHBondContact O-CG 3.38Å; K57-E61 PolarHBondContact O-N 2.82Å; E61-L63 VanDerWaalsContact C-N 3.33Å; E61-L63 PolarHBondContact O-N 3.13Å; E61-H64 PolarHBondContact O-N 3.01Å; E61-N65 WeakPolarHBondContact O-CB 3.28Å; E61-N65 PolarHBondContact O-N 2.96Å; E61-N65 PolarHBondContact O-ND2 3.26Å
62	R	95.7	Very high	95.6	Very high	120 Å²	120	106.2 Å²	106.2	45%	0.453	49%	0.493	S	S	.	.	H	α-helix	trans	-62.8	-39.3	175.9	-78.6	-170.3	-60	-93.5	-1.6	112.4	K58 R59 E60 R66	K58-R62 WeakPolarHBondContact O-CB 3.42Å; K58-R62 VanDerWaalsContact O-CG 3.28Å; K58-R62 WeakPolarHBondContact O-CG 3.44Å; K58-R62 PolarHBondContact O-N 3.11Å; K58-R62 VanDerWaalsContact O-N 3.13Å; R59-R62 VanDerWaalsContact CG-NH2 3.3Å; R59-R62 PolarHBondContact O-N 2.92Å; E60-R62 PolarHBondContact O-N 3.44Å; R62-R66 WeakPolarHBondContact O-CB 3.19Å; R62-R66 WeakPolarHBondContact O-CG 3.41Å; R62-R66 PolarHBondContact O-N 2.93Å
63	L	96.8	Very high	95.3	Very high	94 Å²	94	101.1 Å²	101.1	49%	0.492	47%	0.472	S	S	.	.	H	α-helix	trans	-68.8	-44.6	179.4	-177.6	62.5	0	0	0	110.9	R59 E60 E61 R66 K67	R59-L63 WeakPolarHBondContact O-CB 3.4Å; R59-L63 PolarHBondContact O-N 3.4Å; E60-L63 PolarHBondContact O-N 3.4Å; E60-L63 VanDerWaalsContact O-N 3.11Å; E61-L63 VanDerWaalsContact C-N 3.33Å; E61-L63 PolarHBondContact O-N 3.13Å; L63-R66 WeakPolarHBondContact O-CB 3.36Å; L63-R66 PolarHBondContact O-N 2.92Å; L63-K67 WeakPolarHBondContact O-CG 3.39Å; L63-K67 PolarHBondContact O-N 3.24Å
64	H	97	Very high	95	Very high	109 Å²	109	103 Å²	103	51%	0.505	48%	0.482	S	S	.	.	H	α-helix	trans	-56.7	-53	174.2	-179.8	-86.5	0	0	0	110.9	E60 E61 R66 K67 E68	E60-H64 WeakPolarHBondContact O-CB 3.4Å; E60-H64 PolarHBondContact O-N 3.48Å; E61-H64 PolarHBondContact O-N 3.01Å; H64-R66 VanDerWaalsContact C-N 3.26Å; H64-R66 PolarHBondContact O-N 3.23Å; H64-K67 WeakPolarHBondContact O-CB 3.38Å; H64-K67 PolarHBondContact O-N 2.92Å; H64-E68 PolarHBondContact O-N 2.98Å
65	N	94	Very high	94.8	Very high	104 Å²	104	105.9 Å²	105.9	56%	0.556	49%	0.485	S	S	*	.	H	α-helix	trans	-60.6	-34.8	178.7	-68.4	-10.4	0	0	0	112.6	E61 R69	E61-N65 WeakPolarHBondContact O-CB 3.28Å; E61-N65 PolarHBondContact O-N 2.96Å; E61-N65 PolarHBondContact O-ND2 3.26Å; N65-R69 WeakPolarHBondContact O-CB 3.45Å; N65-R69 PolarHBondContact O-N 3.36Å
