G4VI89_SCHMA Loading...

Small nuclear ribonucleoprotein G

Plays a role in pre-mRNA splicing.

AlphaFold DB , UniProt , Accession G4VI89, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 76 aa.

						>G4VI89_SCHMA|G4VI89
MSKAHQPELKKYLDKRLRLKLNANREVVGVLRGFDAFMNIVVSDAYEVTKDGNQIKIDMAVVRGNSINIVEGVDRI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.8	Very low	74.8	Confident	238 Å²	238	124.9 Å²	124.9	100%	1.172	63%	0.627	S	S	*	*				0	116.9	0	-72.5	-160.5	-91.7	0	0	108.1	K3	M1-K3 PolarHBondContact O-N 3.39Å
2	S	59.1	Low	76.4	Confident	119 Å²	119	118.6 Å²	118.6	83%	0.832	59%	0.591	S	S	*	*	P	Polyproline II helix	trans	-58.6	130.6	172	49.7	0	0	0	0	108.6	A4	S2-A4 PolarHBondContact O-N 3.05Å; S2-A4 VanDerWaalsContact O-N 3.17Å
3	K	60.8	Low	77.8	Confident	201 Å²	201	114.2 Å²	114.2	87%	0.874	57%	0.571	S	S	*	*	P	Polyproline II helix	trans	-54.9	126.5	170.5	-77.5	-178.5	177.5	179	0	107.1	M1 H5	M1-K3 PolarHBondContact O-N 3.39Å; K3-H5 PolarHBondContact O-N 3.17Å
4	A	64.6	Low	79.1	Confident	71 Å²	71	113.5 Å²	113.5	59%	0.587	57%	0.569	S	S	*	*	P	Polyproline II helix	trans	-54.4	118.8	171.4	0	0	0	0	0	107.4	S2 Q6	S2-A4 PolarHBondContact O-N 3.05Å; S2-A4 VanDerWaalsContact O-N 3.17Å; A4-Q6 PolarHBondContact O-N 3.37Å
5	H	71.9	Confident	80.3	Confident	149 Å²	149	110.9 Å²	110.9	69%	0.69	55%	0.553	S	S	*	*	P	Polyproline II helix	trans	-64.7	118.2	176.2	-178.7	78.9	0	0	0	107	K3	K3-H5 PolarHBondContact O-N 3.17Å
6	Q	76.3	Confident	81.3	Confident	147 Å²	147	108.4 Å²	108.4	69%	0.687	54%	0.535	S	S	*	.	P	Polyproline II helix	trans	-64.6	132.2	-179.3	-75.3	-172.9	-17.4	0	0	109	A4 E8	A4-Q6 PolarHBondContact O-N 3.37Å; Q6-E8 PolarHBondContact O-N 3.18Å
7	P	80.4	Confident	82.2	Confident	22 Å²	22	102.1 Å²	102.1	14%	0.143	50%	0.504	C	S	.	.	P	Polyproline II helix	trans	-57.2	133.4	176.2	-24	33.4	0	0	0	111.2	L9 F34 M38	P7-L9 HydrophobicContact CB-CD1 4.12Å; P7-L9 HydrophobicContact CB-CG 4Å; P7-L9 PolarHBondContact O-N 3.18Å; P7-F34 HydrophobicContact CB-CD2 4.41Å; P7-F34 HydrophobicContact CB-CE2 4.5Å; P7-F34 WeakPolarHBondContact O-CE2 3.29Å; P7-M38 HydrophobicContact CB-CG 3.95Å; P7-M38 HydrophobicContact CG-CB 4.47Å; P7-M38 HydrophobicContact CG-CG 3.35Å; P7-M38 HydrophobicContact CG-SD 4.39Å
8	E	87.1	Confident	83.1	Confident	136 Å²	136	101.8 Å²	101.8	64%	0.636	50%	0.496	S	S	*	.	S	Bend	trans	-78.1	48.4	175.9	-64.2	-169.3	173.2	0	0	112.3	Q6	Q6-E8 PolarHBondContact O-N 3.18Å
9	L	91	Very high	83.8	Confident	16 Å²	16	96.5 Å²	96.5	8%	0.084	47%	0.47	C	S	.	.			trans	-87.8	-7.5	-179.7	-67.7	178.2	0	0	0	113.3	P7 K11 Y12 L31 F34 I40 V70	P7-L9 HydrophobicContact CB-CD1 4.12Å; P7-L9 HydrophobicContact CB-CG 4Å; P7-L9 PolarHBondContact O-N 3.18Å; L9-K11 PolarHBondContact O-N 2.86Å; L9-Y12 HydrophobicContact CD2-CD2 4.09Å; L9-Y12 WeakPolarHBondContact O-CA 3.38Å; L9-Y12 WeakPolarHBondContact O-CB 3.49Å; L9-Y12 PolarHBondContact O-N 2.87Å; L9-L31 HydrophobicContact CB-CD2 4.14Å; L9-F34 HydrophobicContact CB-CD1 3.78Å; L9-F34 HydrophobicContact CB-CD2 4.06Å; L9-F34 HydrophobicContact CB-CE1 3.85Å; L9-F34 HydrophobicContact CB-CE2 4.11Å; L9-F34 HydrophobicContact CB-CG 3.9Å; L9-F34 HydrophobicContact CB-CZ 4.02Å; L9-F34 HydrophobicContact CD1-CB 4.1Å; L9-F34 HydrophobicContact CD1-CD2 4.35Å; L9-F34 HydrophobicContact CD1-CG 4.15Å; L9-I40 HydrophobicContact CD1-CD1 3.92Å; L9-I40 HydrophobicContact CD1-CG1 4.23Å; L9-V70 HydrophobicContact CD2-CG1 4.21Å
10	K	92.3	Very high	84.5	Confident	165 Å²	165	95.3 Å²	95.3	72%	0.717	46%	0.462	S	S	*	.	G	3₁₀ helix	trans	-56.1	-36.9	-177.5	-168.8	176.8	-179.2	-179.9	0	113	Y12 L13 F34	K10-Y12 PolarHBondContact O-N 3.21Å; K10-L13 HydrophobicContact CG-CD1 4.02Å; K10-L13 WeakPolarHBondContact O-CG 3.45Å; K10-L13 PolarHBondContact O-N 2.9Å; K10-F34 HydrophobicContact CB-CE1 4.48Å; K10-F34 HydrophobicContact CB-CZ 4.23Å
11	K	92.1	Very high	85.1	Confident	110 Å²	110	91.2 Å²	91.2	48%	0.478	44%	0.443	S	S	.	.	G	3₁₀ helix	trans	-69.1	-14	177.7	68.2	-175.2	178.9	-171.5	0	114.1	L9 I76	L9-K11 PolarHBondContact O-N 2.86Å; K11-I76 HydrophobicContact CD-CD1 4.2Å; K11-I76 HydrophobicContact CG-CD1 4.34Å
12	Y	94.4	Very high	87.5	Confident	49 Å²	49	82.9 Å²	82.9	19%	0.192	40%	0.403	C	S	.	.	G	3₁₀ helix	trans	-101.3	1.2	178.8	-61.4	-85.1	0	0	0	113	L9 K10 D14 K15 L17 L31 I76	L9-Y12 HydrophobicContact CD2-CD2 4.09Å; L9-Y12 WeakPolarHBondContact O-CA 3.38Å; L9-Y12 WeakPolarHBondContact O-CB 3.49Å; L9-Y12 PolarHBondContact O-N 2.87Å; K10-Y12 PolarHBondContact O-N 3.21Å; Y12-D14 PolarHBondContact O-N 3.47Å; Y12-K15 VanDerWaalsContact O-CB 3.27Å; Y12-K15 WeakPolarHBondContact O-CB 3.47Å; Y12-K15 PolarHBondContact O-N 3.3Å; Y12-L17 HydrophobicContact CD1-CD2 3.66Å; Y12-L17 HydrophobicContact CE1-CD2 4.43Å; Y12-L17 HydrophobicContact CG-CD2 3.99Å; Y12-L31 WeakPolarHBondContact O-CB 3.5Å; Y12-I76 HydrophobicContact CD1-CD1 3.9Å; Y12-I76 HydrophobicContact CD1-CG1 4.38Å; Y12-I76 HydrophobicContact CE1-CD1 3.23Å; Y12-I76 HydrophobicContact CE1-CG1 4.03Å; Y12-I76 HydrophobicContact CE2-CD1 4.33Å; Y12-I76 VanDerWaalsContact CZ-CD1 3.47Å
