G4VHU9_SCHMA Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession G4VHU9, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 102 aa.

						>G4VHU9_SCHMA|G4VHU9
MGLCVGIGFCILPIVLIQCFFPDSSWRKLAFSLPCFVITVCGGISYFFTMCFSWQLVVELCLLSSLFELLVTVNFSGCLDSVHVTDSLLFQLNKQLQRMSRN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.4	Very low	58	Low	219 Å²	219	88.7 Å²	88.7	100%	1.079	51%	0.514	S	S	*	.				0	-25.9	0	-69.7	-179	170.5	0	0	113.9
2	G	51.2	Low	58.9	Low	33 Å²	33	90.8 Å²	90.8	34%	0.34	52%	0.521	S	S	.	.	H	α-helix	trans	-66	-36.6	-178.4	0	0	0	0	0	116.5	C4 V5 G6 Y46	G2-C4 VanDerWaalsContact C-N 3.28Å; G2-C4 PolarHBondContact O-N 3.35Å; G2-V5 PolarHBondContact O-N 3.46Å; G2-G6 PolarHBondContact O-N 2.85Å; G2-G6 VanDerWaalsContact O-N 3.17Å; G2-Y46 VanDerWaalsContact C-CE2 3.44Å; G2-Y46 WeakPolarHBondContact O-CE2 3.39Å
3	L	51.2	Low	59.4	Low	102 Å²	102	87.1 Å²	87.1	53%	0.534	50%	0.502	S	S	.	.	H	α-helix	trans	-56.7	-42.3	-177.8	-83.8	165.8	0	0	0	112	G6 I7 Y46	L3-G6 PolarHBondContact O-N 3.35Å; L3-I7 WeakPolarHBondContact O-CB 3.32Å; L3-I7 WeakPolarHBondContact O-CD1 3.43Å; L3-I7 VanDerWaalsContact O-CG1 3.25Å; L3-I7 WeakPolarHBondContact O-CG1 3.48Å; L3-I7 PolarHBondContact O-N 3.48Å; L3-Y46 VanDerWaalsContact CA-OH 3.25Å; L3-Y46 WeakPolarHBondContact CA-OH 3.47Å; L3-Y46 HydrophobicContact CD2-CE1 3.79Å; L3-Y46 WeakPolarHBondContact CD2-OH 3.38Å; L3-Y46 HydrophobicContact CG-CE1 4.45Å; L3-Y46 WeakPolarHBondContact CG-OH 3.41Å; L3-Y46 PolarHBondContact N-OH 3.4Å
4	C	55.8	Low	60.1	Low	100 Å²	100	86.2 Å²	86.2	68%	0.676	49%	0.493	S	S	*	.	H	α-helix	trans	-68.7	-35.6	-178.1	-58.8	0	0	0	0	112.8	G2 G8	G2-C4 VanDerWaalsContact C-N 3.28Å; G2-C4 PolarHBondContact O-N 3.35Å; C4-G8 PolarHBondContact O-N 2.98Å
5	V	57	Low	60.5	Low	108 Å²	108	85.1 Å²	85.1	66%	0.655	49%	0.489	S	S	*	.	H	α-helix	trans	-69.9	-41.7	179	-177.5	0	0	0	0	110.4	G2 F9	G2-V5 PolarHBondContact O-N 3.46Å; V5-F9 VanDerWaalsContact O-CB 3.27Å; V5-F9 WeakPolarHBondContact O-CB 3.3Å; V5-F9 PolarHBondContact O-N 2.9Å
6	G	58.7	Low	60.9	Low	21 Å²	21	85.8 Å²	85.8	22%	0.216	49%	0.49	C	S	.	.	H	α-helix	trans	-65.7	-49.3	177.1	0	0	0	0	0	112.8	G2 L3 G8 F9 C10	G2-G6 PolarHBondContact O-N 2.85Å; G2-G6 VanDerWaalsContact O-N 3.17Å; L3-G6 PolarHBondContact O-N 3.35Å; G6-G8 PolarHBondContact O-N 3.39Å; G6-F9 PolarHBondContact O-N 3.21Å; G6-C10 PolarHBondContact O-N 3.16Å; G6-C10 VanDerWaalsContact O-N 3.07Å; G6-C10 PolarHBondContact O-SG 3.46Å
7	I	61.8	Low	61.1	Low	100 Å²	100	83.1 Å²	83.1	51%	0.513	47%	0.473	S	S	.	.	H	α-helix	trans	-64.5	-43.2	179	-63.8	162.5	0	0	0	110.5	L3 F9 C10 I11	L3-I7 WeakPolarHBondContact O-CB 3.32Å; L3-I7 WeakPolarHBondContact O-CD1 3.43Å; L3-I7 VanDerWaalsContact O-CG1 3.25Å; L3-I7 WeakPolarHBondContact O-CG1 3.48Å; L3-I7 PolarHBondContact O-N 3.48Å; I7-F9 PolarHBondContact O-N 3.37Å; I7-C10 PolarHBondContact O-N 3.43Å; I7-I11 HydrophobicContact CG2-CD1 4.48Å; I7-I11 HydrophobicContact CG2-CG1 3.85Å; I7-I11 WeakPolarHBondContact O-CB 3.37Å; I7-I11 WeakPolarHBondContact O-CG1 3.44Å; I7-I11 PolarHBondContact O-N 3.12Å
8	G	62.3	Low	61.3	Low	39 Å²	39	86.8 Å²	86.8	40%	0.402	49%	0.486	S	S	.	.	H	α-helix	trans	-60.8	-44.3	177.4	0	0	0	0	0	112.6	C4 G6 C10 L12	C4-G8 PolarHBondContact O-N 2.98Å; G6-G8 PolarHBondContact O-N 3.39Å; G8-C10 VanDerWaalsContact C-N 3.32Å; G8-C10 PolarHBondContact O-N 2.96Å; G8-L12 WeakPolarHBondContact O-CB 3.28Å; G8-L12 PolarHBondContact O-N 3.17Å
9	F	64.5	Low	61.5	Low	137 Å²	137	87.4 Å²	87.4	60%	0.601	50%	0.495	S	S	*	.	H	α-helix	trans	-65.7	-32.7	177.2	-169	-95.9	0	0	0	112.9	V5 G6 I7 P13 I38	V5-F9 VanDerWaalsContact O-CB 3.27Å; V5-F9 WeakPolarHBondContact O-CB 3.3Å; V5-F9 PolarHBondContact O-N 2.9Å; G6-F9 PolarHBondContact O-N 3.21Å; I7-F9 PolarHBondContact O-N 3.37Å; F9-P13 WeakPolarHBondContact O-CD 3.43Å; F9-P13 WeakPolarHBondContact O-CG 3.49Å; F9-I38 HydrophobicContact CE1-CG2 4.17Å
10	C	61.1	Low	61.5	Low	24 Å²	24	90.5 Å²	90.5	16%	0.162	50%	0.503	C	S	.	.	H	α-helix	trans	-79.1	-39.1	177.8	-67.2	0	0	0	0	113.3	G6 I7 G8 I14 T39	G6-C10 PolarHBondContact O-N 3.16Å; G6-C10 VanDerWaalsContact O-N 3.07Å; G6-C10 PolarHBondContact O-SG 3.46Å; I7-C10 PolarHBondContact O-N 3.43Å; G8-C10 VanDerWaalsContact C-N 3.32Å; G8-C10 PolarHBondContact O-N 2.96Å; C10-I14 WeakPolarHBondContact O-CD1 3.46Å; C10-I14 WeakPolarHBondContact O-CG1 3.31Å; C10-T39 HydrophobicContact CB-CG2 3.99Å
11	I	67.7	Low	61.4	Low	93 Å²	93	90.2 Å²	90.2	48%	0.477	50%	0.496	S	S	.	.	H	α-helix	trans	-75.3	-39.3	-177.4	-61.5	-97.2	0	0	0	110.8	I7 I14 V15	I7-I11 HydrophobicContact CG2-CD1 4.48Å; I7-I11 HydrophobicContact CG2-CG1 3.85Å; I7-I11 WeakPolarHBondContact O-CB 3.37Å; I7-I11 WeakPolarHBondContact O-CG1 3.44Å; I7-I11 PolarHBondContact O-N 3.12Å; I11-I14 PolarHBondContact O-N 2.85Å; I11-I14 VanDerWaalsContact O-N 3.15Å; I11-V15 HydrophobicContact CG2-CG2 3.73Å; I11-V15 WeakPolarHBondContact O-CG2 3.48Å; I11-V15 PolarHBondContact O-N 3.45Å
12	L	68.6	Low	62	Low	114 Å²	114	83.6 Å²	83.6	60%	0.597	47%	0.47	S	S	*	.	H	α-helix	trans	-53.3	-52	-174.7	-171.4	70.8	0	0	0	113.4	G8 I14 V15 L16	G8-L12 WeakPolarHBondContact O-CB 3.28Å; G8-L12 PolarHBondContact O-N 3.17Å; L12-I14 PolarHBondContact O-N 3.39Å; L12-V15 PolarHBondContact O-N 3.26Å; L12-L16 VanDerWaalsContact O-CB 3.32Å; L12-L16 WeakPolarHBondContact O-CB 3.34Å; L12-L16 PolarHBondContact O-N 3.26Å
13	P	66.3	Low	62.6	Low	42 Å²	42	89.2 Å²	89.2	27%	0.273	49%	0.492	S	S	.	.	H	α-helix	trans	-67.3	-32.7	179.5	24.6	-32.6	0	0	0	113.2	F9 L16 I17	F9-P13 WeakPolarHBondContact O-CD 3.43Å; F9-P13 WeakPolarHBondContact O-CG 3.49Å; P13-L16 PolarHBondContact O-N 2.92Å; P13-I17 WeakPolarHBondContact O-CB 3.29Å; P13-I17 WeakPolarHBondContact O-CG1 3.26Å; P13-I17 PolarHBondContact O-N 3.47Å
14	I	69.2	Low	63.3	Low	75 Å²	75	86.3 Å²	86.3	39%	0.385	48%	0.48	S	S	.	.	H	α-helix	trans	-64.6	-48.1	178	-63.1	171	0	0	0	110.1	C10 I11 L12 L16 I17 Q18	C10-I14 WeakPolarHBondContact O-CD1 3.46Å; C10-I14 WeakPolarHBondContact O-CG1 3.31Å; I11-I14 PolarHBondContact O-N 2.85Å; I11-I14 VanDerWaalsContact O-N 3.15Å; L12-I14 PolarHBondContact O-N 3.39Å; I14-L16 VanDerWaalsContact C-N 3.34Å; I14-I17 PolarHBondContact O-N 2.99Å; I14-Q18 WeakPolarHBondContact O-CG 3.46Å; I14-Q18 PolarHBondContact O-N 3.3Å; I14-Q18 VanDerWaalsContact O-N 3.08Å