66	R	93.4	Very high	94.7	Very high	142 Å²	142	106 Å²	106	54%	0.536	49%	0.486	S	S	.	.	H	α-helix	trans	-66	-42.1	173.2	-77.4	171.6	-177.8	-167	-0.2	112.1	R62 L63 H64 N70	R62-R66 WeakPolarHBondContact O-CB 3.19Å; R62-R66 WeakPolarHBondContact O-CG 3.41Å; R62-R66 PolarHBondContact O-N 2.93Å; L63-R66 WeakPolarHBondContact O-CB 3.36Å; L63-R66 PolarHBondContact O-N 2.92Å; H64-R66 VanDerWaalsContact C-N 3.26Å; H64-R66 PolarHBondContact O-N 3.23Å; R66-N70 WeakPolarHBondContact O-CB 3.41Å; R66-N70 PolarHBondContact O-N 3.02Å; R66-N70 PolarHBondContact O-ND2 3.34Å; R66-N70 PolarHBondContact O-OD1 3.45Å
67	K	95.6	Very high	94.5	Very high	125 Å²	125	104.3 Å²	104.3	54%	0.543	48%	0.482	S	S	.	.	H	α-helix	trans	-62.3	-51.8	177.3	-73.1	179.6	177.9	-175.7	0	110.9	L63 H64 R69 N70 I71	L63-K67 WeakPolarHBondContact O-CG 3.39Å; L63-K67 PolarHBondContact O-N 3.24Å; H64-K67 WeakPolarHBondContact O-CB 3.38Å; H64-K67 PolarHBondContact O-N 2.92Å; K67-R69 VanDerWaalsContact C-N 3.31Å; K67-R69 PolarHBondContact O-N 2.98Å; K67-N70 PolarHBondContact O-N 3.05Å; K67-I71 WeakPolarHBondContact O-CG1 3.17Å; K67-I71 PolarHBondContact O-N 3.36Å
68	E	94	Very high	94.3	Very high	97 Å²	97	110.7 Å²	110.7	45%	0.453	50%	0.503	S	S	.	.	H	α-helix	trans	-59.5	-41.5	178	-67.9	-51.6	119.6	0	0	112.4	H64 N70 I71 S72	H64-E68 PolarHBondContact O-N 2.98Å; E68-N70 PolarHBondContact O-N 3Å; E68-I71 PolarHBondContact O-N 3.21Å; E68-S72 WeakPolarHBondContact O-CB 3.23Å; E68-S72 PolarHBondContact O-N 3.35Å; E68-S72 PolarHBondContact O-OG 3.47Å
69	R	90.7	Very high	94.2	Very high	80 Å²	80	113.8 Å²	113.8	30%	0.302	52%	0.516	S	S	.	.	H	α-helix	trans	-62.6	-41.9	173.8	-173.9	178.6	66.5	-171.8	1.6	112.2	N65 K67 S72 M73	N65-R69 WeakPolarHBondContact O-CB 3.45Å; N65-R69 PolarHBondContact O-N 3.36Å; K67-R69 VanDerWaalsContact C-N 3.31Å; K67-R69 PolarHBondContact O-N 2.98Å; R69-S72 WeakPolarHBondContact CA-OG 3.48Å; R69-S72 PolarHBondContact O-N 3.01Å; R69-S72 PolarHBondContact O-OG 2.98Å; R69-M73 HydrophobicContact CG-CE 3.89Å; R69-M73 HydrophobicContact CG-CG 4.42Å; R69-M73 HydrophobicContact CG-SD 4.16Å; R69-M73 WeakPolarHBondContact O-CB 3.35Å; R69-M73 VanDerWaalsContact O-CG 3.24Å; R69-M73 WeakPolarHBondContact O-CG 3.5Å; R69-M73 PolarHBondContact O-N 2.97Å