13	L	95	Very high	89.3	Confident	62 Å²	62	81 Å²	81	33%	0.325	40%	0.395	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57.2	137.3	174.9	-73.4	169.7	0	0	0	110	K10 K15 L31 F34	K10-L13 HydrophobicContact CG-CD1 4.02Å; K10-L13 WeakPolarHBondContact O-CG 3.45Å; K10-L13 PolarHBondContact O-N 2.9Å; L13-K15 PolarHBondContact O-N 3.28Å; L13-K15 VanDerWaalsContact O-N 3.1Å; L13-L31 HydrophobicContact CD2-CD2 4.18Å; L13-L31 HydrophobicContact CD2-CG 4.17Å; L13-F34 HydrophobicContact CD2-CD1 4.29Å; L13-F34 HydrophobicContact CD2-CE1 4.27Å; L13-F34 HydrophobicContact CG-CE1 4.39Å
14	D	96	Very high	90.9	Very high	104 Å²	104	78.3 Å²	78.3	56%	0.556	39%	0.39	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.3	15.4	-174.3	-58.2	-55.9	0	0	0	114.8	Y12 L31 R32	Y12-D14 PolarHBondContact O-N 3.47Å; D14-L31 PolarHBondContact N-O 2.74Å; D14-R32 IonicContact OD1-CZ 3.96Å; D14-R32 IonicContact OD1-NH1 3.39Å; D14-R32 PolarHBondContact OD1-NH1 3.1Å
15	K	96.6	Very high	92.4	Very high	74 Å²	74	80.5 Å²	80.5	32%	0.322	38%	0.383	S	S	.	.	S	Bend	trans	-101.8	152.3	171.8	-56.1	-62.2	-176.1	167.3	0	111	Y12 L13 L17 V30 L31 D74	Y12-K15 VanDerWaalsContact O-CB 3.27Å; Y12-K15 WeakPolarHBondContact O-CB 3.47Å; Y12-K15 PolarHBondContact O-N 3.3Å; L13-K15 PolarHBondContact O-N 3.28Å; L13-K15 VanDerWaalsContact O-N 3.1Å; K15-L17 PolarHBondContact O-N 3.32Å; K15-V30 WeakPolarHBondContact O-CA 3.18Å; K15-L31 PolarHBondContact O-N 3.21Å; K15-D74 HydrophobicContact CD-CB 4.49Å
16	R	96.7	Very high	93.6	Very high	72 Å²	72	75 Å²	75	27%	0.272	36%	0.358	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.2	125.6	173.5	-171.1	172.3	-65.8	-79.1	-1.5	110.2	V28 G29 V73 D74	R16-V28 HydrophobicContact CG-CG1 3.73Å; R16-G29 WeakPolarHBondContact CA-O 3.5Å; R16-V73 HydrophobicContact CB-CB 4.13Å; R16-V73 HydrophobicContact CG-CB 4.04Å; R16-V73 HydrophobicContact CG-CG1 4.48Å; R16-V73 HydrophobicContact CG-CG2 4.07Å; R16-V73 PolarHBondContact O-N 2.82Å; R16-D74 WeakPolarHBondContact CB-OD2 3.45Å; R16-D74 PolarHBondContact N-OD2 3.4Å
17	L	96.7	Very high	94.6	Very high	0 Å²	0	68.7 Å²	68.7	0%	0	33%	0.329	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.4	144.3	175	-65.1	-174.8	0	0	0	110.5	Y12 K15 L19 V28 G29 L31 V70 E71	Y12-L17 HydrophobicContact CD1-CD2 3.66Å; Y12-L17 HydrophobicContact CE1-CD2 4.43Å; Y12-L17 HydrophobicContact CG-CD2 3.99Å; K15-L17 PolarHBondContact O-N 3.32Å; L17-L19 HydrophobicContact CB-CD2 4.17Å; L17-L19 HydrophobicContact CD1-CD2 4.44Å; L17-V28 CarbonylContact O-C 3.6Å; L17-V28 VanDerWaalsContact O-CA 3.28Å; L17-V28 WeakPolarHBondContact O-CA 3.48Å; L17-V28 WeakPolarHBondContact O-CG1 3.02Å; L17-G29 PolarHBondContact N-O 3.46Å; L17-G29 PolarHBondContact O-N 2.92Å; L17-L31 HydrophobicContact CD1-CB 3.7Å; L17-L31 HydrophobicContact CD1-CD1 4.16Å; L17-L31 HydrophobicContact CD1-CD2 3.98Å; L17-L31 HydrophobicContact CD1-CG 4.14Å; L17-L31 HydrophobicContact CG-CB 4.14Å; L17-V70 HydrophobicContact CD1-CG1 3.8Å; L17-V70 HydrophobicContact CD2-CG1 4.13Å; L17-V70 HydrophobicContact CG-CG1 4.42Å; L17-E71 CarbonylContact C-O 3.56Å; L17-E71 WeakPolarHBondContact CA-O 3.32Å
18	R	97.2	Very high	95.4	Very high	98 Å²	98	67.7 Å²	67.7	37%	0.37	32%	0.322	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.6	120.2	164.3	167.2	179.2	-80.1	170.5	-7.5	108.3	E26 V28 E71 V73	R18-E26 VanDerWaalsContact CD-OE1 3.31Å; R18-E26 WeakPolarHBondContact CD-OE1 3.41Å; R18-E26 HydrophobicContact CG-CG 4.04Å; R18-E26 IonicContact CZ-OE1 2.74Å; R18-E26 VanDerWaalsContact CZ-OE1 3.3Å; R18-E26 IonicContact NE-OE1 3.72Å; R18-E26 PolarHBondContact NE-OE1 3.41Å; R18-E26 IonicContact NH2-OE1 3.81Å; R18-E26 PolarHBondContact NH2-OE1 3.25Å; R18-V28 HydrophobicContact CB-CG2 4.09Å; R18-V28 HydrophobicContact CG-CG2 4.23Å; R18-E71 HydrophobicContact CB-CB 4.18Å; R18-E71 VanDerWaalsContact CD-OE2 3.3Å; R18-E71 WeakPolarHBondContact CD-OE2 2.94Å; R18-E71 PolarHBondContact N-O 2.61Å; R18-E71 PolarHBondContact O-N 2.9Å; R18-V73 HydrophobicContact CB-CG2 3.93Å
19	L	97.3	Very high	96	Very high	0 Å²	0	61.2 Å²	61.2	0%	0	29%	0.292	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.7	112.6	-178.7	-52.5	179.3	0	0	0	108.8	L17 L21 E26 V27 I40 V42 V62 V70	L17-L19 HydrophobicContact CB-CD2 4.17Å; L17-L19 HydrophobicContact CD1-CD2 4.44Å; L19-L21 HydrophobicContact CB-CD2 4.03Å; L19-E26 WeakPolarHBondContact O-CA 3.48Å; L19-V27 WeakPolarHBondContact CA-O 3.42Å; L19-V27 WeakPolarHBondContact CB-O 3.27Å; L19-V27 PolarHBondContact N-O 2.81Å; L19-V27 PolarHBondContact O-N 3.16Å; L19-I40 HydrophobicContact CD1-CG2 4.11Å; L19-I40 HydrophobicContact CD2-CD1 3.96Å; L19-V42 HydrophobicContact CD1-CG1 4.03Å; L19-V62 HydrophobicContact CD1-CB 4.42Å; L19-V62 HydrophobicContact CD1-CG2 3.98Å; L19-V70 HydrophobicContact CD2-CB 4.35Å; L19-V70 HydrophobicContact CD2-CG1 3.96Å; L19-V70 HydrophobicContact CD2-CG2 3.95Å