15	V	66.3	Low	63.9	Low	70 Å²	70	86 Å²	86	42%	0.424	48%	0.479	S	S	.	.	H	α-helix	trans	-63.5	-42.8	176.8	176.6	0	0	0	0	110.3	I11 L12 I17 Q18 C19	I11-V15 HydrophobicContact CG2-CG2 3.73Å; I11-V15 WeakPolarHBondContact O-CG2 3.48Å; I11-V15 PolarHBondContact O-N 3.45Å; L12-V15 PolarHBondContact O-N 3.26Å; V15-I17 VanDerWaalsContact C-N 3.34Å; V15-I17 PolarHBondContact O-N 3.43Å; V15-Q18 PolarHBondContact O-N 2.94Å; V15-C19 WeakPolarHBondContact O-CB 3.39Å; V15-C19 PolarHBondContact O-N 3.45Å; V15-C19 PolarHBondContact O-SG 2.87Å
16	L	66.3	Low	64.3	Low	96 Å²	96	91.6 Å²	91.6	50%	0.503	49%	0.489	S	S	.	.	H	α-helix	trans	-62.8	-40.1	-179.6	-141.4	140.5	0	0	0	111.8	L12 P13 I14 C19 F20	L12-L16 VanDerWaalsContact O-CB 3.32Å; L12-L16 WeakPolarHBondContact O-CB 3.34Å; L12-L16 PolarHBondContact O-N 3.26Å; P13-L16 PolarHBondContact O-N 2.92Å; I14-L16 VanDerWaalsContact C-N 3.34Å; L16-C19 PolarHBondContact O-N 2.94Å; L16-F20 HydrophobicContact CD2-CD2 4.34Å; L16-F20 WeakPolarHBondContact O-CB 3.43Å; L16-F20 PolarHBondContact O-N 3.12Å
17	I	64.2	Low	64.6	Low	40 Å²	40	96 Å²	96	21%	0.205	50%	0.499	C	S	.	.	H	α-helix	trans	-68.2	-42	176.5	-76.6	164.9	0	0	0	112.2	P13 I14 V15 C19 F20 F21 F31 C35	P13-I17 WeakPolarHBondContact O-CB 3.29Å; P13-I17 WeakPolarHBondContact O-CG1 3.26Å; P13-I17 PolarHBondContact O-N 3.47Å; I14-I17 PolarHBondContact O-N 2.99Å; V15-I17 VanDerWaalsContact C-N 3.34Å; V15-I17 PolarHBondContact O-N 3.43Å; I17-C19 VanDerWaalsContact C-N 3.29Å; I17-C19 PolarHBondContact O-N 2.91Å; I17-F20 PolarHBondContact O-N 3.06Å; I17-F21 PolarHBondContact O-N 3.38Å; I17-F31 HydrophobicContact CD1-CB 4.26Å; I17-F31 HydrophobicContact CD1-CD1 4.41Å; I17-C35 HydrophobicContact CD1-CB 4.28Å; I17-C35 WeakPolarHBondContact CD1-SG 3.46Å
18	Q	65	Low	64.9	Low	150 Å²	150	95.9 Å²	95.9	70%	0.701	49%	0.494	S	S	*	.	H	α-helix	trans	-63.5	-36.6	175.8	-74.1	-175.4	-19.2	0	0	111.8	I14 V15	I14-Q18 WeakPolarHBondContact O-CG 3.46Å; I14-Q18 PolarHBondContact O-N 3.3Å; I14-Q18 VanDerWaalsContact O-N 3.08Å; V15-Q18 PolarHBondContact O-N 2.94Å
19	C	64	Low	65.1	Low	98 Å²	98	100 Å²	100	66%	0.662	51%	0.507	S	S	*	.	H	α-helix	trans	-73.6	-35.9	176.4	-73.1	0	0	0	0	113.8	V15 L16 I17	V15-C19 WeakPolarHBondContact O-CB 3.39Å; V15-C19 PolarHBondContact O-N 3.45Å; V15-C19 PolarHBondContact O-SG 2.87Å; L16-C19 PolarHBondContact O-N 2.94Å; I17-C19 VanDerWaalsContact C-N 3.29Å; I17-C19 PolarHBondContact O-N 2.91Å
20	F	63.1	Low	65.5	Low	149 Å²	149	96.7 Å²	96.7	65%	0.654	51%	0.505	S	S	*	.	H	α-helix	trans	-88.3	-22.6	-169.6	-123.2	-95.7	0	0	0	115.4	L16 I17	L16-F20 HydrophobicContact CD2-CD2 4.34Å; L16-F20 WeakPolarHBondContact O-CB 3.43Å; L16-F20 PolarHBondContact O-N 3.12Å; I17-F20 PolarHBondContact O-N 3.06Å
21	F	58.7	Low	65.7	Low	84 Å²	84	100.4 Å²	100.4	37%	0.368	52%	0.518	S	S	.	.			trans	-136.7	81.8	-174.3	-77.5	-70.8	0	0	0	114.4	I17 K28	I17-F21 PolarHBondContact O-N 3.38Å; F21-K28 VanDerWaalsContact O-CE 3.3Å; F21-K28 WeakPolarHBondContact O-CE 3.32Å
22	P	59.2	Low	65.9	Low	80 Å²	80	98.6 Å²	98.6	52%	0.519	51%	0.514	S	S	.	.			trans	-67.5	-30.4	176.6	18.3	-26	0	0	0	115.9	K28	P22-K28 WeakPolarHBondContact O-CE 3.49Å; P22-K28 PolarHBondContact O-NZ 3.49Å
23	D	64.1	Low	66.1	Low	152 Å²	152	98.8 Å²	98.8	81%	0.813	52%	0.515	S	S	*	.	S	Bend	trans	-111.2	3.8	-153.5	-72.3	-55	0	0	0	120.5
24	S	65.1	Low	66.5	Low	40 Å²	40	99.9 Å²	99.9	28%	0.28	52%	0.522	S	S	.	.			trans	-135.9	113.7	175.6	50.9	0	0	0	0	114.6	W26 R27 K28	S24-W26 VanDerWaalsContact C-N 3.26Å; S24-W26 PolarHBondContact O-N 2.87Å; S24-R27 PolarHBondContact O-N 3.41Å; S24-R27 VanDerWaalsContact O-N 3.12Å; S24-R27 WeakPolarHBondContact OG-CB 3.4Å; S24-R27 WeakPolarHBondContact OG-CD 3.26Å; S24-R27 VanDerWaalsContact OG-CG 3.26Å; S24-R27 WeakPolarHBondContact OG-CG 3.26Å; S24-K28 PolarHBondContact O-N 2.72Å; S24-K28 VanDerWaalsContact O-N 3.09Å
25	S	69.5	Low	66.6	Low	93 Å²	93	97.3 Å²	97.3	65%	0.65	51%	0.511	S	S	*	.	H	α-helix	trans	-55.8	-35.7	-178.1	-53.8	0	0	0	0	113.7	L29	S25-L29 PolarHBondContact O-N 3.36Å
26	W	65.5	Low	67.1	Low	227 Å²	227	100.7 Å²	100.7	86%	0.86	52%	0.52	S	S	*	.	H	α-helix	trans	-70.9	-39.1	178.2	-62.1	87.9	0	0	0	112.7	S24 K28 L29 A30	S24-W26 VanDerWaalsContact C-N 3.26Å; S24-W26 PolarHBondContact O-N 2.87Å; W26-K28 VanDerWaalsContact C-N 3.33Å; W26-L29 PolarHBondContact O-N 3.44Å; W26-A30 WeakPolarHBondContact O-CB 3.34Å; W26-A30 PolarHBondContact O-N 3.38Å
27	R	65	Low	67.8	Low	112 Å²	112	99.7 Å²	99.7	42%	0.423	52%	0.517	S	S	.	.	H	α-helix	trans	-69.5	-34.7	176.8	-62	-177.7	95.9	-110.6	9.6	110.8	S24 L29 A30 F31	S24-R27 PolarHBondContact O-N 3.41Å; S24-R27 VanDerWaalsContact O-N 3.12Å; S24-R27 WeakPolarHBondContact OG-CB 3.4Å; S24-R27 WeakPolarHBondContact OG-CD 3.26Å; S24-R27 VanDerWaalsContact OG-CG 3.26Å; S24-R27 WeakPolarHBondContact OG-CG 3.26Å; R27-L29 PolarHBondContact O-N 3.09Å; R27-A30 PolarHBondContact O-N 2.87Å; R27-F31 WeakPolarHBondContact O-CB 3.46Å; R27-F31 PolarHBondContact O-N 2.99Å
28	K	67.1	Low	68.5	Low	98 Å²	98	102.1 Å²	102.1	43%	0.426	53%	0.53	S	S	.	.	H	α-helix	trans	-57.6	-47.2	171.4	-71.6	177.1	-176.8	170.7	0	111.3	F21 P22 S24 W26 F31 S32	F21-K28 VanDerWaalsContact O-CE 3.3Å; F21-K28 WeakPolarHBondContact O-CE 3.32Å; P22-K28 WeakPolarHBondContact O-CE 3.49Å; P22-K28 PolarHBondContact O-NZ 3.49Å; S24-K28 PolarHBondContact O-N 2.72Å; S24-K28 VanDerWaalsContact O-N 3.09Å; W26-K28 VanDerWaalsContact C-N 3.33Å; K28-F31 PolarHBondContact O-N 2.94Å; K28-S32 WeakPolarHBondContact O-CB 3.33Å; K28-S32 PolarHBondContact O-N 2.96Å; K28-S32 PolarHBondContact O-OG 2.89Å
29	L	67.4	Low	69.1	Low	125 Å²	125	96.8 Å²	96.8	65%	0.654	51%	0.508	S	S	*	.	H	α-helix	trans	-66.9	-44.8	179.7	-140.6	94	0	0	0	112.6	S25 W26 R27 F31 S32 L33	S25-L29 PolarHBondContact O-N 3.36Å; W26-L29 PolarHBondContact O-N 3.44Å; R27-L29 PolarHBondContact O-N 3.09Å; L29-F31 PolarHBondContact O-N 2.9Å; L29-S32 WeakPolarHBondContact CA-OG 3.4Å; L29-S32 PolarHBondContact O-N 3.41Å; L29-S32 PolarHBondContact O-OG 2.99Å; L29-L33 PolarHBondContact O-N 3.29Å