70	N	91.4	Very high	94.1	Very high	97 Å²	97	108 Å²	108	52%	0.519	51%	0.507	S	S	.	.	H	α-helix	trans	-66.2	-41.2	-179.9	-73	-8.2	0	0	0	111.7	R66 K67 E68 M73 Q74	R66-N70 WeakPolarHBondContact O-CB 3.41Å; R66-N70 PolarHBondContact O-N 3.02Å; R66-N70 PolarHBondContact O-ND2 3.34Å; R66-N70 PolarHBondContact O-OD1 3.45Å; K67-N70 PolarHBondContact O-N 3.05Å; E68-N70 PolarHBondContact O-N 3Å; N70-M73 PolarHBondContact O-N 3.46Å; N70-Q74 PolarHBondContact O-N 2.94Å
71	I	92.5	Very high	93.9	Very high	103 Å²	103	108.1 Å²	108.1	53%	0.528	51%	0.508	S	S	.	.	H	α-helix	trans	-61.1	-51.8	174.9	-65.6	166	0	0	0	110	K67 E68 M73 Q74	K67-I71 WeakPolarHBondContact O-CG1 3.17Å; K67-I71 PolarHBondContact O-N 3.36Å; E68-I71 PolarHBondContact O-N 3.21Å; I71-M73 PolarHBondContact O-N 3.49Å; I71-Q74 VanDerWaalsContact O-CB 3.23Å; I71-Q74 WeakPolarHBondContact O-CB 3.24Å; I71-Q74 PolarHBondContact O-N 2.93Å
72	S	90.4	Very high	93.8	Very high	54 Å²	54	106 Å²	106	38%	0.378	50%	0.502	S	S	.	.	H	α-helix	trans	-62.7	-27	179.6	55.4	0	0	0	0	113.9	E68 R69 Q74 H86 L90	E68-S72 WeakPolarHBondContact O-CB 3.23Å; E68-S72 PolarHBondContact O-N 3.35Å; E68-S72 PolarHBondContact O-OG 3.47Å; R69-S72 WeakPolarHBondContact CA-OG 3.48Å; R69-S72 PolarHBondContact O-N 3.01Å; R69-S72 PolarHBondContact O-OG 2.98Å; S72-Q74 VanDerWaalsContact C-N 3.33Å; S72-H86 PolarHBondContact O-NE2 3.45Å; S72-L90 WeakPolarHBondContact O-CD1 3.38Å
73	M	91.4	Very high	93.7	Very high	30 Å²	30	101.9 Å²	101.9	15%	0.148	49%	0.49	C	S	.	.	T	Hydrogen-bonded Turn	trans	-81.1	-4.7	174.7	-73.5	-170.7	-51.6	0	0	114.5	R69 N70 I71 K75 R87 L90 L91	R69-M73 HydrophobicContact CG-CE 3.89Å; R69-M73 HydrophobicContact CG-CG 4.42Å; R69-M73 HydrophobicContact CG-SD 4.16Å; R69-M73 WeakPolarHBondContact O-CB 3.35Å; R69-M73 VanDerWaalsContact O-CG 3.24Å; R69-M73 WeakPolarHBondContact O-CG 3.5Å; R69-M73 PolarHBondContact O-N 2.97Å; N70-M73 PolarHBondContact O-N 3.46Å; I71-M73 PolarHBondContact O-N 3.49Å; M73-K75 PolarHBondContact O-N 2.97Å; M73-R87 HydrophobicContact CB-CG 4.09Å; M73-R87 HydrophobicContact CG-CG 4.21Å; M73-R87 PolarHBondContact O-NE 3.48Å; M73-L90 HydrophobicContact CG-CD1 3.93Å; M73-L91 HydrophobicContact SD-CD2 4.41Å
74	Q	91.9	Very high	93.6	Very high	141 Å²	141	102.9 Å²	102.9	66%	0.659	49%	0.494	S	S	*	.			trans	-78.5	33.6	-178.8	-158.3	-177.2	-1.5	0	0	113.2	N70 I71 S72	N70-Q74 PolarHBondContact O-N 2.94Å; I71-Q74 VanDerWaalsContact O-CB 3.23Å; I71-Q74 WeakPolarHBondContact O-CB 3.24Å; I71-Q74 PolarHBondContact O-N 2.93Å; S72-Q74 VanDerWaalsContact C-N 3.33Å