20	K	97.4	Very high	96.3	Very high	72 Å²	72	61.2 Å²	61.2	31%	0.313	29%	0.293	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.4	121.9	170	-69.8	173.8	174.6	160.5	0	108.7	N68 I69 E71	K20-N68 WeakPolarHBondContact O-CB 3.37Å; K20-N68 PolarHBondContact O-N 2.83Å; K20-I69 HydrophobicContact CB-CB 4.09Å; K20-I69 HydrophobicContact CD-CB 4.2Å; K20-I69 HydrophobicContact CD-CD1 4Å; K20-I69 HydrophobicContact CD-CG1 4.44Å; K20-I69 PolarHBondContact N-O 2.91Å; K20-I69 PolarHBondContact O-N 2.88Å; K20-E71 WeakPolarHBondContact CE-OE1 3.4Å; K20-E71 IonicContact NZ-OE1 2.65Å; K20-E71 PolarHBondContact NZ-OE1 2.92Å; K20-E71 IonicContact NZ-OE2 2.61Å
21	L	97.7	Very high	96.5	Very high	11 Å²	11	53.4 Å²	53.4	6%	0.058	26%	0.259	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	171.6	-173.1	-49.6	-178.5	0	0	0	111.6	L19 R25 V27 V62 S66 I67 N68	L19-L21 HydrophobicContact CB-CD2 4.03Å; L21-R25 HydrophobicContact CB-CB 4.19Å; L21-R25 PolarHBondContact N-O 2.93Å; L21-V27 HydrophobicContact CD1-CB 4.46Å; L21-V27 HydrophobicContact CD1-CG2 3.79Å; L21-V62 HydrophobicContact CD1-CG1 4.37Å; L21-V62 HydrophobicContact CD2-CG1 3.61Å; L21-S66 CarbonylContact C-O 3.55Å; L21-S66 WeakPolarHBondContact CA-O 3.23Å; L21-I67 HydrophobicContact CD2-CB 4.46Å; L21-I67 HydrophobicContact CD2-CG1 3.94Å; L21-N68 VanDerWaalsContact C-ND2 3.3Å; L21-N68 PolarHBondContact O-ND2 3.06Å
22	N	97.2	Very high	96.8	Very high	62 Å²	62	54 Å²	54	33%	0.332	26%	0.258	S	S	.	.	T	Hydrogen-bonded Turn	trans	-54.4	147.6	169.7	-70.7	-18.3	0	0	0	112.3	R25 N65 S66 N68	N22-R25 PolarHBondContact O-NE 3.4Å; N22-R25 VanDerWaalsContact O-NE 3.15Å; N22-N65 PolarHBondContact ND2-O 2.9Å; N22-S66 PolarHBondContact N-O 2.93Å; N22-N68 PolarHBondContact N-ND2 3.25Å; N22-N68 PolarHBondContact OD1-ND2 2.92Å; N22-N68 VanDerWaalsContact OD1-ND2 3.14Å; N22-N68 PolarHBondContact OD1-OD1 3.15Å
23	A	96	Very high	96.9	Very high	79 Å²	79	52.6 Å²	52.6	65%	0.653	26%	0.259	S	S	*	.	T	Hydrogen-bonded Turn	trans	64.1	33.2	-177.3	0	0	0	0	0	114.6	R25	A23-R25 PolarHBondContact O-N 2.75Å
24	N	94.1	Very high	97	Very high	145 Å²	145	52.8 Å²	52.8	78%	0.775	26%	0.257	S	S	*	.	T	Hydrogen-bonded Turn	trans	55.4	36.3	178.6	-59.8	-31.1	0	0	0	113
25	R	96.8	Very high	96.9	Very high	117 Å²	117	50.7 Å²	50.7	44%	0.442	25%	0.246	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-92.1	148.6	171.8	-67	-179.6	-63.6	151.7	0.7	109.1	L21 N22 A23	L21-R25 HydrophobicContact CB-CB 4.19Å; L21-R25 PolarHBondContact N-O 2.93Å; N22-R25 PolarHBondContact O-NE 3.4Å; N22-R25 VanDerWaalsContact O-NE 3.15Å; A23-R25 PolarHBondContact O-N 2.75Å
26	E	97.4	Very high	96.7	Very high	35 Å²	35	49.4 Å²	49.4	16%	0.164	25%	0.249	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-133.1	132.7	179.9	-178.5	177.5	139.4	0	0	109.6	R18 L19 V28 E47 V48	R18-E26 VanDerWaalsContact CD-OE1 3.31Å; R18-E26 WeakPolarHBondContact CD-OE1 3.41Å; R18-E26 HydrophobicContact CG-CG 4.04Å; R18-E26 IonicContact CZ-OE1 2.74Å; R18-E26 VanDerWaalsContact CZ-OE1 3.3Å; R18-E26 IonicContact NE-OE1 3.72Å; R18-E26 PolarHBondContact NE-OE1 3.41Å; R18-E26 IonicContact NH2-OE1 3.81Å; R18-E26 PolarHBondContact NH2-OE1 3.25Å; L19-E26 WeakPolarHBondContact O-CA 3.48Å; E26-V28 HydrophobicContact CG-CG2 4.5Å; E26-E47 WeakPolarHBondContact O-CA 3.34Å; E26-V48 HydrophobicContact CB-CB 4.1Å; E26-V48 HydrophobicContact CG-CB 4.17Å; E26-V48 HydrophobicContact CG-CG2 4.31Å; E26-V48 PolarHBondContact O-N 3.18Å
27	V	97.8	Very high	96.4	Very high	13 Å²	13	53.5 Å²	53.5	8%	0.079	27%	0.269	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.2	131.3	174.9	174.5	0	0	0	0	108.3	L19 L21 V42 A45 Y46 I57	L19-V27 WeakPolarHBondContact CA-O 3.42Å; L19-V27 WeakPolarHBondContact CB-O 3.27Å; L19-V27 PolarHBondContact N-O 2.81Å; L19-V27 PolarHBondContact O-N 3.16Å; L21-V27 HydrophobicContact CD1-CB 4.46Å; L21-V27 HydrophobicContact CD1-CG2 3.79Å; V27-V42 HydrophobicContact CG1-CG2 4.42Å; V27-A45 HydrophobicContact CG1-CB 4.26Å; V27-Y46 WeakPolarHBondContact CA-O 3.45Å; V27-I57 HydrophobicContact CG2-CD1 4.46Å
28	V	97.6	Very high	96.3	Very high	1 Å²	1	57.7 Å²	57.7	1%	0.006	29%	0.289	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.3	133.5	174.5	-177.8	0	0	0	0	108.5	R16 L17 R18 E26 A45 Y46 V48 V73	R16-V28 HydrophobicContact CG-CG1 3.73Å; L17-V28 CarbonylContact O-C 3.6Å; L17-V28 VanDerWaalsContact O-CA 3.28Å; L17-V28 WeakPolarHBondContact O-CA 3.48Å; L17-V28 WeakPolarHBondContact O-CG1 3.02Å; R18-V28 HydrophobicContact CB-CG2 4.09Å; R18-V28 HydrophobicContact CG-CG2 4.23Å; E26-V28 HydrophobicContact CG-CG2 4.5Å; V28-A45 CarbonylContact O-C 3.55Å; V28-A45 VanDerWaalsContact O-CA 3.23Å; V28-A45 WeakPolarHBondContact O-CA 3.41Å; V28-Y46 HydrophobicContact CB-CD1 4.42Å; V28-Y46 HydrophobicContact CB-CD2 4.24Å; V28-Y46 HydrophobicContact CB-CE1 3.87Å; V28-Y46 HydrophobicContact CB-CE2 3.64Å; V28-Y46 VanDerWaalsContact CB-CZ 3.45Å; V28-Y46 HydrophobicContact CG1-CE1 3.91Å; V28-Y46 HydrophobicContact CG1-CE2 4.32Å; V28-Y46 WeakPolarHBondContact CG1-OH 3.23Å; V28-Y46 HydrophobicContact CG2-CE2 3.9Å; V28-Y46 PolarHBondContact N-O 2.82Å; V28-Y46 PolarHBondContact O-N 2.98Å; V28-V48 HydrophobicContact CG2-CG2 3.99Å; V28-V73 HydrophobicContact CG1-CG2 4.44Å
