G4VI94_SCHMA Loading...

Ribosome-binding factor A

AlphaFold DB , UniProt , Accession G4VI94, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 64 aa.

						>G4VI94_SCHMA|G4VI94
MKRKINPEHLESTLLARKLSIIGDEFDKELMNIKIFNMESCSQNRLIGELPGVLINQSYEQGII
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.8	Very low	70.8	Confident	240 Å²	240	150.1 Å²	150.1	100%	1.182	70%	0.702	S	S	*	*				0	114.3	0	-68.7	176.7	136.6	0	0	108.8	R3	M1-R3 PolarHBondContact O-N 3.5Å
2	K	66.2	Low	71.4	Confident	213 Å²	213	143.8 Å²	143.8	93%	0.926	69%	0.687	S	S	*	*			trans	-75.1	107.3	171.4	-70.4	-170	178.3	-176.5	0	107.6	K4	K2-K4 PolarHBondContact O-N 3.25Å; K2-K4 VanDerWaalsContact O-N 3.11Å
3	R	64.7	Low	72.7	Confident	237 Å²	237	137.2 Å²	137.2	89%	0.894	66%	0.662	S	S	*	*			trans	-65.3	110.1	167.2	-75.4	-176.4	173.4	162.1	-1.8	106.7	M1 I5	M1-R3 PolarHBondContact O-N 3.5Å; R3-I5 PolarHBondContact O-N 3.27Å; R3-I5 VanDerWaalsContact O-N 3.07Å
4	K	67.7	Low	74	Confident	205 Å²	205	133.1 Å²	133.1	89%	0.891	64%	0.644	S	S	*	*			trans	-67.6	103.3	166.4	-75	-174.5	175.9	-176.9	0	105.9	K2 N6	K2-K4 PolarHBondContact O-N 3.25Å; K2-K4 VanDerWaalsContact O-N 3.11Å; K4-N6 PolarHBondContact O-N 3.06Å
5	I	67.4	Low	75.3	Confident	116 Å²	116	131.2 Å²	131.2	60%	0.595	64%	0.638	S	S	*	*			trans	-62.7	128.4	166.4	-61.4	170	0	0	0	105.4	R3 H9 L10	R3-I5 PolarHBondContact O-N 3.27Å; R3-I5 VanDerWaalsContact O-N 3.07Å; I5-H9 HydrophobicContact CG2-CB 4.28Å; I5-L10 HydrophobicContact CG2-CB 4.37Å
6	N	74.3	Confident	76.4	Confident	68 Å²	68	126.6 Å²	126.6	36%	0.364	63%	0.628	S	S	.	*			trans	-55.4	126.6	176.6	-172.3	-0.8	0	0	0	108	K4 E8 H9 L10	K4-N6 PolarHBondContact O-N 3.06Å; N6-E8 PolarHBondContact ND2-OE2 3.11Å; N6-E8 PolarHBondContact O-N 3.24Å; N6-E8 VanDerWaalsContact O-N 3.13Å; N6-H9 HydrophobicContact CB-CB 4.37Å; N6-H9 WeakPolarHBondContact O-CA 3.29Å; N6-H9 WeakPolarHBondContact O-CB 3.17Å; N6-H9 PolarHBondContact O-N 3.12Å; N6-L10 PolarHBondContact O-N 2.86Å
7	P	75.7	Confident	77.4	Confident	85 Å²	85	128.2 Å²	128.2	55%	0.552	63%	0.625	S	S	*	*	H	α-helix	trans	-50.2	-36.6	179.1	16.4	-32.1	0	0	0	113.2	H9 L10 E11	P7-H9 VanDerWaalsContact C-N 3.33Å; P7-H9 PolarHBondContact O-N 3.09Å; P7-L10 WeakPolarHBondContact O-CB 3.15Å; P7-L10 PolarHBondContact O-N 3.24Å; P7-L10 VanDerWaalsContact O-N 3.08Å; P7-E11 PolarHBondContact O-N 3.37Å
8	E	77.4	Confident	78.4	Confident	140 Å²	140	128.9 Å²	128.9	65%	0.654	62%	0.624	S	S	*	*	H	α-helix	trans	-60.6	-39.5	175.6	-62.7	175.1	168.3	0	0	112.7	N6 S12	N6-E8 PolarHBondContact ND2-OE2 3.11Å; N6-E8 PolarHBondContact O-N 3.24Å; N6-E8 VanDerWaalsContact O-N 3.13Å; E8-S12 PolarHBondContact O-N 2.73Å; E8-S12 VanDerWaalsContact O-N 3.16Å