30	A	71.4	Confident	69.8	Low	68 Å²	68	95.1 Å²	95.1	56%	0.562	49%	0.494	S	S	*	.	H	α-helix	trans	-62.3	-33	179.6	0	0	0	0	0	112.4	W26 R27 P34	W26-A30 WeakPolarHBondContact O-CB 3.34Å; W26-A30 PolarHBondContact O-N 3.38Å; R27-A30 PolarHBondContact O-N 2.87Å; A30-P34 WeakPolarHBondContact O-CD 3.42Å; A30-P34 WeakPolarHBondContact O-CG 3.41Å
31	F	67.1	Low	70.6	Confident	102 Å²	102	91.1 Å²	91.1	45%	0.447	48%	0.484	S	S	.	.	H	α-helix	trans	-88	-28.9	175.1	-90.3	-88.5	0	0	0	113.8	I17 R27 K28 L29 P34 C35	I17-F31 HydrophobicContact CD1-CB 4.26Å; I17-F31 HydrophobicContact CD1-CD1 4.41Å; R27-F31 WeakPolarHBondContact O-CB 3.46Å; R27-F31 PolarHBondContact O-N 2.99Å; K28-F31 PolarHBondContact O-N 2.94Å; L29-F31 PolarHBondContact O-N 2.9Å; F31-P34 WeakPolarHBondContact O-CD 3.43Å; F31-C35 PolarHBondContact O-N 3.26Å; F31-C35 PolarHBondContact O-SG 3.34Å
32	S	71.3	Confident	71.6	Confident	56 Å²	56	88.3 Å²	88.3	39%	0.392	48%	0.479	S	S	.	.	H	α-helix	trans	-68.9	-36.3	179.9	67.1	0	0	0	0	112	K28 L29 C35 F36	K28-S32 WeakPolarHBondContact O-CB 3.33Å; K28-S32 PolarHBondContact O-N 2.96Å; K28-S32 PolarHBondContact O-OG 2.89Å; L29-S32 WeakPolarHBondContact CA-OG 3.4Å; L29-S32 PolarHBondContact O-N 3.41Å; L29-S32 PolarHBondContact O-OG 2.99Å; S32-C35 PolarHBondContact O-N 2.9Å; S32-F36 VanDerWaalsContact O-CB 3.31Å; S32-F36 WeakPolarHBondContact O-CB 3.33Å; S32-F36 PolarHBondContact O-N 3.21Å
33	L	73.5	Confident	72.6	Confident	118 Å²	118	86.3 Å²	86.3	62%	0.618	47%	0.473	S	S	*	.	H	α-helix	trans	-66.4	-49.6	-175.2	-165	117.4	0	0	0	112.7	L29 C35 F36 V37	L29-L33 PolarHBondContact O-N 3.29Å; L33-C35 VanDerWaalsContact C-N 3.3Å; L33-C35 PolarHBondContact O-N 2.86Å; L33-F36 PolarHBondContact O-N 3.38Å; L33-V37 WeakPolarHBondContact O-CG2 3.49Å; L33-V37 PolarHBondContact O-N 2.85Å
34	P	74.8	Confident	73.3	Confident	65 Å²	65	83.2 Å²	83.2	42%	0.422	46%	0.455	S	S	.	.	H	α-helix	trans	-59.7	-39.5	172.5	-22.1	32.5	0	0	0	112.6	A30 F31 V37 I38	A30-P34 WeakPolarHBondContact O-CD 3.42Å; A30-P34 WeakPolarHBondContact O-CG 3.41Å; F31-P34 WeakPolarHBondContact O-CD 3.43Å; P34-V37 PolarHBondContact O-N 2.85Å; P34-I38 VanDerWaalsContact O-CG1 3.27Å; P34-I38 WeakPolarHBondContact O-CG1 3.41Å; P34-I38 PolarHBondContact O-N 3.39Å
35	C	70.1	Confident	74	Confident	21 Å²	21	84.6 Å²	84.6	14%	0.142	47%	0.465	C	S	.	.	H	α-helix	trans	-67.4	-39.2	179.9	-67.6	0	0	0	0	112.4	I17 F31 S32 L33 I38 T39	I17-C35 HydrophobicContact CD1-CB 4.28Å; I17-C35 WeakPolarHBondContact CD1-SG 3.46Å; F31-C35 PolarHBondContact O-N 3.26Å; F31-C35 PolarHBondContact O-SG 3.34Å; S32-C35 PolarHBondContact O-N 2.9Å; L33-C35 VanDerWaalsContact C-N 3.3Å; L33-C35 PolarHBondContact O-N 2.86Å; C35-I38 PolarHBondContact O-N 3.47Å; C35-T39 VanDerWaalsContact O-CB 3.3Å; C35-T39 WeakPolarHBondContact O-CB 3.32Å; C35-T39 PolarHBondContact O-N 2.9Å; C35-T39 PolarHBondContact O-OG1 3.46Å
36	F	77.1	Confident	74.5	Confident	141 Å²	141	82.6 Å²	82.6	62%	0.618	44%	0.443	S	S	*	.	H	α-helix	trans	-61.3	-45.7	172.8	180	-100.3	0	0	0	110.9	S32 L33 T39 V40	S32-F36 VanDerWaalsContact O-CB 3.31Å; S32-F36 WeakPolarHBondContact O-CB 3.33Å; S32-F36 PolarHBondContact O-N 3.21Å; L33-F36 PolarHBondContact O-N 3.38Å; F36-T39 WeakPolarHBondContact O-CB 3.47Å; F36-T39 PolarHBondContact O-N 3.44Å; F36-V40 HydrophobicContact CD1-CG2 4.25Å; F36-V40 HydrophobicContact CD2-CG2 4.49Å; F36-V40 HydrophobicContact CE1-CG2 3.85Å; F36-V40 HydrophobicContact CE2-CG2 4.11Å; F36-V40 HydrophobicContact CZ-CG2 3.77Å; F36-V40 WeakPolarHBondContact O-CG2 3.44Å; F36-V40 PolarHBondContact O-N 3.39Å
37	V	80.3	Confident	75.2	Confident	74 Å²	74	78 Å²	78	45%	0.448	43%	0.43	S	S	.	.	H	α-helix	trans	-60.8	-47.7	176.8	173.5	0	0	0	0	111.2	L33 P34 T39 V40 C41	L33-V37 WeakPolarHBondContact O-CG2 3.49Å; L33-V37 PolarHBondContact O-N 2.85Å; P34-V37 PolarHBondContact O-N 2.85Å; V37-T39 VanDerWaalsContact C-N 3.28Å; V37-T39 PolarHBondContact O-N 2.97Å; V37-V40 PolarHBondContact O-N 2.9Å; V37-C41 WeakPolarHBondContact O-CB 3.29Å; V37-C41 PolarHBondContact O-N 2.77Å; V37-C41 PolarHBondContact O-SG 3.45Å; V37-C41 VanDerWaalsContact O-SG 3.33Å
38	I	78.7	Confident	75.9	Confident	91 Å²	91	79.1 Å²	79.1	47%	0.467	44%	0.438	S	S	.	.	H	α-helix	trans	-60.3	-40.7	177.1	-68.5	164.3	0	0	0	110.8	F9 P34 C35 G42	F9-I38 HydrophobicContact CE1-CG2 4.17Å; P34-I38 VanDerWaalsContact O-CG1 3.27Å; P34-I38 WeakPolarHBondContact O-CG1 3.41Å; P34-I38 PolarHBondContact O-N 3.39Å; C35-I38 PolarHBondContact O-N 3.47Å; I38-G42 PolarHBondContact O-N 2.86Å
39	T	78.2	Confident	76.7	Confident	39 Å²	39	78.4 Å²	78.4	24%	0.239	44%	0.442	C	S	.	.	H	α-helix	trans	-64.5	-45.1	178.2	-60.4	0	0	0	0	111.4	C10 C35 F36 V37 G42 G43	C10-T39 HydrophobicContact CB-CG2 3.99Å; C35-T39 VanDerWaalsContact O-CB 3.3Å; C35-T39 WeakPolarHBondContact O-CB 3.32Å; C35-T39 PolarHBondContact O-N 2.9Å; C35-T39 PolarHBondContact O-OG1 3.46Å; F36-T39 WeakPolarHBondContact O-CB 3.47Å; F36-T39 PolarHBondContact O-N 3.44Å; V37-T39 VanDerWaalsContact C-N 3.28Å; V37-T39 PolarHBondContact O-N 2.97Å; T39-G42 PolarHBondContact O-N 2.9Å; T39-G43 PolarHBondContact O-N 3.48Å
40	V	79.5	Confident	77.2	Confident	62 Å²	62	76.3 Å²	76.3	38%	0.376	43%	0.43	S	S	.	.	H	α-helix	trans	-65.8	-47.1	177.2	171.7	0	0	0	0	110.6	F36 V37 G42 G43 I44	F36-V40 HydrophobicContact CD1-CG2 4.25Å; F36-V40 HydrophobicContact CD2-CG2 4.49Å; F36-V40 HydrophobicContact CE1-CG2 3.85Å; F36-V40 HydrophobicContact CE2-CG2 4.11Å; F36-V40 HydrophobicContact CZ-CG2 3.77Å; F36-V40 WeakPolarHBondContact O-CG2 3.44Å; F36-V40 PolarHBondContact O-N 3.39Å; V37-V40 PolarHBondContact O-N 2.9Å; V40-G42 VanDerWaalsContact C-N 3.33Å; V40-G42 PolarHBondContact O-N 3.43Å; V40-G43 PolarHBondContact O-N 2.86Å; V40-I44 HydrophobicContact CG1-CD1 3.79Å; V40-I44 HydrophobicContact CG1-CG1 4.49Å; V40-I44 VanDerWaalsContact O-CG1 3.28Å; V40-I44 WeakPolarHBondContact O-CG1 3.39Å; V40-I44 PolarHBondContact O-N 3.24Å
41	C	80	Confident	77.7	Confident	65 Å²	65	75.5 Å²	75.5	44%	0.439	42%	0.419	S	S	.	.	H	α-helix	trans	-61.4	-40.6	176.3	-72.2	0	0	0	0	112.3	V37 I44 S45	V37-C41 WeakPolarHBondContact O-CB 3.29Å; V37-C41 PolarHBondContact O-N 2.77Å; V37-C41 PolarHBondContact O-SG 3.45Å; V37-C41 VanDerWaalsContact O-SG 3.33Å; C41-I44 PolarHBondContact O-N 3.2Å; C41-S45 WeakPolarHBondContact O-CB 3.44Å; C41-S45 PolarHBondContact O-N 2.91Å; C41-S45 PolarHBondContact O-OG 3.3Å