29	G	97.7	Very high	96.2	Very high	0 Å²	0	55.1 Å²	55.1	0%	0	28%	0.283	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-169.4	173.3	-179.4	0	0	0	0	0	112.3	R16 L17 S43	R16-G29 WeakPolarHBondContact CA-O 3.5Å; L17-G29 PolarHBondContact N-O 3.46Å; L17-G29 PolarHBondContact O-N 2.92Å; G29-S43 CarbonylContact C-O 3.44Å; G29-S43 WeakPolarHBondContact CA-O 3.47Å
30	V	97.7	Very high	96.2	Very high	17 Å²	17	55.1 Å²	55.1	10%	0.103	28%	0.283	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.4	125.3	178.6	179.1	0	0	0	0	109.5	K15 R32 V42 S43	K15-V30 WeakPolarHBondContact O-CA 3.18Å; V30-R32 PolarHBondContact O-N 2.87Å; V30-V42 CarbonylContact O-C 3.59Å; V30-V42 VanDerWaalsContact O-CA 3.23Å; V30-V42 WeakPolarHBondContact O-CA 3.4Å; V30-S43 PolarHBondContact N-O 2.96Å; V30-S43 PolarHBondContact O-N 3.01Å
31	L	97.5	Very high	96.2	Very high	0 Å²	0	53.9 Å²	53.9	0%	0	28%	0.282	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.1	119.8	178.9	179.7	65	0	0	0	110.7	L9 Y12 L13 D14 K15 L17 G33 F34 I40	L9-L31 HydrophobicContact CB-CD2 4.14Å; Y12-L31 WeakPolarHBondContact O-CB 3.5Å; L13-L31 HydrophobicContact CD2-CD2 4.18Å; L13-L31 HydrophobicContact CD2-CG 4.17Å; D14-L31 PolarHBondContact N-O 2.74Å; K15-L31 PolarHBondContact O-N 3.21Å; L17-L31 HydrophobicContact CD1-CB 3.7Å; L17-L31 HydrophobicContact CD1-CD1 4.16Å; L17-L31 HydrophobicContact CD1-CD2 3.98Å; L17-L31 HydrophobicContact CD1-CG 4.14Å; L17-L31 HydrophobicContact CG-CB 4.14Å; L31-G33 WeakPolarHBondContact CD1-O 3.34Å; L31-F34 HydrophobicContact CD2-CD1 4.29Å; L31-I40 HydrophobicContact CD1-CB 4.49Å; L31-I40 HydrophobicContact CD1-CG1 4.49Å; L31-I40 HydrophobicContact CD1-CG2 3.53Å
32	R	97.8	Very high	96.2	Very high	124 Å²	124	53.4 Å²	53.4	47%	0.468	28%	0.279	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.4	-25.3	176.2	-62.6	-54.4	-172.3	160.9	6.8	113.8	D14 V30 V41 S43 D44	D14-R32 IonicContact OD1-CZ 3.96Å; D14-R32 IonicContact OD1-NH1 3.39Å; D14-R32 PolarHBondContact OD1-NH1 3.1Å; V30-R32 PolarHBondContact O-N 2.87Å; R32-V41 HydrophobicContact CB-CB 4.43Å; R32-V41 HydrophobicContact CB-CG1 4.2Å; R32-V41 PolarHBondContact N-O 3.42Å; R32-S43 PolarHBondContact NE-OG 2.89Å; R32-S43 PolarHBondContact NH2-OG 2.79Å; R32-D44 IonicContact NH2-OD2 2.78Å
33	G	97.1	Very high	96.3	Very high	19 Å²	19	50.9 Å²	50.9	20%	0.196	27%	0.266	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-171.7	159.5	-178.9	0	0	0	0	0	111.9	L31 V41	L31-G33 WeakPolarHBondContact CD1-O 3.34Å; G33-V41 PolarHBondContact N-O 2.91Å; G33-V41 PolarHBondContact O-N 3.07Å
34	F	96.5	Very high	96.3	Very high	65 Å²	65	51.2 Å²	51.2	29%	0.285	26%	0.257	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.7	164.8	175	64.9	-82.7	0	0	0	110.3	P7 L9 K10 L13 L31 N39 I40	P7-F34 HydrophobicContact CB-CD2 4.41Å; P7-F34 HydrophobicContact CB-CE2 4.5Å; P7-F34 WeakPolarHBondContact O-CE2 3.29Å; L9-F34 HydrophobicContact CB-CD1 3.78Å; L9-F34 HydrophobicContact CB-CD2 4.06Å; L9-F34 HydrophobicContact CB-CE1 3.85Å; L9-F34 HydrophobicContact CB-CE2 4.11Å; L9-F34 HydrophobicContact CB-CG 3.9Å; L9-F34 HydrophobicContact CB-CZ 4.02Å; L9-F34 HydrophobicContact CD1-CB 4.1Å; L9-F34 HydrophobicContact CD1-CD2 4.35Å; L9-F34 HydrophobicContact CD1-CG 4.15Å; K10-F34 HydrophobicContact CB-CE1 4.48Å; K10-F34 HydrophobicContact CB-CZ 4.23Å; L13-F34 HydrophobicContact CD2-CD1 4.29Å; L13-F34 HydrophobicContact CD2-CE1 4.27Å; L13-F34 HydrophobicContact CG-CE1 4.39Å; L31-F34 HydrophobicContact CD2-CD1 4.29Å; F34-N39 WeakPolarHBondContact CA-O 3.49Å; F34-I40 HydrophobicContact CB-CG1 4.47Å
35	D	94.2	Very high	96.5	Very high	60 Å²	60	44.3 Å²	44.3	32%	0.321	22%	0.22	S	C	.	.			trans	-126.6	-177	174.8	72.1	14.9	0	0	0	112.8	F37 M38 N39	D35-F37 PolarHBondContact O-N 2.85Å; D35-F37 WeakPolarHBondContact OD1-CA 3.43Å; D35-F37 PolarHBondContact OD1-N 2.84Å; D35-M38 PolarHBondContact O-N 2.92Å; D35-M38 VanDerWaalsContact O-N 3.16Å; D35-M38 PolarHBondContact OD1-N 3.27Å; D35-N39 PolarHBondContact N-O 2.86Å; D35-N39 WeakPolarHBondContact OD1-CB 3.28Å; D35-N39 PolarHBondContact OD1-N 3.49Å; D35-N39 PolarHBondContact OD1-ND2 3.27Å; D35-N39 WeakPolarHBondContact OD2-CB 3.3Å; D35-N39 PolarHBondContact OD2-ND2 3.15Å
36	A	91.7	Very high	96.6	Very high	47 Å²	47	41 Å²	41	39%	0.388	21%	0.208	S	C	.	.	T	Hydrogen-bonded Turn	trans	-66.4	-14.3	-178.8	0	0	0	0	0	114.3