9	H	76.1	Confident	79.4	Confident	120 Å²	120	127.7 Å²	127.7	56%	0.556	62%	0.621	S	S	*	*	H	α-helix	trans	-72.2	-31.9	174.5	-68.8	-49.3	0	0	0	112.1	I5 N6 P7 T13	I5-H9 HydrophobicContact CG2-CB 4.28Å; N6-H9 HydrophobicContact CB-CB 4.37Å; N6-H9 WeakPolarHBondContact O-CA 3.29Å; N6-H9 WeakPolarHBondContact O-CB 3.17Å; N6-H9 PolarHBondContact O-N 3.12Å; P7-H9 VanDerWaalsContact C-N 3.33Å; P7-H9 PolarHBondContact O-N 3.09Å; H9-T13 WeakPolarHBondContact O-CB 3.38Å; H9-T13 PolarHBondContact O-N 2.78Å; H9-T13 PolarHBondContact O-OG1 3.07Å
10	L	79	Confident	80.2	Confident	85 Å²	85	124.7 Å²	124.7	45%	0.445	61%	0.613	S	S	.	*	H	α-helix	trans	-65	-46.2	175.9	-176.2	67.3	0	0	0	110.7	I5 N6 P7 T13 L14	I5-L10 HydrophobicContact CG2-CB 4.37Å; N6-L10 PolarHBondContact O-N 2.86Å; P7-L10 WeakPolarHBondContact O-CB 3.15Å; P7-L10 PolarHBondContact O-N 3.24Å; P7-L10 VanDerWaalsContact O-N 3.08Å; L10-T13 PolarHBondContact O-N 2.94Å; L10-L14 HydrophobicContact CG-CD1 4.25Å; L10-L14 WeakPolarHBondContact O-CG 3.41Å; L10-L14 PolarHBondContact O-N 3.2Å
11	E	80.5	Confident	81	Confident	142 Å²	142	123.1 Å²	123.1	66%	0.664	61%	0.606	S	S	*	*	H	α-helix	trans	-63.1	-45	177.8	-71.8	-174.4	178.9	0	0	112.2	P7 T13 L14 L15	P7-E11 PolarHBondContact O-N 3.37Å; E11-T13 VanDerWaalsContact C-N 3.3Å; E11-T13 PolarHBondContact O-N 3.07Å; E11-L14 PolarHBondContact O-N 3.35Å; E11-L15 WeakPolarHBondContact O-CB 3.39Å; E11-L15 PolarHBondContact O-N 3.37Å
12	S	78.5	Confident	83.2	Confident	75 Å²	75	116.5 Å²	116.5	52%	0.524	58%	0.575	S	S	.	*	H	α-helix	trans	-59.9	-40.8	174.1	172.7	0	0	0	0	111.9	E8 L15 A16	E8-S12 PolarHBondContact O-N 2.73Å; E8-S12 VanDerWaalsContact O-N 3.16Å; S12-L15 PolarHBondContact O-N 3.36Å; S12-A16 WeakPolarHBondContact O-CB 3.48Å; S12-A16 PolarHBondContact O-N 2.86Å
13	T	87.9	Confident	84.7	Confident	58 Å²	58	107.8 Å²	107.8	36%	0.356	55%	0.545	S	S	.	.	H	α-helix	trans	-65.2	-41.1	177	-57.6	0	0	0	0	111.7	H9 L10 E11 R17	H9-T13 WeakPolarHBondContact O-CB 3.38Å; H9-T13 PolarHBondContact O-N 2.78Å; H9-T13 PolarHBondContact O-OG1 3.07Å; L10-T13 PolarHBondContact O-N 2.94Å; E11-T13 VanDerWaalsContact C-N 3.3Å; E11-T13 PolarHBondContact O-N 3.07Å; T13-R17 VanDerWaalsContact O-CG 3.3Å; T13-R17 WeakPolarHBondContact O-CG 3.49Å; T13-R17 PolarHBondContact O-N 2.84Å