42	G	79.1	Confident	78.4	Confident	26 Å²	26	77 Å²	77	27%	0.268	43%	0.426	S	S	.	.	H	α-helix	trans	-62.9	-44.2	174.3	0	0	0	0	0	111.6	I38 T39 V40 S45 Y46	I38-G42 PolarHBondContact O-N 2.86Å; T39-G42 PolarHBondContact O-N 2.9Å; V40-G42 VanDerWaalsContact C-N 3.33Å; V40-G42 PolarHBondContact O-N 3.43Å; G42-S45 PolarHBondContact O-N 3.49Å; G42-Y46 WeakPolarHBondContact O-CB 3.49Å; G42-Y46 PolarHBondContact O-N 2.94Å
43	G	79	Confident	78.8	Confident	37 Å²	37	76.9 Å²	76.9	38%	0.381	43%	0.425	S	S	.	.	H	α-helix	trans	-61.1	-44.1	175.1	0	0	0	0	0	113.1	T39 V40 Y46 F47	T39-G43 PolarHBondContact O-N 3.48Å; V40-G43 PolarHBondContact O-N 2.86Å; G43-Y46 PolarHBondContact O-N 3.25Å; G43-F47 WeakPolarHBondContact O-CB 3.44Å; G43-F47 PolarHBondContact O-N 3.43Å
44	I	80	Confident	79.2	Confident	87 Å²	87	79.9 Å²	79.9	45%	0.446	43%	0.428	S	S	.	.	H	α-helix	trans	-64	-47.7	176.5	-66.7	163.1	0	0	0	110.6	V40 C41 Y46 F47 F48	V40-I44 HydrophobicContact CG1-CD1 3.79Å; V40-I44 HydrophobicContact CG1-CG1 4.49Å; V40-I44 VanDerWaalsContact O-CG1 3.28Å; V40-I44 WeakPolarHBondContact O-CG1 3.39Å; V40-I44 PolarHBondContact O-N 3.24Å; C41-I44 PolarHBondContact O-N 3.2Å; I44-Y46 VanDerWaalsContact C-N 3.28Å; I44-Y46 PolarHBondContact O-N 3.39Å; I44-F47 WeakPolarHBondContact O-CB 3.47Å; I44-F47 PolarHBondContact O-N 2.91Å; I44-F48 HydrophobicContact CG2-CD2 3.7Å; I44-F48 HydrophobicContact CG2-CE2 3.55Å; I44-F48 VanDerWaalsContact O-CD2 3.22Å; I44-F48 WeakPolarHBondContact O-CD2 3.4Å; I44-F48 PolarHBondContact O-N 2.91Å
45	S	79.3	Confident	79.5	Confident	69 Å²	69	82.6 Å²	82.6	48%	0.483	44%	0.435	S	S	.	.	H	α-helix	trans	-62.1	-39.1	179.2	-57.3	0	0	0	0	111.7	C41 G42 F48 T49	C41-S45 WeakPolarHBondContact O-CB 3.44Å; C41-S45 PolarHBondContact O-N 2.91Å; C41-S45 PolarHBondContact O-OG 3.3Å; G42-S45 PolarHBondContact O-N 3.49Å; S45-F48 PolarHBondContact O-N 2.88Å; S45-T49 PolarHBondContact O-N 3.32Å; S45-T49 PolarHBondContact O-OG1 2.93Å
46	Y	79.3	Confident	79.9	Confident	51 Å²	51	85.6 Å²	85.6	20%	0.2	45%	0.45	C	S	.	.	H	α-helix	trans	-64.1	-46.2	175	179.7	-104.4	0	0	0	111.9	G2 L3 G42 G43 I44 F48 T49 M50	G2-Y46 VanDerWaalsContact C-CE2 3.44Å; G2-Y46 WeakPolarHBondContact O-CE2 3.39Å; L3-Y46 VanDerWaalsContact CA-OH 3.25Å; L3-Y46 WeakPolarHBondContact CA-OH 3.47Å; L3-Y46 HydrophobicContact CD2-CE1 3.79Å; L3-Y46 WeakPolarHBondContact CD2-OH 3.38Å; L3-Y46 HydrophobicContact CG-CE1 4.45Å; L3-Y46 WeakPolarHBondContact CG-OH 3.41Å; L3-Y46 PolarHBondContact N-OH 3.4Å; G42-Y46 WeakPolarHBondContact O-CB 3.49Å; G42-Y46 PolarHBondContact O-N 2.94Å; G43-Y46 PolarHBondContact O-N 3.25Å; I44-Y46 VanDerWaalsContact C-N 3.28Å; I44-Y46 PolarHBondContact O-N 3.39Å; Y46-F48 VanDerWaalsContact C-N 3.33Å; Y46-F48 PolarHBondContact O-N 2.94Å; Y46-T49 PolarHBondContact O-N 3.45Å; Y46-T49 VanDerWaalsContact O-N 3.17Å; Y46-M50 HydrophobicContact CD1-CG 4.21Å; Y46-M50 HydrophobicContact CD2-CG 4.35Å; Y46-M50 HydrophobicContact CE1-CG 3.65Å; Y46-M50 HydrophobicContact CE1-SD 4.44Å; Y46-M50 HydrophobicContact CE2-CG 3.77Å; Y46-M50 HydrophobicContact CE2-SD 3.92Å; Y46-M50 WeakPolarHBondContact O-CG 3.45Å; Y46-M50 PolarHBondContact O-N 3.49Å; Y46-M50 WeakPolarHBondContact OH-CE 3.45Å; Y46-M50 WeakPolarHBondContact OH-CG 3.44Å; Y46-M50 PolarHBondContact OH-SD 3.27Å
47	F	81.7	Confident	80.3	Confident	132 Å²	132	83 Å²	83	58%	0.579	45%	0.445	S	S	*	.	H	α-helix	trans	-55.8	-48.3	175	177.3	-98	0	0	0	111.3	G43 I44 T49 M50 C51	G43-F47 WeakPolarHBondContact O-CB 3.44Å; G43-F47 PolarHBondContact O-N 3.43Å; I44-F47 WeakPolarHBondContact O-CB 3.47Å; I44-F47 PolarHBondContact O-N 2.91Å; F47-T49 VanDerWaalsContact C-N 3.35Å; F47-T49 PolarHBondContact O-N 3.38Å; F47-M50 PolarHBondContact O-N 2.98Å; F47-C51 PolarHBondContact O-N 3.37Å; F47-C51 PolarHBondContact O-SG 2.96Å; F47-C51 VanDerWaalsContact O-SG 3.4Å
48	F	78.5	Confident	80.5	Confident	134 Å²	134	82.6 Å²	82.6	59%	0.588	44%	0.442	S	S	*	.	H	α-helix	trans	-60.3	-42.4	175.8	-82.7	-67.4	0	0	0	112.9	I44 S45 Y46 M50 C51 F52	I44-F48 HydrophobicContact CG2-CD2 3.7Å; I44-F48 HydrophobicContact CG2-CE2 3.55Å; I44-F48 VanDerWaalsContact O-CD2 3.22Å; I44-F48 WeakPolarHBondContact O-CD2 3.4Å; I44-F48 PolarHBondContact O-N 2.91Å; S45-F48 PolarHBondContact O-N 2.88Å; Y46-F48 VanDerWaalsContact C-N 3.33Å; Y46-F48 PolarHBondContact O-N 2.94Å; F48-M50 VanDerWaalsContact C-N 3.32Å; F48-M50 PolarHBondContact O-N 2.9Å; F48-C51 PolarHBondContact O-N 3.45Å; F48-F52 WeakPolarHBondContact O-CB 3.42Å; F48-F52 PolarHBondContact O-N 2.89Å
49	T	83.5	Confident	80.8	Confident	83 Å²	83	84.1 Å²	84.1	51%	0.509	45%	0.448	S	S	.	.	H	α-helix	trans	-62.3	-41.1	178.1	-56.1	0	0	0	0	111.5	S45 Y46 F47 F52 S53	S45-T49 PolarHBondContact O-N 3.32Å; S45-T49 PolarHBondContact O-OG1 2.93Å; Y46-T49 PolarHBondContact O-N 3.45Å; Y46-T49 VanDerWaalsContact O-N 3.17Å; F47-T49 VanDerWaalsContact C-N 3.35Å; F47-T49 PolarHBondContact O-N 3.38Å; T49-F52 PolarHBondContact O-N 3.45Å; T49-S53 WeakPolarHBondContact O-CB 3.28Å; T49-S53 PolarHBondContact O-N 3.28Å; T49-S53 PolarHBondContact O-OG 3.03Å
50	M	79.9	Confident	81.1	Confident	82 Å²	82	87.2 Å²	87.2	40%	0.404	46%	0.462	S	S	.	.	H	α-helix	trans	-69.1	-41.3	177.8	-67.6	-65.8	-83.6	0	0	111.7	Y46 F47 F48 S53 W54	Y46-M50 HydrophobicContact CD1-CG 4.21Å; Y46-M50 HydrophobicContact CD2-CG 4.35Å; Y46-M50 HydrophobicContact CE1-CG 3.65Å; Y46-M50 HydrophobicContact CE1-SD 4.44Å; Y46-M50 HydrophobicContact CE2-CG 3.77Å; Y46-M50 HydrophobicContact CE2-SD 3.92Å; Y46-M50 WeakPolarHBondContact O-CG 3.45Å; Y46-M50 PolarHBondContact O-N 3.49Å; Y46-M50 WeakPolarHBondContact OH-CE 3.45Å; Y46-M50 WeakPolarHBondContact OH-CG 3.44Å; Y46-M50 PolarHBondContact OH-SD 3.27Å; F47-M50 PolarHBondContact O-N 2.98Å; F48-M50 VanDerWaalsContact C-N 3.32Å; F48-M50 PolarHBondContact O-N 2.9Å; M50-S53 PolarHBondContact O-N 3.39Å; M50-W54 WeakPolarHBondContact O-CB 3.22Å; M50-W54 PolarHBondContact O-N 3.21Å