37	F	91.9	Very high	96.6	Very high	158 Å²	158	42.4 Å²	42.4	69%	0.693	22%	0.215	S	C	*	.	T	Hydrogen-bonded Turn	trans	-99.8	9.3	177.7	-57.2	-73.9	0	0	0	112.4	D35 N39 G64	D35-F37 PolarHBondContact O-N 2.85Å; D35-F37 WeakPolarHBondContact OD1-CA 3.43Å; D35-F37 PolarHBondContact OD1-N 2.84Å; F37-N39 PolarHBondContact O-N 2.78Å; F37-G64 WeakPolarHBondContact O-CA 3.42Å
38	M	93.1	Very high	96.5	Very high	88 Å²	88	43.2 Å²	43.2	43%	0.433	22%	0.219	S	C	.	.			trans	58	27.5	-170.7	-59.2	-174.4	-60.9	0	0	113.3	P7 D35 I40 G64 I67	P7-M38 HydrophobicContact CB-CG 3.95Å; P7-M38 HydrophobicContact CG-CB 4.47Å; P7-M38 HydrophobicContact CG-CG 3.35Å; P7-M38 HydrophobicContact CG-SD 4.39Å; D35-M38 PolarHBondContact O-N 2.92Å; D35-M38 VanDerWaalsContact O-N 3.16Å; D35-M38 PolarHBondContact OD1-N 3.27Å; M38-I40 PolarHBondContact O-N 2.8Å; M38-G64 VanDerWaalsContact C-CA 3.48Å; M38-G64 WeakPolarHBondContact O-CA 3.32Å; M38-I67 WeakPolarHBondContact O-CD1 3.34Å
39	N	96.1	Very high	96.4	Very high	44 Å²	44	44.5 Å²	44.5	24%	0.235	23%	0.227	C	C	.	.			trans	-66.9	132	162.4	-56.6	-49.9	0	0	0	107.5	F34 D35 F37 V62 R63 G64	F34-N39 WeakPolarHBondContact CA-O 3.49Å; D35-N39 PolarHBondContact N-O 2.86Å; D35-N39 WeakPolarHBondContact OD1-CB 3.28Å; D35-N39 PolarHBondContact OD1-N 3.49Å; D35-N39 PolarHBondContact OD1-ND2 3.27Å; D35-N39 WeakPolarHBondContact OD2-CB 3.3Å; D35-N39 PolarHBondContact OD2-ND2 3.15Å; F37-N39 PolarHBondContact O-N 2.78Å; N39-V62 CarbonylContact C-O 3.54Å; N39-V62 VanDerWaalsContact CA-O 3.28Å; N39-V62 WeakPolarHBondContact CA-O 3.38Å; N39-R63 VanDerWaalsContact OD1-CA 3.32Å; N39-R63 WeakPolarHBondContact OD1-CA 3.43Å; N39-G64 PolarHBondContact OD1-N 3.15Å
40	I	97	Very high	96.1	Very high	0 Å²	0	53 Å²	53	0%	0	27%	0.265	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.8	132.8	-171.9	-70.9	-177.1	0	0	0	109.6	L9 L19 L31 F34 M38 V42 V61 V62 I67 V70	L9-I40 HydrophobicContact CD1-CD1 3.92Å; L9-I40 HydrophobicContact CD1-CG1 4.23Å; L19-I40 HydrophobicContact CD1-CG2 4.11Å; L19-I40 HydrophobicContact CD2-CD1 3.96Å; L31-I40 HydrophobicContact CD1-CB 4.49Å; L31-I40 HydrophobicContact CD1-CG1 4.49Å; L31-I40 HydrophobicContact CD1-CG2 3.53Å; F34-I40 HydrophobicContact CB-CG1 4.47Å; M38-I40 PolarHBondContact O-N 2.8Å; I40-V42 HydrophobicContact CG2-CG1 3.83Å; I40-V61 CarbonylContact O-C 3.57Å; I40-V61 WeakPolarHBondContact O-CA 3.46Å; I40-V62 PolarHBondContact N-O 3.23Å; I40-V62 PolarHBondContact O-N 3Å; I40-I67 HydrophobicContact CB-CD1 4.2Å; I40-I67 HydrophobicContact CD1-CD1 3.63Å; I40-I67 HydrophobicContact CG1-CD1 3.91Å; I40-V70 HydrophobicContact CD1-CG2 4.16Å
41	V	98	Very high	96	Very high	47 Å²	47	59 Å²	59	29%	0.285	30%	0.296	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.7	122.7	168.4	-173.1	0	0	0	0	108.3	R32 G33 V61	R32-V41 HydrophobicContact CB-CB 4.43Å; R32-V41 HydrophobicContact CB-CG1 4.2Å; R32-V41 PolarHBondContact N-O 3.42Å; G33-V41 PolarHBondContact N-O 2.91Å; G33-V41 PolarHBondContact O-N 3.07Å; V41-V61 HydrophobicContact CG2-CG2 4.32Å
42	V	97.9	Very high	95.8	Very high	0 Å²	0	61.3 Å²	61.3	0%	0	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.6	139.8	173.7	-74.5	0	0	0	0	111.4	L19 V27 V30 I40 A45 M59 A60	L19-V42 HydrophobicContact CD1-CG1 4.03Å; V27-V42 HydrophobicContact CG1-CG2 4.42Å; V30-V42 CarbonylContact O-C 3.59Å; V30-V42 VanDerWaalsContact O-CA 3.23Å; V30-V42 WeakPolarHBondContact O-CA 3.4Å; I40-V42 HydrophobicContact CG2-CG1 3.83Å; V42-A45 HydrophobicContact CB-CB 4.34Å; V42-A45 HydrophobicContact CG2-CB 3.77Å; V42-M59 WeakPolarHBondContact O-CA 3.31Å; V42-A60 HydrophobicContact CG2-CB 4.08Å; V42-A60 PolarHBondContact N-O 2.84Å; V42-A60 PolarHBondContact O-N 3.48Å
43	S	97.9	Very high	95.7	Very high	9 Å²	9	60.2 Å²	60.2	6%	0.063	32%	0.323	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.2	166.6	164.5	78.6	0	0	0	0	111.2	G29 V30 R32 A45 D58	G29-S43 CarbonylContact C-O 3.44Å; G29-S43 WeakPolarHBondContact CA-O 3.47Å; V30-S43 PolarHBondContact N-O 2.96Å; V30-S43 PolarHBondContact O-N 3.01Å; R32-S43 PolarHBondContact NE-OG 2.89Å; R32-S43 PolarHBondContact NH2-OG 2.79Å; S43-A45 PolarHBondContact O-N 3.25Å; S43-A45 VanDerWaalsContact O-N 3.09Å; S43-D58 CarbonylContact C-O 3.32Å; S43-D58 VanDerWaalsContact C-O 3.32Å
44	D	97.3	Very high	95.7	Very high	86 Å²	86	65.6 Å²	65.6	46%	0.46	34%	0.343	S	S	.	.	E	Extended strand (participates in β ladder)	trans	50.5	37.2	179.6	-48.7	-64	0	0	0	111.6	R32 D58	R32-D44 IonicContact NH2-OD2 2.78Å; D44-D58 PolarHBondContact N-O 3.43Å