75	K	92.4	Very high	93.5	Very high	115 Å²	115	106.2 Å²	106.2	50%	0.5	51%	0.507	S	S	.	.			trans	-82.5	121.3	171.9	-165.9	173.9	-175.1	170.3	0	109.9	M73 V83 H86	M73-K75 PolarHBondContact O-N 2.97Å; K75-V83 HydrophobicContact CB-CB 4.4Å; K75-V83 HydrophobicContact CB-CG2 4.44Å; K75-V83 HydrophobicContact CD-CB 4.49Å; K75-V83 HydrophobicContact CD-CG2 4.42Å; K75-V83 HydrophobicContact CG-CB 4.29Å; K75-V83 HydrophobicContact CG-CG2 3.96Å; K75-V83 PolarHBondContact O-N 3.03Å; K75-H86 VanDerWaalsContact CB-CD2 3.46Å; K75-H86 WeakPolarHBondContact CB-CD2 3.37Å; K75-H86 HydrophobicContact CD-CB 4.08Å
76	L	95.3	Very high	93.5	Very high	90 Å²	90	103.7 Å²	103.7	47%	0.471	49%	0.492	S	S	.	.	B	Isolated β-bridge	trans	-110	153.2	178.5	-55.8	-179	0	0	0	111.3	G80 Q81 P82	L76-G80 WeakPolarHBondContact CD2-O 3.41Å; L76-Q81 CarbonylContact C-O 3.48Å; L76-Q81 WeakPolarHBondContact CA-O 3.38Å; L76-P82 HydrophobicContact CD2-CG 4.47Å
77	T	93.6	Very high	93.5	Very high	61 Å²	61	100.4 Å²	100.4	37%	0.374	48%	0.479	S	S	.	.			trans	-76.1	170.7	169.2	62	0	0	0	0	110.1	K79 G80 Q81 V83	T77-K79 PolarHBondContact O-N 3.2Å; T77-K79 VanDerWaalsContact O-N 3.1Å; T77-K79 PolarHBondContact OG1-N 2.94Å; T77-G80 PolarHBondContact O-N 2.83Å; T77-Q81 HydrophobicContact CG2-CB 4.45Å; T77-Q81 WeakPolarHBondContact CG2-O 3.46Å; T77-Q81 PolarHBondContact N-O 3.34Å; T77-Q81 WeakPolarHBondContact OG1-CB 3.32Å; T77-Q81 PolarHBondContact OG1-N 3.36Å; T77-Q81 PolarHBondContact OG1-O 3.05Å; T77-V83 HydrophobicContact CG2-CG2 3.79Å
78	R	94.8	Very high	93.3	Very high	262 Å²	262	98.5 Å²	98.5	99%	0.989	47%	0.474	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56.1	-26.1	173.2	-69	-175	175.8	-179.6	-1.5	113.6	G80	R78-G80 VanDerWaalsContact C-N 3.32Å
79	K	96	Very high	93.3	Very high	190 Å²	190	101.4 Å²	101.4	83%	0.826	49%	0.485	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.8	7.7	176.3	-62.2	-173.4	177.7	-175.5	0	113.4	T77 Q81	T77-K79 PolarHBondContact O-N 3.2Å; T77-K79 VanDerWaalsContact O-N 3.1Å; T77-K79 PolarHBondContact OG1-N 2.94Å; K79-Q81 VanDerWaalsContact C-N 3.27Å; K79-Q81 PolarHBondContact O-N 2.97Å