51	C	81.9	Confident	81.4	Confident	50 Å²	50	88.5 Å²	88.5	34%	0.338	47%	0.473	S	S	.	.	H	α-helix	trans	-60.2	-44.9	173.3	-72.3	0	0	0	0	111.8	F47 F48 W54 Q55	F47-C51 PolarHBondContact O-N 3.37Å; F47-C51 PolarHBondContact O-SG 2.96Å; F47-C51 VanDerWaalsContact O-SG 3.4Å; F48-C51 PolarHBondContact O-N 3.45Å; C51-W54 PolarHBondContact O-N 2.91Å; C51-Q55 WeakPolarHBondContact O-CG 3.37Å; C51-Q55 PolarHBondContact O-N 3.21Å
52	F	80.9	Confident	81.6	Confident	134 Å²	134	90.6 Å²	90.6	59%	0.588	48%	0.479	S	S	*	.	H	α-helix	trans	-64.4	-42.5	177.1	-173	-100.2	0	0	0	111.7	F48 T49 W54 Q55 L56	F48-F52 WeakPolarHBondContact O-CB 3.42Å; F48-F52 PolarHBondContact O-N 2.89Å; T49-F52 PolarHBondContact O-N 3.45Å; F52-W54 VanDerWaalsContact C-N 3.31Å; F52-W54 PolarHBondContact O-N 3.43Å; F52-Q55 PolarHBondContact O-N 3.42Å; F52-L56 WeakPolarHBondContact O-CB 3.35Å; F52-L56 PolarHBondContact O-N 3.31Å
53	S	80.3	Confident	81.8	Confident	53 Å²	53	94.5 Å²	94.5	37%	0.371	49%	0.493	S	S	.	.	H	α-helix	trans	-61.8	-40.2	176	-58.6	0	0	0	0	111.6	T49 M50 L56 V57	T49-S53 WeakPolarHBondContact O-CB 3.28Å; T49-S53 PolarHBondContact O-N 3.28Å; T49-S53 PolarHBondContact O-OG 3.03Å; M50-S53 PolarHBondContact O-N 3.39Å; S53-L56 PolarHBondContact O-N 2.99Å; S53-V57 VanDerWaalsContact O-CG2 3.28Å; S53-V57 WeakPolarHBondContact O-CG2 3.42Å; S53-V57 PolarHBondContact O-N 3.46Å
54	W	80.2	Confident	82.1	Confident	181 Å²	181	95.8 Å²	95.8	69%	0.686	50%	0.496	S	S	*	.	H	α-helix	trans	-64.6	-46.1	175.2	179.9	-97.8	0	0	0	112	M50 C51 F52 L56 V57 V58	M50-W54 WeakPolarHBondContact O-CB 3.22Å; M50-W54 PolarHBondContact O-N 3.21Å; C51-W54 PolarHBondContact O-N 2.91Å; F52-W54 VanDerWaalsContact C-N 3.31Å; F52-W54 PolarHBondContact O-N 3.43Å; W54-L56 VanDerWaalsContact C-N 3.31Å; W54-L56 PolarHBondContact O-N 2.9Å; W54-V57 PolarHBondContact O-N 2.95Å; W54-V58 HydrophobicContact CZ2-CG2 4.43Å; W54-V58 WeakPolarHBondContact O-CG2 3.35Å; W54-V58 PolarHBondContact O-N 3.42Å
55	Q	81.8	Confident	82.1	Confident	122 Å²	122	94.9 Å²	94.9	57%	0.57	50%	0.498	S	S	*	.	H	α-helix	trans	-58.2	-44.9	175.5	-75.3	179.8	-14	0	0	111.5	C51 F52 V57 V58 E59	C51-Q55 WeakPolarHBondContact O-CG 3.37Å; C51-Q55 PolarHBondContact O-N 3.21Å; F52-Q55 PolarHBondContact O-N 3.42Å; Q55-V57 VanDerWaalsContact C-N 3.32Å; Q55-V57 PolarHBondContact O-N 3.17Å; Q55-V58 PolarHBondContact O-N 2.94Å; Q55-E59 WeakPolarHBondContact O-CB 3.22Å; Q55-E59 PolarHBondContact O-N 2.74Å
56	L	79.7	Confident	82.2	Confident	85 Å²	85	96.8 Å²	96.8	45%	0.445	50%	0.502	S	S	.	.	H	α-helix	trans	-60.2	-41.6	177.4	-168.3	73.9	0	0	0	111.9	F52 S53 W54 E59 L60	F52-L56 WeakPolarHBondContact O-CB 3.35Å; F52-L56 PolarHBondContact O-N 3.31Å; S53-L56 PolarHBondContact O-N 2.99Å; W54-L56 VanDerWaalsContact C-N 3.31Å; W54-L56 PolarHBondContact O-N 2.9Å; L56-E59 PolarHBondContact O-N 2.88Å; L56-L60 HydrophobicContact CG-CD1 4.1Å; L56-L60 WeakPolarHBondContact O-CB 3.28Å; L56-L60 WeakPolarHBondContact O-CD1 3.44Å; L56-L60 PolarHBondContact O-N 3.25Å
57	V	85	Confident	82.3	Confident	85 Å²	85	100.9 Å²	100.9	52%	0.515	52%	0.521	S	S	.	.	H	α-helix	trans	-64.5	-42.8	176.7	169.3	0	0	0	0	111.5	S53 W54 Q55 E59 L60 C61	S53-V57 VanDerWaalsContact O-CG2 3.28Å; S53-V57 WeakPolarHBondContact O-CG2 3.42Å; S53-V57 PolarHBondContact O-N 3.46Å; W54-V57 PolarHBondContact O-N 2.95Å; Q55-V57 VanDerWaalsContact C-N 3.32Å; Q55-V57 PolarHBondContact O-N 3.17Å; V57-E59 VanDerWaalsContact C-N 3.32Å; V57-E59 PolarHBondContact O-N 3.34Å; V57-L60 PolarHBondContact O-N 2.93Å; V57-C61 WeakPolarHBondContact O-CB 3.44Å; V57-C61 PolarHBondContact O-N 3.43Å
58	V	83.2	Confident	82.4	Confident	66 Å²	66	100.2 Å²	100.2	40%	0.4	52%	0.52	S	S	.	.	H	α-helix	trans	-61.7	-43.3	176.4	171.9	0	0	0	0	110.7	W54 Q55 C61 L62	W54-V58 HydrophobicContact CZ2-CG2 4.43Å; W54-V58 WeakPolarHBondContact O-CG2 3.35Å; W54-V58 PolarHBondContact O-N 3.42Å; Q55-V58 PolarHBondContact O-N 2.94Å; V58-C61 PolarHBondContact O-N 3.34Å; V58-L62 HydrophobicContact CG1-CD1 4.43Å; V58-L62 PolarHBondContact O-N 3.44Å
59	E	86.3	Confident	82.6	Confident	124 Å²	124	98.9 Å²	98.9	58%	0.579	52%	0.518	S	S	*	.	H	α-helix	trans	-67.9	-40.7	-179.9	-159.4	164	-169.9	0	0	112.1	Q55 L56 V57 C61 L62 L63	Q55-E59 WeakPolarHBondContact O-CB 3.22Å; Q55-E59 PolarHBondContact O-N 2.74Å; L56-E59 PolarHBondContact O-N 2.88Å; V57-E59 VanDerWaalsContact C-N 3.32Å; V57-E59 PolarHBondContact O-N 3.34Å; E59-C61 VanDerWaalsContact C-N 3.33Å; E59-C61 PolarHBondContact O-N 3.4Å; E59-L62 PolarHBondContact O-N 2.94Å; E59-L63 WeakPolarHBondContact O-CG 3.17Å; E59-L63 PolarHBondContact O-N 2.92Å
60	L	83.2	Confident	82.5	Confident	104 Å²	104	99.7 Å²	99.7	55%	0.545	52%	0.519	S	S	.	.	H	α-helix	trans	-59.8	-41	170.5	-91.7	150.7	0	0	0	112.4	L56 V57 L63 S64	L56-L60 HydrophobicContact CG-CD1 4.1Å; L56-L60 WeakPolarHBondContact O-CB 3.28Å; L56-L60 WeakPolarHBondContact O-CD1 3.44Å; L56-L60 PolarHBondContact O-N 3.25Å; V57-L60 PolarHBondContact O-N 2.93Å; L60-L63 PolarHBondContact O-N 3.45Å; L60-S64 WeakPolarHBondContact O-CB 3.1Å; L60-S64 PolarHBondContact O-N 3.4Å
61	C	85.8	Confident	82.5	Confident	88 Å²	88	98.4 Å²	98.4	60%	0.595	52%	0.515	S	S	*	.	H	α-helix	trans	-66.5	-41.2	178.3	-161.5	0	0	0	0	111.4	V57 V58 E59 S64 S65	V57-C61 WeakPolarHBondContact O-CB 3.44Å; V57-C61 PolarHBondContact O-N 3.43Å; V58-C61 PolarHBondContact O-N 3.34Å; E59-C61 VanDerWaalsContact C-N 3.33Å; E59-C61 PolarHBondContact O-N 3.4Å; C61-S64 PolarHBondContact O-N 3.22Å; C61-S65 WeakPolarHBondContact O-CB 3.25Å; C61-S65 PolarHBondContact O-N 3.38Å
62	L	85	Confident	82.5	Confident	110 Å²	110	100.3 Å²	100.3	58%	0.576	53%	0.526	S	S	*	.	H	α-helix	trans	-62.5	-44.5	173.2	-76.6	172.5	0	0	0	112.1	V58 E59 S64 S65 L66	V58-L62 HydrophobicContact CG1-CD1 4.43Å; V58-L62 PolarHBondContact O-N 3.44Å; E59-L62 PolarHBondContact O-N 2.94Å; L62-S64 VanDerWaalsContact C-N 3.34Å; L62-S64 PolarHBondContact O-N 2.98Å; L62-S65 PolarHBondContact O-N 2.88Å; L62-L66 WeakPolarHBondContact O-CB 3.35Å; L62-L66 WeakPolarHBondContact O-CG 3.33Å; L62-L66 PolarHBondContact O-N 2.8Å
63	L	82.7	Confident	82.4	Confident	108 Å²	108	98.2 Å²	98.2	57%	0.565	52%	0.524	S	S	*	.	H	α-helix	trans	-62	-41.9	176.2	-76	167.6	0	0	0	111.8	E59 L60 L66 F67	E59-L63 WeakPolarHBondContact O-CG 3.17Å; E59-L63 PolarHBondContact O-N 2.92Å; L60-L63 PolarHBondContact O-N 3.45Å; L63-L66 PolarHBondContact O-N 2.81Å; L63-F67 WeakPolarHBondContact O-CB 3.43Å; L63-F67 PolarHBondContact O-N 3.44Å