45	A	97.8	Very high	95.7	Very high	1 Å²	1	66.6 Å²	66.6	1%	0.008	35%	0.351	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.4	140.8	-171.5	0	0	0	0	0	110.7	V27 V28 V42 S43 I57 D58	V27-A45 HydrophobicContact CG1-CB 4.26Å; V28-A45 CarbonylContact O-C 3.55Å; V28-A45 VanDerWaalsContact O-CA 3.23Å; V28-A45 WeakPolarHBondContact O-CA 3.41Å; V42-A45 HydrophobicContact CB-CB 4.34Å; V42-A45 HydrophobicContact CG2-CB 3.77Å; S43-A45 PolarHBondContact O-N 3.25Å; S43-A45 VanDerWaalsContact O-N 3.09Å; A45-I57 HydrophobicContact CB-CB 4.3Å; A45-I57 PolarHBondContact O-N 2.65Å; A45-D58 WeakPolarHBondContact CB-O 3.49Å; A45-D58 PolarHBondContact N-O 2.96Å; A45-D58 PolarHBondContact O-N 2.76Å
46	Y	97.9	Very high	95.9	Very high	48 Å²	48	70.9 Å²	70.9	19%	0.188	37%	0.366	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136	144	168.2	59.2	-91.9	0	0	0	110.3	V27 V28 V48 Q54 I55	V27-Y46 WeakPolarHBondContact CA-O 3.45Å; V28-Y46 HydrophobicContact CB-CD1 4.42Å; V28-Y46 HydrophobicContact CB-CD2 4.24Å; V28-Y46 HydrophobicContact CB-CE1 3.87Å; V28-Y46 HydrophobicContact CB-CE2 3.64Å; V28-Y46 VanDerWaalsContact CB-CZ 3.45Å; V28-Y46 HydrophobicContact CG1-CE1 3.91Å; V28-Y46 HydrophobicContact CG1-CE2 4.32Å; V28-Y46 WeakPolarHBondContact CG1-OH 3.23Å; V28-Y46 HydrophobicContact CG2-CE2 3.9Å; V28-Y46 PolarHBondContact N-O 2.82Å; V28-Y46 PolarHBondContact O-N 2.98Å; Y46-V48 HydrophobicContact CD2-CG2 3.92Å; Y46-V48 HydrophobicContact CE2-CG2 3.64Å; Y46-Q54 HydrophobicContact CD2-CB 3.88Å; Y46-Q54 HydrophobicContact CD2-CG 3.7Å; Y46-Q54 HydrophobicContact CE2-CB 4.44Å; Y46-Q54 VanDerWaalsContact CE2-CD 3.48Å; Y46-Q54 HydrophobicContact CE2-CG 3.79Å; Y46-Q54 HydrophobicContact CG-CB 4.38Å; Y46-I55 CarbonylContact C-O 3.46Å; Y46-I55 WeakPolarHBondContact CA-O 3.44Å; Y46-I55 WeakPolarHBondContact CB-O 3.28Å
47	E	97.6	Very high	96.1	Very high	63 Å²	63	71.9 Å²	71.9	29%	0.294	36%	0.364	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.3	136.7	166.9	172.9	172.4	-158.9	0	0	109.4	E26 Q54 I55 I57	E26-E47 WeakPolarHBondContact O-CA 3.34Å; E47-Q54 CarbonylContact O-C 3.59Å; E47-Q54 VanDerWaalsContact O-CA 3.32Å; E47-Q54 WeakPolarHBondContact O-CA 3.43Å; E47-I55 HydrophobicContact CB-CB 4.44Å; E47-I55 PolarHBondContact N-O 2.79Å; E47-I55 PolarHBondContact O-N 3.04Å; E47-I57 HydrophobicContact CB-CD1 3.91Å
48	V	97	Very high	96.4	Very high	30 Å²	30	67.8 Å²	67.8	18%	0.182	35%	0.35	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.7	109.2	167.6	-178.3	0	0	0	0	107.2	E26 V28 Y46	E26-V48 HydrophobicContact CB-CB 4.1Å; E26-V48 HydrophobicContact CG-CB 4.17Å; E26-V48 HydrophobicContact CG-CG2 4.31Å; E26-V48 PolarHBondContact O-N 3.18Å; V28-V48 HydrophobicContact CG2-CG2 3.99Å; Y46-V48 HydrophobicContact CD2-CG2 3.92Å; Y46-V48 HydrophobicContact CE2-CG2 3.64Å
49	T	95	Very high	96.6	Very high	28 Å²	28	69.9 Å²	69.9	17%	0.172	36%	0.36	C	S	.	.			trans	-71.6	165.3	178.3	75.6	0	0	0	0	110.7	D51 G52 N53 I55	T49-D51 PolarHBondContact O-N 3.09Å; T49-D51 VanDerWaalsContact O-N 3.15Å; T49-D51 PolarHBondContact OG1-N 2.92Å; T49-G52 PolarHBondContact O-N 2.78Å; T49-N53 HydrophobicContact CG2-CB 4.28Å; T49-N53 PolarHBondContact N-O 2.82Å; T49-N53 WeakPolarHBondContact OG1-CB 3.38Å; T49-N53 PolarHBondContact OG1-N 2.95Å; T49-I55 HydrophobicContact CG2-CD1 3.46Å; T49-I55 VanDerWaalsContact CG2-CD1 3.46Å; T49-I55 HydrophobicContact CG2-CG1 3.85Å
50	K	92.1	Very high	96.6	Very high	180 Å²	180	68.8 Å²	68.8	78%	0.783	36%	0.357	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.7	-27	176.4	-64.5	-179	-178.9	176.2	0	113.2	G52	K50-G52 VanDerWaalsContact C-N 3.27Å
51	D	94.4	Very high	96.7	Very high	142 Å²	142	74.2 Å²	74.2	76%	0.759	39%	0.39	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.3	0.6	177.9	-50.9	-45.2	0	0	0	112.7	T49 N53	T49-D51 PolarHBondContact O-N 3.09Å; T49-D51 VanDerWaalsContact O-N 3.15Å; T49-D51 PolarHBondContact OG1-N 2.92Å; D51-N53 VanDerWaalsContact C-N 3.34Å
52	G	93.1	Very high	96.6	Very high	48 Å²	48	72.6 Å²	72.6	50%	0.495	38%	0.38	S	S	.	.	S	Bend	trans	84	3.1	-178.2	0	0	0	0	0	114.8	T49 K50	T49-G52 PolarHBondContact O-N 2.78Å; K50-G52 VanDerWaalsContact C-N 3.27Å
53	N	96.3	Very high	96.6	Very high	102 Å²	102	80.9 Å²	80.9	55%	0.545	41%	0.411	S	S	.	.			trans	-70.9	148.1	175.8	-66.6	-43	0	0	0	110.8	T49 D51	T49-N53 HydrophobicContact CG2-CB 4.28Å; T49-N53 PolarHBondContact N-O 2.82Å; T49-N53 WeakPolarHBondContact OG1-CB 3.38Å; T49-N53 PolarHBondContact OG1-N 2.95Å; D51-N53 VanDerWaalsContact C-N 3.34Å
54	Q	96.9	Very high	96.5	Very high	131 Å²	131	80.6 Å²	80.6	61%	0.612	41%	0.41	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105.4	115.8	176.2	-63.5	-177.2	13.3	0	0	109.9	Y46 E47	Y46-Q54 HydrophobicContact CD2-CB 3.88Å; Y46-Q54 HydrophobicContact CD2-CG 3.7Å; Y46-Q54 HydrophobicContact CE2-CB 4.44Å; Y46-Q54 VanDerWaalsContact CE2-CD 3.48Å; Y46-Q54 HydrophobicContact CE2-CG 3.79Å; Y46-Q54 HydrophobicContact CG-CB 4.38Å; E47-Q54 CarbonylContact O-C 3.59Å; E47-Q54 VanDerWaalsContact O-CA 3.32Å; E47-Q54 WeakPolarHBondContact O-CA 3.43Å