80	G	94.1	Very high	93.3	Very high	42 Å²	42	99.6 Å²	99.6	43%	0.433	48%	0.481	S	S	.	.	S	Bend	trans	78	1.8	-177.7	0	0	0	0	0	115.3	L76 T77 R78	L76-G80 WeakPolarHBondContact CD2-O 3.41Å; T77-G80 PolarHBondContact O-N 2.83Å; R78-G80 VanDerWaalsContact C-N 3.32Å
81	Q	93.9	Very high	93.3	Very high	124 Å²	124	98.5 Å²	98.5	58%	0.579	48%	0.475	S	S	*	.			trans	-77.8	144.5	178.9	-61.9	-61.9	-33.4	0	0	111.7	L76 T77 K79 V83	L76-Q81 CarbonylContact C-O 3.48Å; L76-Q81 WeakPolarHBondContact CA-O 3.38Å; T77-Q81 HydrophobicContact CG2-CB 4.45Å; T77-Q81 WeakPolarHBondContact CG2-O 3.46Å; T77-Q81 PolarHBondContact N-O 3.34Å; T77-Q81 WeakPolarHBondContact OG1-CB 3.32Å; T77-Q81 PolarHBondContact OG1-N 3.36Å; T77-Q81 PolarHBondContact OG1-O 3.05Å; K79-Q81 VanDerWaalsContact C-N 3.27Å; K79-Q81 PolarHBondContact O-N 2.97Å; Q81-V83 PolarHBondContact O-N 3.04Å
82	P	94.5	Very high	93.2	Very high	45 Å²	45	98.3 Å²	98.3	29%	0.292	47%	0.474	S	S	.	.	B	Isolated β-bridge	trans	-50.7	131.9	169.2	-34.3	41	0	0	0	115.1	L76 M84	L76-P82 HydrophobicContact CD2-CG 4.47Å; P82-M84 HydrophobicContact CB-SD 4.31Å; P82-M84 PolarHBondContact O-N 3.3Å
83	V	95	Very high	93.2	Very high	35 Å²	35	102.2 Å²	102.2	21%	0.212	49%	0.485	C	S	.	.			trans	-79	91.3	170.7	-175.3	0	0	0	0	109.4	K75 T77 Q81 K85 H86 R87	K75-V83 HydrophobicContact CB-CB 4.4Å; K75-V83 HydrophobicContact CB-CG2 4.44Å; K75-V83 HydrophobicContact CD-CB 4.49Å; K75-V83 HydrophobicContact CD-CG2 4.42Å; K75-V83 HydrophobicContact CG-CB 4.29Å; K75-V83 HydrophobicContact CG-CG2 3.96Å; K75-V83 PolarHBondContact O-N 3.03Å; T77-V83 HydrophobicContact CG2-CG2 3.79Å; Q81-V83 PolarHBondContact O-N 3.04Å; V83-K85 VanDerWaalsContact C-N 3.34Å; V83-K85 PolarHBondContact O-N 3.36Å; V83-H86 HydrophobicContact CB-CB 4.05Å; V83-H86 HydrophobicContact CG1-CB 3.78Å; V83-H86 WeakPolarHBondContact O-CB 3.35Å; V83-H86 PolarHBondContact O-N 2.86Å; V83-H86 VanDerWaalsContact O-N 3.12Å; V83-R87 PolarHBondContact O-N 3.16Å; V83-R87 VanDerWaalsContact O-N 3.16Å
84	M	94.2	Very high	93	Very high	114 Å²	114	105.3 Å²	105.3	56%	0.562	50%	0.499	S	S	*	.	H	α-helix	trans	-58	-41	-176.4	-66.9	-57.6	-71.4	0	0	113.3	P82 H86 R87 I88	P82-M84 HydrophobicContact CB-SD 4.31Å; P82-M84 PolarHBondContact O-N 3.3Å; M84-H86 VanDerWaalsContact C-N 3.28Å; M84-H86 PolarHBondContact O-N 3.13Å; M84-R87 PolarHBondContact O-N 2.96Å; M84-R87 VanDerWaalsContact O-N 3.16Å; M84-I88 VanDerWaalsContact O-CG1 3.32Å; M84-I88 WeakPolarHBondContact O-CG1 3.47Å; M84-I88 PolarHBondContact O-N 3.09Å