64	S	85.1	Confident	82.2	Confident	63 Å²	63	100.6 Å²	100.6	44%	0.441	53%	0.532	S	S	.	.	H	α-helix	trans	-62.3	-44.3	175.3	-168.1	0	0	0	0	111.7	L60 C61 L62 F67 E68	L60-S64 WeakPolarHBondContact O-CB 3.1Å; L60-S64 PolarHBondContact O-N 3.4Å; C61-S64 PolarHBondContact O-N 3.22Å; L62-S64 VanDerWaalsContact C-N 3.34Å; L62-S64 PolarHBondContact O-N 2.98Å; S64-F67 WeakPolarHBondContact O-CB 3.27Å; S64-F67 PolarHBondContact O-N 2.91Å; S64-E68 WeakPolarHBondContact O-CG 3.35Å; S64-E68 PolarHBondContact O-N 3.03Å
65	S	81.6	Confident	81.8	Confident	69 Å²	69	98.5 Å²	98.5	48%	0.483	53%	0.528	S	S	.	.	H	α-helix	trans	-66.4	-40.2	178.6	-174.5	0	0	0	0	112.3	C61 L62 F67 E68 L69	C61-S65 WeakPolarHBondContact O-CB 3.25Å; C61-S65 PolarHBondContact O-N 3.38Å; L62-S65 PolarHBondContact O-N 2.88Å; S65-F67 VanDerWaalsContact C-N 3.31Å; S65-F67 PolarHBondContact O-N 3.43Å; S65-E68 PolarHBondContact O-N 3.33Å; S65-L69 WeakPolarHBondContact O-CB 3.27Å; S65-L69 PolarHBondContact O-N 2.83Å
66	L	79.7	Confident	81.3	Confident	109 Å²	109	95.6 Å²	95.6	57%	0.571	52%	0.521	S	S	*	.	H	α-helix	trans	-62.4	-40.2	172.5	-80.9	169.5	0	0	0	111.7	L62 L63 L69 L70	L62-L66 WeakPolarHBondContact O-CB 3.35Å; L62-L66 WeakPolarHBondContact O-CG 3.33Å; L62-L66 PolarHBondContact O-N 2.8Å; L63-L66 PolarHBondContact O-N 2.81Å; L66-L69 PolarHBondContact O-N 2.9Å; L66-L70 WeakPolarHBondContact O-CB 3.48Å; L66-L70 PolarHBondContact O-N 3.21Å
67	F	83	Confident	81	Confident	136 Å²	136	93.5 Å²	93.5	60%	0.596	52%	0.521	S	S	*	.	H	α-helix	trans	-64.6	-46.2	176.7	-174.5	-98.4	0	0	0	111.5	L63 S64 S65 L69 L70 V71	L63-F67 WeakPolarHBondContact O-CB 3.43Å; L63-F67 PolarHBondContact O-N 3.44Å; S64-F67 WeakPolarHBondContact O-CB 3.27Å; S64-F67 PolarHBondContact O-N 2.91Å; S65-F67 VanDerWaalsContact C-N 3.31Å; S65-F67 PolarHBondContact O-N 3.43Å; F67-L69 VanDerWaalsContact C-N 3.33Å; F67-L69 PolarHBondContact O-N 2.86Å; F67-L70 PolarHBondContact O-N 3.11Å; F67-V71 HydrophobicContact CD1-CG2 4.13Å; F67-V71 HydrophobicContact CE1-CG2 3.78Å; F67-V71 HydrophobicContact CZ-CG2 3.99Å; F67-V71 VanDerWaalsContact O-CG2 3.29Å; F67-V71 WeakPolarHBondContact O-CG2 3.42Å; F67-V71 PolarHBondContact O-N 3.43Å
68	E	82.7	Confident	80.1	Confident	119 Å²	119	93 Å²	93	56%	0.556	52%	0.52	S	S	*	.	H	α-helix	trans	-59.5	-42.4	174.7	-75.7	179.7	165.2	0	0	112.4	S64 S65 V71 T72	S64-E68 WeakPolarHBondContact O-CG 3.35Å; S64-E68 PolarHBondContact O-N 3.03Å; S65-E68 PolarHBondContact O-N 3.33Å; E68-V71 PolarHBondContact O-N 3.27Å; E68-T72 WeakPolarHBondContact O-CB 3.1Å; E68-T72 PolarHBondContact O-N 2.87Å; E68-T72 PolarHBondContact O-OG1 3.19Å
69	L	82.2	Confident	79.3	Confident	106 Å²	106	95.5 Å²	95.5	56%	0.555	53%	0.531	S	S	*	.	H	α-helix	trans	-63.3	-45.3	175.7	-174.6	69.2	0	0	0	111.2	S65 L66 F67 V71 T72 V73	S65-L69 WeakPolarHBondContact O-CB 3.27Å; S65-L69 PolarHBondContact O-N 2.83Å; L66-L69 PolarHBondContact O-N 2.9Å; F67-L69 VanDerWaalsContact C-N 3.33Å; F67-L69 PolarHBondContact O-N 2.86Å; L69-V71 VanDerWaalsContact C-N 3.34Å; L69-V71 PolarHBondContact O-N 2.88Å; L69-T72 WeakPolarHBondContact O-CB 3.48Å; L69-T72 PolarHBondContact O-N 3.46Å; L69-V73 WeakPolarHBondContact O-CG2 3.39Å; L69-V73 PolarHBondContact O-N 3.28Å
70	L	82.2	Confident	78.5	Confident	100 Å²	100	94.5 Å²	94.5	52%	0.524	53%	0.529	S	S	.	.	H	α-helix	trans	-62.7	-40.7	178.7	-178	65.5	0	0	0	112	L66 F67 N74	L66-L70 WeakPolarHBondContact O-CB 3.48Å; L66-L70 PolarHBondContact O-N 3.21Å; F67-L70 PolarHBondContact O-N 3.11Å; L70-N74 WeakPolarHBondContact O-CB 3.25Å; L70-N74 PolarHBondContact O-N 3.49Å; L70-N74 PolarHBondContact O-ND2 3.29Å
71	V	81	Confident	77.7	Confident	54 Å²	54	93 Å²	93	33%	0.327	53%	0.528	S	S	.	.	H	α-helix	trans	-62.8	-45.9	174	170.7	0	0	0	0	109.8	F67 E68 L69 V73 N74 F75	F67-V71 HydrophobicContact CD1-CG2 4.13Å; F67-V71 HydrophobicContact CE1-CG2 3.78Å; F67-V71 HydrophobicContact CZ-CG2 3.99Å; F67-V71 VanDerWaalsContact O-CG2 3.29Å; F67-V71 WeakPolarHBondContact O-CG2 3.42Å; F67-V71 PolarHBondContact O-N 3.43Å; E68-V71 PolarHBondContact O-N 3.27Å; L69-V71 VanDerWaalsContact C-N 3.34Å; L69-V71 PolarHBondContact O-N 2.88Å; V71-V73 PolarHBondContact O-N 2.78Å; V71-N74 PolarHBondContact O-N 3.4Å; V71-F75 HydrophobicContact CG1-CD2 3.73Å; V71-F75 HydrophobicContact CG1-CE2 3.97Å; V71-F75 WeakPolarHBondContact O-CB 3.3Å; V71-F75 WeakPolarHBondContact O-CD2 3.33Å; V71-F75 PolarHBondContact O-N 3.37Å
72	T	80.6	Confident	77.1	Confident	90 Å²	90	92.4 Å²	92.4	55%	0.552	52%	0.521	S	S	*	.	H	α-helix	trans	-61.2	-44.5	178.4	-55.8	0	0	0	0	112	E68 L69 F75 S76	E68-T72 WeakPolarHBondContact O-CB 3.1Å; E68-T72 PolarHBondContact O-N 2.87Å; E68-T72 PolarHBondContact O-OG1 3.19Å; L69-T72 WeakPolarHBondContact O-CB 3.48Å; L69-T72 PolarHBondContact O-N 3.46Å; T72-F75 PolarHBondContact O-N 3.03Å; T72-S76 WeakPolarHBondContact O-CB 3.44Å; T72-S76 PolarHBondContact O-N 3.38Å
73	V	78.2	Confident	76.4	Confident	90 Å²	90	93.7 Å²	93.7	55%	0.545	52%	0.524	S	S	.	.	H	α-helix	trans	-67.4	-41.4	178.1	175.1	0	0	0	0	111.4	L69 V71 S76 G77	L69-V73 WeakPolarHBondContact O-CG2 3.39Å; L69-V73 PolarHBondContact O-N 3.28Å; V71-V73 PolarHBondContact O-N 2.78Å; V73-S76 PolarHBondContact O-N 3.17Å; V73-G77 PolarHBondContact O-N 2.97Å
74	N	76.1	Confident	75.9	Confident	104 Å²	104	92.6 Å²	92.6	56%	0.556	52%	0.521	S	S	*	.	H	α-helix	trans	-63.9	-40.7	174.6	-87.7	-71	0	0	0	112.1	L70 V71 C78	L70-N74 WeakPolarHBondContact O-CB 3.25Å; L70-N74 PolarHBondContact O-N 3.49Å; L70-N74 PolarHBondContact O-ND2 3.29Å; V71-N74 PolarHBondContact O-N 3.4Å; N74-C78 VanDerWaalsContact O-CB 3.26Å; N74-C78 WeakPolarHBondContact O-CB 3.2Å; N74-C78 PolarHBondContact O-N 3.23Å
75	F	72.2	Confident	75.4	Confident	137 Å²	137	93.1 Å²	93.1	60%	0.601	52%	0.522	S	S	*	.	H	α-helix	trans	-65.3	-43.3	174.9	-97.5	-81.2	0	0	0	111.9	V71 T72 C78 L79	V71-F75 HydrophobicContact CG1-CD2 3.73Å; V71-F75 HydrophobicContact CG1-CE2 3.97Å; V71-F75 WeakPolarHBondContact O-CB 3.3Å; V71-F75 WeakPolarHBondContact O-CD2 3.33Å; V71-F75 PolarHBondContact O-N 3.37Å; T72-F75 PolarHBondContact O-N 3.03Å; F75-C78 WeakPolarHBondContact O-CB 3.01Å; F75-C78 PolarHBondContact O-N 2.88Å; F75-L79 WeakPolarHBondContact O-CB 3.41Å; F75-L79 WeakPolarHBondContact O-CG 2.96Å; F75-L79 PolarHBondContact O-N 2.87Å