55	I	97.5	Very high	96.5	Very high	87 Å²	87	82.6 Å²	82.6	45%	0.446	42%	0.421	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.6	118.9	177	-58.7	176.8	0	0	0	108.4	Y46 E47 T49	Y46-I55 CarbonylContact C-O 3.46Å; Y46-I55 WeakPolarHBondContact CA-O 3.44Å; Y46-I55 WeakPolarHBondContact CB-O 3.28Å; E47-I55 HydrophobicContact CB-CB 4.44Å; E47-I55 PolarHBondContact N-O 2.79Å; E47-I55 PolarHBondContact O-N 3.04Å; T49-I55 HydrophobicContact CG2-CD1 3.46Å; T49-I55 VanDerWaalsContact CG2-CD1 3.46Å; T49-I55 HydrophobicContact CG2-CG1 3.85Å
56	K	97.6	Very high	96.5	Very high	150 Å²	150	84 Å²	84	65%	0.652	43%	0.43	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.5	131.6	-178.6	-164.8	-179.8	-171.9	-116.1	0	111.1	D58	K56-D58 WeakPolarHBondContact CE-OD1 3.13Å; K56-D58 IonicContact NZ-OD1 2.92Å; K56-D58 PolarHBondContact NZ-OD1 3.14Å; K56-D58 IonicContact NZ-OD2 3.3Å; K56-D58 PolarHBondContact NZ-OD2 2.96Å
57	I	96.5	Very high	96.4	Very high	67 Å²	67	82.7 Å²	82.7	34%	0.344	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.2	-27.4	176.2	-60.8	170	0	0	0	111.3	V27 A45 E47 M59 A60	V27-I57 HydrophobicContact CG2-CD1 4.46Å; A45-I57 HydrophobicContact CB-CB 4.3Å; A45-I57 PolarHBondContact O-N 2.65Å; E47-I57 HydrophobicContact CB-CD1 3.91Å; I57-M59 PolarHBondContact O-N 3.39Å; I57-A60 HydrophobicContact CG2-CB 3.91Å
58	D	96.8	Very high	96.4	Very high	73 Å²	73	84.4 Å²	84.4	39%	0.39	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	71.4	-94.4	-172.4	-69.7	-49.8	0	0	0	113.6	S43 D44 A45 K56	S43-D58 CarbonylContact C-O 3.32Å; S43-D58 VanDerWaalsContact C-O 3.32Å; D44-D58 PolarHBondContact N-O 3.43Å; A45-D58 WeakPolarHBondContact CB-O 3.49Å; A45-D58 PolarHBondContact N-O 2.96Å; A45-D58 PolarHBondContact O-N 2.76Å; K56-D58 WeakPolarHBondContact CE-OD1 3.13Å; K56-D58 IonicContact NZ-OD1 2.92Å; K56-D58 PolarHBondContact NZ-OD1 3.14Å; K56-D58 IonicContact NZ-OD2 3.3Å; K56-D58 PolarHBondContact NZ-OD2 2.96Å
59	M	97.4	Very high	96.3	Very high	132 Å²	132	86.8 Å²	86.8	65%	0.65	45%	0.449	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-112.8	129	-178.9	-174.8	172	-78.4	0	0	110.2	V42 I57	V42-M59 WeakPolarHBondContact O-CA 3.31Å; I57-M59 PolarHBondContact O-N 3.39Å
60	A	97.3	Very high	96.3	Very high	21 Å²	21	87.9 Å²	87.9	17%	0.174	46%	0.455	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139	147.1	179	0	0	0	0	0	112.1	V42 I57	V42-A60 HydrophobicContact CG2-CB 4.08Å; V42-A60 PolarHBondContact N-O 2.84Å; V42-A60 PolarHBondContact O-N 3.48Å; I57-A60 HydrophobicContact CG2-CB 3.91Å
61	V	97.7	Very high	96.5	Very high	113 Å²	113	82.2 Å²	82.2	69%	0.685	43%	0.431	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105.5	118.7	167.3	-175.8	0	0	0	0	108	I40 V41	I40-V61 CarbonylContact O-C 3.57Å; I40-V61 WeakPolarHBondContact O-CA 3.46Å; V41-V61 HydrophobicContact CG2-CG2 4.32Å
62	V	97.5	Very high	96.4	Very high	14 Å²	14	77.3 Å²	77.3	9%	0.085	41%	0.414	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.3	123.1	179.4	-175.9	0	0	0	0	108.8	L19 L21 N39 I40 G64 I67	L19-V62 HydrophobicContact CD1-CB 4.42Å; L19-V62 HydrophobicContact CD1-CG2 3.98Å; L21-V62 HydrophobicContact CD1-CG1 4.37Å; L21-V62 HydrophobicContact CD2-CG1 3.61Å; N39-V62 CarbonylContact C-O 3.54Å; N39-V62 VanDerWaalsContact CA-O 3.28Å; N39-V62 WeakPolarHBondContact CA-O 3.38Å; I40-V62 PolarHBondContact N-O 3.23Å; I40-V62 PolarHBondContact O-N 3Å; V62-G64 PolarHBondContact O-N 3.39Å; V62-I67 HydrophobicContact CB-CD1 4.33Å; V62-I67 HydrophobicContact CG1-CD1 3.8Å; V62-I67 HydrophobicContact CG1-CG1 3.61Å
63	R	97.5	Very high	96.4	Very high	173 Å²	173	78.6 Å²	78.6	65%	0.653	41%	0.412	S	S	*	.			trans	-67	130	175.3	-174.8	178.5	-179.4	176.5	-0.1	110.3	N39 N65 S66	N39-R63 VanDerWaalsContact OD1-CA 3.32Å; N39-R63 WeakPolarHBondContact OD1-CA 3.43Å; R63-N65 VanDerWaalsContact C-N 3.31Å; R63-N65 HydrophobicContact CG-CB 4.47Å; R63-N65 PolarHBondContact O-N 2.91Å; R63-S66 VanDerWaalsContact O-CB 3.29Å; R63-S66 WeakPolarHBondContact O-CB 3.15Å; R63-S66 PolarHBondContact O-N 2.9Å
64	G	95.9	Very high	95.7	Very high	3 Å²	3	77.3 Å²	77.3	3%	0.031	41%	0.405	C	S	.	.	G	3₁₀ helix	trans	-59.7	-36.3	-175	0	0	0	0	0	114.5	F37 M38 N39 V62 S66 I67	F37-G64 WeakPolarHBondContact O-CA 3.42Å; M38-G64 VanDerWaalsContact C-CA 3.48Å; M38-G64 WeakPolarHBondContact O-CA 3.32Å; N39-G64 PolarHBondContact OD1-N 3.15Å; V62-G64 PolarHBondContact O-N 3.39Å; G64-S66 PolarHBondContact O-N 2.83Å; G64-S66 VanDerWaalsContact O-N 3.07Å; G64-I67 WeakPolarHBondContact O-CB 3.36Å; G64-I67 PolarHBondContact O-N 3.25Å
65	N	96.4	Very high	94.6	Very high	128 Å²	128	82.4 Å²	82.4	68%	0.684	42%	0.419	S	S	*	.	G	3₁₀ helix	trans	-63.6	-14.2	175	-167	71.3	0	0	0	114.1	N22 R63	N22-N65 PolarHBondContact ND2-O 2.9Å; R63-N65 VanDerWaalsContact C-N 3.31Å; R63-N65 HydrophobicContact CG-CB 4.47Å; R63-N65 PolarHBondContact O-N 2.91Å