85	K	94.3	Very high	92.9	Very high	180 Å²	180	105.2 Å²	105.2	78%	0.783	50%	0.502	S	S	*	.	H	α-helix	trans	-56.2	-41.3	176.4	-174.3	177.2	-177.7	176.3	0	112.5	V83 K89	V83-K85 VanDerWaalsContact C-N 3.34Å; V83-K85 PolarHBondContact O-N 3.36Å; K85-K89 WeakPolarHBondContact O-CB 3.42Å; K85-K89 PolarHBondContact O-N 3.1Å; K85-K89 VanDerWaalsContact O-N 3.07Å
86	H	94.1	Very high	92.7	Very high	51 Å²	51	102.2 Å²	102.2	24%	0.236	50%	0.495	C	S	.	.	H	α-helix	trans	-67.1	-46.4	177.3	175	75.1	0	0	0	111.2	S72 K75 V83 M84 K89 L90	S72-H86 PolarHBondContact O-NE2 3.45Å; K75-H86 VanDerWaalsContact CB-CD2 3.46Å; K75-H86 WeakPolarHBondContact CB-CD2 3.37Å; K75-H86 HydrophobicContact CD-CB 4.08Å; V83-H86 HydrophobicContact CB-CB 4.05Å; V83-H86 HydrophobicContact CG1-CB 3.78Å; V83-H86 WeakPolarHBondContact O-CB 3.35Å; V83-H86 PolarHBondContact O-N 2.86Å; V83-H86 VanDerWaalsContact O-N 3.12Å; M84-H86 VanDerWaalsContact C-N 3.28Å; M84-H86 PolarHBondContact O-N 3.13Å; H86-K89 PolarHBondContact O-N 2.85Å; H86-L90 WeakPolarHBondContact NE2-CD1 3.39Å; H86-L90 WeakPolarHBondContact O-CG 3.32Å; H86-L90 PolarHBondContact O-N 3.19Å
87	R	92.8	Very high	91.8	Very high	73 Å²	73	103.4 Å²	103.4	28%	0.275	51%	0.508	S	S	.	.	H	α-helix	trans	-61	-47.6	178.1	-67.4	-176.5	172.6	-176.6	-0.1	112.2	M73 V83 M84 K89 L90 L91	M73-R87 HydrophobicContact CB-CG 4.09Å; M73-R87 HydrophobicContact CG-CG 4.21Å; M73-R87 PolarHBondContact O-NE 3.48Å; V83-R87 PolarHBondContact O-N 3.16Å; V83-R87 VanDerWaalsContact O-N 3.16Å; M84-R87 PolarHBondContact O-N 2.96Å; M84-R87 VanDerWaalsContact O-N 3.16Å; R87-K89 VanDerWaalsContact C-N 3.33Å; R87-K89 PolarHBondContact O-N 3.16Å; R87-L90 PolarHBondContact O-N 2.91Å; R87-L91 WeakPolarHBondContact O-CG 3.42Å; R87-L91 PolarHBondContact O-N 2.74Å
88	I	92.6	Very high	91	Very high	84 Å²	84	103.6 Å²	103.6	43%	0.431	52%	0.522	S	S	.	.	H	α-helix	trans	-60	-44.9	177.6	-66.3	165.5	0	0	0	110.2	M84 L90 L91 L92	M84-I88 VanDerWaalsContact O-CG1 3.32Å; M84-I88 WeakPolarHBondContact O-CG1 3.47Å; M84-I88 PolarHBondContact O-N 3.09Å; I88-L90 VanDerWaalsContact C-N 3.31Å; I88-L90 PolarHBondContact O-N 3.49Å; I88-L91 PolarHBondContact O-N 3.45Å; I88-L91 VanDerWaalsContact O-N 3.13Å; I88-L92 HydrophobicContact CG2-CD1 3.83Å; I88-L92 HydrophobicContact CG2-CG 4.14Å; I88-L92 WeakPolarHBondContact O-CG 3.37Å; I88-L92 PolarHBondContact O-N 2.88Å