76	S	72.5	Confident	75.2	Confident	60 Å²	60	94.6 Å²	94.6	42%	0.42	52%	0.524	S	S	.	.	H	α-helix	trans	-63	-45.3	176.6	-162.7	0	0	0	0	111.3	T72 V73 C78 L79 D80	T72-S76 WeakPolarHBondContact O-CB 3.44Å; T72-S76 PolarHBondContact O-N 3.38Å; V73-S76 PolarHBondContact O-N 3.17Å; S76-C78 VanDerWaalsContact C-N 3.29Å; S76-C78 PolarHBondContact O-N 3.44Å; S76-L79 PolarHBondContact O-N 3.33Å; S76-D80 PolarHBondContact O-N 3.23Å
77	G	72	Confident	75.1	Confident	42 Å²	42	92.4 Å²	92.4	43%	0.433	52%	0.518	S	S	.	.	H	α-helix	trans	-62.5	-35.4	175.3	0	0	0	0	0	112.9	V73 S81	V73-G77 PolarHBondContact O-N 2.97Å; G77-S81 VanDerWaalsContact O-CB 3.32Å; G77-S81 WeakPolarHBondContact O-CB 3.31Å; G77-S81 PolarHBondContact O-N 2.73Å
78	C	67.6	Low	74.9	Confident	73 Å²	73	91 Å²	91	49%	0.493	52%	0.516	S	S	.	.	H	α-helix	trans	-66.9	-45.3	173.2	-169.4	0	0	0	0	111.5	N74 F75 S76 S81 V82	N74-C78 VanDerWaalsContact O-CB 3.26Å; N74-C78 WeakPolarHBondContact O-CB 3.2Å; N74-C78 PolarHBondContact O-N 3.23Å; F75-C78 WeakPolarHBondContact O-CB 3.01Å; F75-C78 PolarHBondContact O-N 2.88Å; S76-C78 VanDerWaalsContact C-N 3.29Å; S76-C78 PolarHBondContact O-N 3.44Å; C78-S81 PolarHBondContact O-N 3.07Å; C78-V82 VanDerWaalsContact O-CG2 3.26Å; C78-V82 WeakPolarHBondContact O-CG2 3.47Å; C78-V82 PolarHBondContact O-N 3.43Å
79	L	65.6	Low	74.7	Confident	120 Å²	120	90.4 Å²	90.4	63%	0.628	52%	0.516	S	S	*	.	H	α-helix	trans	-62.1	-44	176.9	-73.6	171	0	0	0	112	F75 S76 V82 H83	F75-L79 WeakPolarHBondContact O-CB 3.41Å; F75-L79 WeakPolarHBondContact O-CG 2.96Å; F75-L79 PolarHBondContact O-N 2.87Å; S76-L79 PolarHBondContact O-N 3.33Å; L79-V82 PolarHBondContact O-N 3.5Å; L79-H83 WeakPolarHBondContact O-CB 3.48Å; L79-H83 PolarHBondContact O-N 2.82Å
80	D	70.4	Confident	74.8	Confident	102 Å²	102	92.1 Å²	92.1	55%	0.545	52%	0.519	S	S	.	.	H	α-helix	trans	-63	-42.9	175.7	-75.2	-34.9	0	0	0	111.1	S76 V82 H83 V84	S76-D80 PolarHBondContact O-N 3.23Å; D80-V82 PolarHBondContact O-N 2.92Å; D80-H83 PolarHBondContact O-N 3.26Å; D80-V84 VanDerWaalsContact O-CG2 3.26Å; D80-V84 WeakPolarHBondContact O-CG2 3.45Å; D80-V84 PolarHBondContact O-N 3.03Å
81	S	66.8	Low	74.9	Confident	74 Å²	74	91.9 Å²	91.9	52%	0.517	52%	0.516	S	S	.	.	H	α-helix	trans	-64.8	-38.9	177.1	-168.2	0	0	0	0	112.7	G77 C78 T85	G77-S81 VanDerWaalsContact O-CB 3.32Å; G77-S81 WeakPolarHBondContact O-CB 3.31Å; G77-S81 PolarHBondContact O-N 2.73Å; C78-S81 PolarHBondContact O-N 3.07Å; S81-T85 WeakPolarHBondContact O-CB 3.17Å; S81-T85 PolarHBondContact O-N 3.33Å; S81-T85 PolarHBondContact O-OG1 3.36Å
82	V	71.9	Confident	75	Confident	74 Å²	74	95 Å²	95	45%	0.448	53%	0.53	S	S	.	.	H	α-helix	trans	-65.9	-46.2	175.9	171.2	0	0	0	0	110.1	C78 L79 D80 V84 T85 D86	C78-V82 VanDerWaalsContact O-CG2 3.26Å; C78-V82 WeakPolarHBondContact O-CG2 3.47Å; C78-V82 PolarHBondContact O-N 3.43Å; L79-V82 PolarHBondContact O-N 3.5Å; D80-V82 PolarHBondContact O-N 2.92Å; V82-V84 PolarHBondContact O-N 2.9Å; V82-T85 PolarHBondContact O-N 3.02Å; V82-T85 VanDerWaalsContact O-N 3.12Å; V82-D86 PolarHBondContact O-N 3.43Å
83	H	71.2	Confident	75.3	Confident	138 Å²	138	94.6 Å²	94.6	64%	0.639	52%	0.524	S	S	*	.	H	α-helix	trans	-64.4	-38.2	-179.1	-166	-91.8	0	0	0	112.8	L79 D80 S87	L79-H83 WeakPolarHBondContact O-CB 3.48Å; L79-H83 PolarHBondContact O-N 2.82Å; D80-H83 PolarHBondContact O-N 3.26Å; H83-S87 WeakPolarHBondContact O-CB 3.32Å; H83-S87 PolarHBondContact O-N 2.81Å; H83-S87 VanDerWaalsContact O-N 3.09Å
84	V	71.9	Confident	75.8	Confident	85 Å²	85	95.6 Å²	95.6	52%	0.515	52%	0.521	S	S	.	.	H	α-helix	trans	-65.1	-42.7	172.9	172.8	0	0	0	0	110.5	D80 V82 S87 L88	D80-V84 VanDerWaalsContact O-CG2 3.26Å; D80-V84 WeakPolarHBondContact O-CG2 3.45Å; D80-V84 PolarHBondContact O-N 3.03Å; V82-V84 PolarHBondContact O-N 2.9Å; V84-S87 PolarHBondContact O-N 3.48Å; V84-L88 HydrophobicContact CG1-CD1 3.95Å; V84-L88 HydrophobicContact CG1-CG 4.39Å; V84-L88 WeakPolarHBondContact O-CB 3.45Å; V84-L88 VanDerWaalsContact O-CG 3.3Å; V84-L88 WeakPolarHBondContact O-CG 3.44Å; V84-L88 PolarHBondContact O-N 3.17Å
85	T	74.9	Confident	76.2	Confident	74 Å²	74	95 Å²	95	45%	0.454	52%	0.515	S	S	.	.	H	α-helix	trans	-63.3	-46	179.3	-54.7	0	0	0	0	111.5	S81 V82 S87 L88 L89	S81-T85 WeakPolarHBondContact O-CB 3.17Å; S81-T85 PolarHBondContact O-N 3.33Å; S81-T85 PolarHBondContact O-OG1 3.36Å; V82-T85 PolarHBondContact O-N 3.02Å; V82-T85 VanDerWaalsContact O-N 3.12Å; T85-S87 VanDerWaalsContact C-N 3.35Å; T85-S87 PolarHBondContact O-N 3.18Å; T85-L88 PolarHBondContact O-N 3.15Å; T85-L89 VanDerWaalsContact O-CB 3.31Å; T85-L89 WeakPolarHBondContact O-CB 3.39Å; T85-L89 PolarHBondContact O-N 3.28Å
86	D	76.2	Confident	76.8	Confident	99 Å²	99	93.4 Å²	93.4	53%	0.529	51%	0.512	S	S	.	.	H	α-helix	trans	-62.6	-41	177.8	-76.2	-25.8	0	0	0	112.1	V82 L89 F90	V82-D86 PolarHBondContact O-N 3.43Å; D86-L89 PolarHBondContact O-N 3.01Å; D86-F90 VanDerWaalsContact O-CB 3.29Å; D86-F90 WeakPolarHBondContact O-CB 3.4Å; D86-F90 PolarHBondContact O-N 3.06Å
87	S	78.6	Confident	77.4	Confident	63 Å²	63	97 Å²	97	44%	0.441	52%	0.523	S	S	.	.	H	α-helix	trans	-64.7	-43.4	176.6	-171.3	0	0	0	0	112	H83 V84 T85 F90 Q91	H83-S87 WeakPolarHBondContact O-CB 3.32Å; H83-S87 PolarHBondContact O-N 2.81Å; H83-S87 VanDerWaalsContact O-N 3.09Å; V84-S87 PolarHBondContact O-N 3.48Å; T85-S87 VanDerWaalsContact C-N 3.35Å; T85-S87 PolarHBondContact O-N 3.18Å; S87-F90 PolarHBondContact O-N 3.46Å; S87-Q91 WeakPolarHBondContact O-CB 3.36Å; S87-Q91 VanDerWaalsContact O-CG 3.28Å; S87-Q91 WeakPolarHBondContact O-CG 3.43Å; S87-Q91 PolarHBondContact O-N 2.99Å
88	L	77.8	Confident	78	Confident	108 Å²	108	101.1 Å²	101.1	57%	0.565	53%	0.525	S	S	*	.	H	α-helix	trans	-63.7	-44.8	175.6	-72.8	173.9	0	0	0	111.3	V84 T85 F90 Q91 L92	V84-L88 HydrophobicContact CG1-CD1 3.95Å; V84-L88 HydrophobicContact CG1-CG 4.39Å; V84-L88 WeakPolarHBondContact O-CB 3.45Å; V84-L88 VanDerWaalsContact O-CG 3.3Å; V84-L88 WeakPolarHBondContact O-CG 3.44Å; V84-L88 PolarHBondContact O-N 3.17Å; T85-L88 PolarHBondContact O-N 3.15Å; L88-F90 VanDerWaalsContact C-N 3.34Å; L88-F90 PolarHBondContact O-N 3.44Å; L88-Q91 PolarHBondContact O-N 3.09Å; L88-L92 WeakPolarHBondContact O-CB 3.47Å; L88-L92 PolarHBondContact O-N 3.01Å