66	S	97.6	Very high	93.3	Very high	30 Å²	30	84.9 Å²	84.9	21%	0.21	43%	0.431	C	S	.	.	G	3₁₀ helix	trans	-91.6	-9.6	176.1	-59.6	0	0	0	0	113	L21 N22 R63 G64	L21-S66 CarbonylContact C-O 3.55Å; L21-S66 WeakPolarHBondContact CA-O 3.23Å; N22-S66 PolarHBondContact N-O 2.93Å; R63-S66 VanDerWaalsContact O-CB 3.29Å; R63-S66 WeakPolarHBondContact O-CB 3.15Å; R63-S66 PolarHBondContact O-N 2.9Å; G64-S66 PolarHBondContact O-N 2.83Å; G64-S66 VanDerWaalsContact O-N 3.07Å
67	I	97	Very high	93.1	Very high	21 Å²	21	81.6 Å²	81.6	11%	0.108	42%	0.42	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.7	119.4	-173.4	-52.9	-178.6	0	0	0	109.1	L21 M38 I40 V62 G64 V70	L21-I67 HydrophobicContact CD2-CB 4.46Å; L21-I67 HydrophobicContact CD2-CG1 3.94Å; M38-I67 WeakPolarHBondContact O-CD1 3.34Å; I40-I67 HydrophobicContact CB-CD1 4.2Å; I40-I67 HydrophobicContact CD1-CD1 3.63Å; I40-I67 HydrophobicContact CG1-CD1 3.91Å; V62-I67 HydrophobicContact CB-CD1 4.33Å; V62-I67 HydrophobicContact CG1-CD1 3.8Å; V62-I67 HydrophobicContact CG1-CG1 3.61Å; G64-I67 WeakPolarHBondContact O-CB 3.36Å; G64-I67 PolarHBondContact O-N 3.25Å; I67-V70 HydrophobicContact CG2-CG2 3.61Å
68	N	96.6	Very high	92.9	Very high	99 Å²	99	82.4 Å²	82.4	53%	0.529	42%	0.424	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.4	-44	175.7	-67.7	-38.2	0	0	0	111.5	K20 L21 N22	K20-N68 WeakPolarHBondContact O-CB 3.37Å; K20-N68 PolarHBondContact O-N 2.83Å; L21-N68 VanDerWaalsContact C-ND2 3.3Å; L21-N68 PolarHBondContact O-ND2 3.06Å; N22-N68 PolarHBondContact N-ND2 3.25Å; N22-N68 PolarHBondContact OD1-ND2 2.92Å; N22-N68 VanDerWaalsContact OD1-ND2 3.14Å; N22-N68 PolarHBondContact OD1-OD1 3.15Å
69	I	95.8	Very high	92.7	Very high	81 Å²	81	82.9 Å²	82.9	42%	0.415	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.4	139.1	-178.1	-49	-179.7	0	0	0	109.5	K20 E71	K20-I69 HydrophobicContact CB-CB 4.09Å; K20-I69 HydrophobicContact CD-CB 4.2Å; K20-I69 HydrophobicContact CD-CD1 4Å; K20-I69 HydrophobicContact CD-CG1 4.44Å; K20-I69 PolarHBondContact N-O 2.91Å; K20-I69 PolarHBondContact O-N 2.88Å; I69-E71 HydrophobicContact CG2-CG 3.8Å
70	V	95.3	Very high	92.4	Very high	50 Å²	50	80 Å²	80	30%	0.303	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114	117.5	169.2	-177.5	0	0	0	0	108.4	L9 L17 L19 I40 I67	L9-V70 HydrophobicContact CD2-CG1 4.21Å; L17-V70 HydrophobicContact CD1-CG1 3.8Å; L17-V70 HydrophobicContact CD2-CG1 4.13Å; L17-V70 HydrophobicContact CG-CG1 4.42Å; L19-V70 HydrophobicContact CD2-CB 4.35Å; L19-V70 HydrophobicContact CD2-CG1 3.96Å; L19-V70 HydrophobicContact CD2-CG2 3.95Å; I40-V70 HydrophobicContact CD1-CG2 4.16Å; I67-V70 HydrophobicContact CG2-CG2 3.61Å
71	E	95	Very high	92.1	Very high	62 Å²	62	83.7 Å²	83.7	29%	0.29	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.1	130.3	179	-67	172.3	-169	0	0	109.7	L17 R18 K20 I69	L17-E71 CarbonylContact C-O 3.56Å; L17-E71 WeakPolarHBondContact CA-O 3.32Å; R18-E71 HydrophobicContact CB-CB 4.18Å; R18-E71 VanDerWaalsContact CD-OE2 3.3Å; R18-E71 WeakPolarHBondContact CD-OE2 2.94Å; R18-E71 PolarHBondContact N-O 2.61Å; R18-E71 PolarHBondContact O-N 2.9Å; K20-E71 WeakPolarHBondContact CE-OE1 3.4Å; K20-E71 IonicContact NZ-OE1 2.65Å; K20-E71 PolarHBondContact NZ-OE1 2.92Å; K20-E71 IonicContact NZ-OE2 2.61Å; I69-E71 HydrophobicContact CG2-CG 3.8Å
72	G	93.9	Very high	91.8	Very high	38 Å²	38	81.7 Å²	81.7	39%	0.392	41%	0.411	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.4	124.7	169.3	0	0	0	0	0	110.1
73	V	91.7	Very high	91.3	Very high	75 Å²	75	86.6 Å²	86.6	46%	0.455	43%	0.434	S	S	.	.			trans	-83.1	-39.5	176.8	-179.7	0	0	0	0	110.3	R16 R18 V28	R16-V73 HydrophobicContact CB-CB 4.13Å; R16-V73 HydrophobicContact CG-CB 4.04Å; R16-V73 HydrophobicContact CG-CG1 4.48Å; R16-V73 HydrophobicContact CG-CG2 4.07Å; R16-V73 PolarHBondContact O-N 2.82Å; R18-V73 HydrophobicContact CB-CG2 3.93Å; V28-V73 HydrophobicContact CG1-CG2 4.44Å
74	D	82.8	Confident	90.9	Very high	75 Å²	75	79.9 Å²	79.9	40%	0.401	42%	0.417	S	S	.	.	S	Bend	trans	-84.6	149.2	177.9	-57.7	-41	0	0	0	111	K15 R16 I76	K15-D74 HydrophobicContact CD-CB 4.49Å; R16-D74 WeakPolarHBondContact CB-OD2 3.45Å; R16-D74 PolarHBondContact N-OD2 3.4Å; D74-I76 PolarHBondContact O-N 3.19Å
75	R	73.6	Confident	90.5	Very high	239 Å²	239	86.3 Å²	86.3	90%	0.902	45%	0.45	S	S	*	.			trans	-65.3	132.9	167.4	-68.6	-176.1	178.9	-169.8	-0.3	109.1
76	I	69.7	Low	89.9	Confident	138 Å²	138	82.5 Å²	82.5	71%	0.708	43%	0.428	S	S	*	.			trans	-82.4	0	172.4	-52	174.1	0	0	0	108.7	K11 Y12 D74	K11-I76 HydrophobicContact CD-CD1 4.2Å; K11-I76 HydrophobicContact CG-CD1 4.34Å; Y12-I76 HydrophobicContact CD1-CD1 3.9Å; Y12-I76 HydrophobicContact CD1-CG1 4.38Å; Y12-I76 HydrophobicContact CE1-CD1 3.23Å; Y12-I76 HydrophobicContact CE1-CG1 4.03Å; Y12-I76 HydrophobicContact CE2-CD1 4.33Å; Y12-I76 VanDerWaalsContact CZ-CD1 3.47Å; D74-I76 PolarHBondContact O-N 3.19Å

Retrieved 76 of 76 residues in 35.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).