89	K	92.6	Very high	89.7	Confident	159 Å²	159	97.3 Å²	97.3	69%	0.691	51%	0.508	S	S	*	.	H	α-helix	trans	-56.7	-44.5	175.9	-175.4	177.6	-178.9	176.7	0	112.1	K85 H86 R87 K93	K85-K89 WeakPolarHBondContact O-CB 3.42Å; K85-K89 PolarHBondContact O-N 3.1Å; K85-K89 VanDerWaalsContact O-N 3.07Å; H86-K89 PolarHBondContact O-N 2.85Å; R87-K89 VanDerWaalsContact C-N 3.33Å; R87-K89 PolarHBondContact O-N 3.16Å; K89-K93 PolarHBondContact O-N 3.46Å; K89-K93 VanDerWaalsContact O-N 3.1Å
90	L	91.9	Very high	87.7	Confident	42 Å²	42	96 Å²	96	22%	0.22	52%	0.523	C	S	.	.	H	α-helix	trans	-64.7	-39.1	176.7	-70.8	177.7	0	0	0	112.5	S72 M73 H86 R87 I88 Q94	S72-L90 WeakPolarHBondContact O-CD1 3.38Å; M73-L90 HydrophobicContact CG-CD1 3.93Å; H86-L90 WeakPolarHBondContact NE2-CD1 3.39Å; H86-L90 WeakPolarHBondContact O-CG 3.32Å; H86-L90 PolarHBondContact O-N 3.19Å; R87-L90 PolarHBondContact O-N 2.91Å; I88-L90 VanDerWaalsContact C-N 3.31Å; I88-L90 PolarHBondContact O-N 3.49Å; L90-Q94 WeakPolarHBondContact O-CG 3.42Å; L90-Q94 PolarHBondContact O-N 3.14Å
91	L	90.9	Very high	87.4	Confident	74 Å²	74	98.7 Å²	98.7	39%	0.387	53%	0.527	S	S	.	.	H	α-helix	trans	-68	-43.5	177.6	-69.5	171.9	0	0	0	112	M73 R87 I88 K93 Q94 L95	M73-L91 HydrophobicContact SD-CD2 4.41Å; R87-L91 WeakPolarHBondContact O-CG 3.42Å; R87-L91 PolarHBondContact O-N 2.74Å; I88-L91 PolarHBondContact O-N 3.45Å; I88-L91 VanDerWaalsContact O-N 3.13Å; L91-K93 PolarHBondContact O-N 3.16Å; L91-Q94 WeakPolarHBondContact O-CB 3.42Å; L91-Q94 PolarHBondContact O-N 3.12Å; L91-Q94 VanDerWaalsContact O-N 3.09Å; L91-L95 PolarHBondContact O-N 3.1Å
92	L	91.5	Very high	87	Confident	98 Å²	98	97.4 Å²	97.4	51%	0.513	53%	0.525	S	S	.	.	H	α-helix	trans	-62	-43.1	177.5	-71.4	174.8	0	0	0	111.5	I88 Q94 L95 C96	I88-L92 HydrophobicContact CG2-CD1 3.83Å; I88-L92 HydrophobicContact CG2-CG 4.14Å; I88-L92 WeakPolarHBondContact O-CG 3.37Å; I88-L92 PolarHBondContact O-N 2.88Å; L92-Q94 PolarHBondContact O-N 3.03Å; L92-Q94 VanDerWaalsContact O-N 3.16Å; L92-L95 PolarHBondContact O-N 3.07Å; L92-C96 PolarHBondContact O-N 3.32Å