89	L	79.6	Confident	78.6	Confident	105 Å²	105	103.7 Å²	103.7	55%	0.55	53%	0.531	S	S	.	.	H	α-helix	trans	-63.8	-40.8	179.4	-148.2	161.3	0	0	0	110.8	T85 D86 L92 N93	T85-L89 VanDerWaalsContact O-CB 3.31Å; T85-L89 WeakPolarHBondContact O-CB 3.39Å; T85-L89 PolarHBondContact O-N 3.28Å; D86-L89 PolarHBondContact O-N 3.01Å; L89-L92 PolarHBondContact O-N 3.12Å; L89-N93 WeakPolarHBondContact O-CB 3.2Å; L89-N93 PolarHBondContact O-N 3.23Å
90	F	83	Confident	79.4	Confident	142 Å²	142	103 Å²	103	62%	0.623	54%	0.537	S	S	*	.	H	α-helix	trans	-63	-44.3	173.7	-173	-97.4	0	0	0	112.5	D86 S87 L88 N93 K94	D86-F90 VanDerWaalsContact O-CB 3.29Å; D86-F90 WeakPolarHBondContact O-CB 3.4Å; D86-F90 PolarHBondContact O-N 3.06Å; S87-F90 PolarHBondContact O-N 3.46Å; L88-F90 VanDerWaalsContact C-N 3.34Å; L88-F90 PolarHBondContact O-N 3.44Å; F90-N93 PolarHBondContact O-N 3.29Å; F90-K94 WeakPolarHBondContact O-CB 3.26Å; F90-K94 PolarHBondContact O-N 3.08Å
91	Q	84.6	Confident	79.5	Confident	96 Å²	96	109 Å²	109	45%	0.449	55%	0.552	S	S	.	*	H	α-helix	trans	-63.1	-43.7	175.6	-72.7	-71.1	-9.2	0	0	111.7	S87 L88 K94 Q95	S87-Q91 WeakPolarHBondContact O-CB 3.36Å; S87-Q91 VanDerWaalsContact O-CG 3.28Å; S87-Q91 WeakPolarHBondContact O-CG 3.43Å; S87-Q91 PolarHBondContact O-N 2.99Å; L88-Q91 PolarHBondContact O-N 3.09Å; Q91-K94 PolarHBondContact O-N 3.5Å; Q91-Q95 WeakPolarHBondContact O-CG 3.3Å; Q91-Q95 PolarHBondContact O-N 3.4Å
92	L	84.4	Confident	79.3	Confident	120 Å²	120	115.3 Å²	115.3	63%	0.628	58%	0.58	S	S	*	*	H	α-helix	trans	-62.3	-44	178.2	-127.9	153.3	0	0	0	111	L88 L89 K94 Q95 L96	L88-L92 WeakPolarHBondContact O-CB 3.47Å; L88-L92 PolarHBondContact O-N 3.01Å; L89-L92 PolarHBondContact O-N 3.12Å; L92-K94 VanDerWaalsContact C-N 3.33Å; L92-K94 PolarHBondContact O-N 3.31Å; L92-Q95 PolarHBondContact O-N 3.47Å; L92-Q95 VanDerWaalsContact O-N 3.17Å; L92-L96 WeakPolarHBondContact O-CB 3.47Å; L92-L96 PolarHBondContact O-N 3.22Å
93	N	86.7	Confident	79.6	Confident	81 Å²	81	117.4 Å²	117.4	43%	0.433	59%	0.586	S	S	.	*	H	α-helix	trans	-63.6	-39.7	177	-156.1	-8.8	0	0	0	111.4	L89 F90 Q95 L96 Q97	L89-N93 WeakPolarHBondContact O-CB 3.2Å; L89-N93 PolarHBondContact O-N 3.23Å; F90-N93 PolarHBondContact O-N 3.29Å; N93-Q95 VanDerWaalsContact C-N 3.33Å; N93-Q95 PolarHBondContact O-N 3.42Å; N93-L96 PolarHBondContact O-N 3.36Å; N93-Q97 WeakPolarHBondContact O-CB 3.38Å; N93-Q97 WeakPolarHBondContact O-CG 3.09Å; N93-Q97 PolarHBondContact O-N 2.97Å
94	K	87.2	Confident	80.1	Confident	111 Å²	111	116.3 Å²	116.3	48%	0.483	58%	0.583	S	S	.	*	H	α-helix	trans	-66.6	-29.9	174.5	-164.2	179.2	-174.4	178.8	0	113.4	F90 Q91 L92 R98	F90-K94 WeakPolarHBondContact O-CB 3.26Å; F90-K94 PolarHBondContact O-N 3.08Å; Q91-K94 PolarHBondContact O-N 3.5Å; L92-K94 VanDerWaalsContact C-N 3.33Å; L92-K94 PolarHBondContact O-N 3.31Å; K94-R98 PolarHBondContact O-N 2.93Å; K94-R98 PolarHBondContact O-NE 3.46Å; K94-R98 VanDerWaalsContact O-NE 3.16Å
95	Q	85.1	Confident	80.5	Confident	90 Å²	90	118.1 Å²	118.1	42%	0.421	59%	0.587	S	S	.	*	H	α-helix	trans	-76.2	-43.4	173.1	-67.2	-69.2	-6.4	0	0	111	Q91 L92 N93 Q97 R98 M99	Q91-Q95 WeakPolarHBondContact O-CG 3.3Å; Q91-Q95 PolarHBondContact O-N 3.4Å; L92-Q95 PolarHBondContact O-N 3.47Å; L92-Q95 VanDerWaalsContact O-N 3.17Å; N93-Q95 VanDerWaalsContact C-N 3.33Å; N93-Q95 PolarHBondContact O-N 3.42Å; Q95-Q97 PolarHBondContact O-N 3.4Å; Q95-R98 VanDerWaalsContact CD-NH2 3.29Å; Q95-R98 WeakPolarHBondContact O-CB 3.39Å; Q95-R98 PolarHBondContact O-N 2.96Å; Q95-R98 VanDerWaalsContact O-N 3.12Å; Q95-M99 PolarHBondContact O-N 3.46Å
96	L	86	Confident	80.9	Confident	104 Å²	104	120.6 Å²	120.6	55%	0.545	60%	0.595	S	S	.	*	H	α-helix	trans	-60.9	-44.8	177.6	-163.6	88.9	0	0	0	111.7	L92 N93 R98 M99 S100	L92-L96 WeakPolarHBondContact O-CB 3.47Å; L92-L96 PolarHBondContact O-N 3.22Å; N93-L96 PolarHBondContact O-N 3.36Å; L96-R98 VanDerWaalsContact C-N 3.27Å; L96-R98 PolarHBondContact O-N 3.43Å; L96-M99 PolarHBondContact O-N 3.41Å; L96-S100 WeakPolarHBondContact O-CB 3.35Å; L96-S100 PolarHBondContact O-N 3.23Å
97	Q	85	Confident	81.2	Confident	136 Å²	136	122 Å²	122	64%	0.636	60%	0.599	S	S	*	*	H	α-helix	trans	-63.2	-31.9	175	-76.9	-166.2	-22.4	0	0	113.1	N93 Q95 R101	N93-Q97 WeakPolarHBondContact O-CB 3.38Å; N93-Q97 WeakPolarHBondContact O-CG 3.09Å; N93-Q97 PolarHBondContact O-N 2.97Å; Q95-Q97 PolarHBondContact O-N 3.4Å; Q97-R101 PolarHBondContact O-N 2.84Å
98	R	84.8	Confident	81.3	Confident	129 Å²	129	125.9 Å²	125.9	49%	0.487	61%	0.61	S	S	.	*	H	α-helix	trans	-71.3	-37.9	174.2	-85.1	-175.2	-81.9	168.4	-5.2	112.2	K94 Q95 L96	K94-R98 PolarHBondContact O-N 2.93Å; K94-R98 PolarHBondContact O-NE 3.46Å; K94-R98 VanDerWaalsContact O-NE 3.16Å; Q95-R98 VanDerWaalsContact CD-NH2 3.29Å; Q95-R98 WeakPolarHBondContact O-CB 3.39Å; Q95-R98 PolarHBondContact O-N 2.96Å; Q95-R98 VanDerWaalsContact O-N 3.12Å; L96-R98 VanDerWaalsContact C-N 3.27Å; L96-R98 PolarHBondContact O-N 3.43Å
99	M	79.4	Confident	81.6	Confident	127 Å²	127	127.2 Å²	127.2	63%	0.626	61%	0.613	S	S	*	*	H	α-helix	trans	-71.1	-37.2	175.6	-72.5	-170.9	-71.3	0	0	112.7	Q95 L96 R101 N102	Q95-M99 PolarHBondContact O-N 3.46Å; L96-M99 PolarHBondContact O-N 3.41Å; M99-R101 PolarHBondContact O-N 3.42Å; M99-N102 PolarHBondContact O-N 2.94Å
100	S	81.3	Confident	81.8	Confident	105 Å²	105	128.9 Å²	128.9	73%	0.734	62%	0.618	S	S	*	*	H	α-helix	trans	-70.3	-18	179	-173.4	0	0	0	0	113.6	L96	L96-S100 WeakPolarHBondContact O-CB 3.35Å; L96-S100 PolarHBondContact O-N 3.23Å
101	R	73.8	Confident	81.7	Confident	229 Å²	229	127.8 Å²	127.8	86%	0.864	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.2	-4.3	-179.2	-143.8	178.9	-165.7	174	4.2	114.1	Q97 M99	Q97-R101 PolarHBondContact O-N 2.84Å; M99-R101 PolarHBondContact O-N 3.42Å
102	N	61.6	Low	81.4	Confident	206 Å²	206	130.7 Å²	130.7	100%	1.102	63%	0.632	S	S	*	*			trans	-104.6	0	170.4	-92.2	6.1	0	0	0	109.8	M99	M99-N102 PolarHBondContact O-N 2.94Å

Retrieved 102 of 102 residues in 21.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).