93	K	89.8	Confident	86.6	Confident	137 Å²	137	100.3 Å²	100.3	60%	0.596	54%	0.537	S	S	*	.	H	α-helix	trans	-57.9	-29.9	174.6	-172.5	175.1	-178.3	177.4	0	112.9	K89 L91	K89-K93 PolarHBondContact O-N 3.46Å; K89-K93 VanDerWaalsContact O-N 3.1Å; L91-K93 PolarHBondContact O-N 3.16Å
94	Q	87.3	Confident	86.1	Confident	95 Å²	95	104.1 Å²	104.1	44%	0.444	56%	0.557	S	S	.	*	H	α-helix	trans	-77.5	-30.3	176.9	-70.7	176.3	8.1	0	0	113.2	L90 L91 L92	L90-Q94 WeakPolarHBondContact O-CG 3.42Å; L90-Q94 PolarHBondContact O-N 3.14Å; L91-Q94 WeakPolarHBondContact O-CB 3.42Å; L91-Q94 PolarHBondContact O-N 3.12Å; L91-Q94 VanDerWaalsContact O-N 3.09Å; L92-Q94 PolarHBondContact O-N 3.03Å; L92-Q94 VanDerWaalsContact O-N 3.16Å
95	L	88.9	Confident	85.6	Confident	138 Å²	138	103.5 Å²	103.5	72%	0.723	56%	0.556	S	S	*	*	H	α-helix	trans	-81.8	-36	178.9	-65.3	174.2	0	0	0	111.6	L91 L92 P97	L91-L95 PolarHBondContact O-N 3.1Å; L92-L95 PolarHBondContact O-N 3.07Å; L95-P97 WeakPolarHBondContact O-CD 3.38Å
96	C	87.9	Confident	85.1	Confident	53 Å²	53	98.4 Å²	98.4	36%	0.358	54%	0.541	S	S	.	.			trans	-121.6	78.6	-179.7	-59.3	0	0	0	0	110.6	L92 G98 D99	L92-C96 PolarHBondContact O-N 3.32Å; C96-G98 PolarHBondContact O-N 3.04Å; C96-D99 HydrophobicContact CB-CB 3.83Å; C96-D99 VanDerWaalsContact CB-OD2 3.26Å; C96-D99 WeakPolarHBondContact CB-OD2 3.26Å; C96-D99 PolarHBondContact O-N 3.33Å; C96-D99 PolarHBondContact SG-OD2 3.25Å
97	P	78.2	Confident	84.4	Confident	114 Å²	114	101.8 Å²	101.8	74%	0.74	56%	0.563	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.6	-4.7	-177.1	24.8	-32.9	0	0	0	115.1	L95	L95-P97 WeakPolarHBondContact O-CD 3.38Å
98	G	77	Confident	83.8	Confident	65 Å²	65	104 Å²	104	67%	0.67	59%	0.585	S	S	*	*	T	Hydrogen-bonded Turn	trans	-110	-8.9	176.6	0	0	0	0	0	115.3	C96 S100	C96-G98 PolarHBondContact O-N 3.04Å; G98-S100 PolarHBondContact O-N 3.27Å
99	D	65.6	Low	83	Confident	131 Å²	131	105.7 Å²	105.7	70%	0.701	60%	0.598	S	S	*	*			trans	-95.9	73.7	-176.7	-62.3	-17.7	0	0	0	109.5	C96	C96-D99 HydrophobicContact CB-CB 3.83Å; C96-D99 VanDerWaalsContact CB-OD2 3.26Å; C96-D99 WeakPolarHBondContact CB-OD2 3.26Å; C96-D99 PolarHBondContact O-N 3.33Å; C96-D99 PolarHBondContact SG-OD2 3.25Å
100	S	55	Low	82.2	Confident	162 Å²	162	100.8 Å²	100.8	100%	1.133	59%	0.589	S	S	*	*			trans	-148.2	0	168.7	59.3	0	0	0	0	112	G98	G98-S100 PolarHBondContact O-N 3.27Å

Retrieved 100 of 100 residues in 24.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).