14	L	91.1	Very high	86.2	Confident	80 Å²	80	101.5 Å²	101.5	42%	0.419	53%	0.529	S	S	.	.	H	α-helix	trans	-67.5	-42.6	177.9	-72.2	174	0	0	0	111.6	L10 E11 R17 K18	L10-L14 HydrophobicContact CG-CD1 4.25Å; L10-L14 WeakPolarHBondContact O-CG 3.41Å; L10-L14 PolarHBondContact O-N 3.2Å; E11-L14 PolarHBondContact O-N 3.35Å; L14-R17 PolarHBondContact O-N 3.48Å; L14-K18 WeakPolarHBondContact O-CG 3.35Å; L14-K18 PolarHBondContact O-N 2.97Å
15	L	93	Very high	87.6	Confident	104 Å²	104	97.9 Å²	97.9	55%	0.545	52%	0.515	S	S	.	.	H	α-helix	trans	-62.5	-47.3	176	179.2	61	0	0	0	111.2	E11 S12 R17 K18 L19	E11-L15 WeakPolarHBondContact O-CB 3.39Å; E11-L15 PolarHBondContact O-N 3.37Å; S12-L15 PolarHBondContact O-N 3.36Å; L15-R17 VanDerWaalsContact C-N 3.29Å; L15-R17 PolarHBondContact O-N 2.86Å; L15-K18 PolarHBondContact O-N 3.38Å; L15-K18 VanDerWaalsContact O-N 3.14Å; L15-L19 HydrophobicContact CD1-CD1 4.33Å; L15-L19 HydrophobicContact CD1-CG 4.33Å; L15-L19 HydrophobicContact CG-CD1 4.19Å; L15-L19 WeakPolarHBondContact O-CG 3.41Å; L15-L19 PolarHBondContact O-N 3.24Å
16	A	92.6	Very high	89.1	Confident	58 Å²	58	98.4 Å²	98.4	48%	0.479	51%	0.514	S	S	.	.	H	α-helix	trans	-57.9	-41.7	177	0	0	0	0	0	111.9	S12 L19 S20	S12-A16 WeakPolarHBondContact O-CB 3.48Å; S12-A16 PolarHBondContact O-N 2.86Å; A16-L19 PolarHBondContact O-N 3.46Å; A16-S20 PolarHBondContact O-N 3.43Å
17	R	93.7	Very high	90.2	Very high	154 Å²	154	100 Å²	100	58%	0.581	52%	0.522	S	S	*	.	H	α-helix	trans	-63.2	-44	174.8	-75.4	175.2	-177.3	166.3	2.1	112.7	T13 L14 L15 L19 S20 I21	T13-R17 VanDerWaalsContact O-CG 3.3Å; T13-R17 WeakPolarHBondContact O-CG 3.49Å; T13-R17 PolarHBondContact O-N 2.84Å; L14-R17 PolarHBondContact O-N 3.48Å; L15-R17 VanDerWaalsContact C-N 3.29Å; L15-R17 PolarHBondContact O-N 2.86Å; R17-L19 VanDerWaalsContact C-N 3.35Å; R17-S20 WeakPolarHBondContact O-CB 3.43Å; R17-S20 PolarHBondContact O-N 2.83Å; R17-I21 WeakPolarHBondContact O-CG1 3.2Å; R17-I21 PolarHBondContact O-N 3.13Å; R17-I21 VanDerWaalsContact O-N 3.07Å
18	K	96	Very high	91.2	Very high	141 Å²	141	102.9 Å²	102.9	61%	0.613	53%	0.526	S	S	*	.	H	α-helix	trans	-61.7	-43.8	177.4	-73.9	179.6	178.3	-174.8	0	111.5	L14 L15 S20 I21 I22	L14-K18 WeakPolarHBondContact O-CG 3.35Å; L14-K18 PolarHBondContact O-N 2.97Å; L15-K18 PolarHBondContact O-N 3.38Å; L15-K18 VanDerWaalsContact O-N 3.14Å; K18-S20 VanDerWaalsContact C-N 3.34Å; K18-I21 PolarHBondContact O-N 3.47Å; K18-I22 WeakPolarHBondContact O-CG1 3.38Å; K18-I22 PolarHBondContact O-N 2.76Å; K18-I22 VanDerWaalsContact O-N 3.09Å
19	L	96.3	Very high	92.1	Very high	106 Å²	106	101.3 Å²	101.3	56%	0.555	52%	0.519	S	S	*	.	H	α-helix	trans	-64.6	-38	176.8	-69.3	173.4	0	0	0	112.3	L15 A16 R17 I22 G23	L15-L19 HydrophobicContact CD1-CD1 4.33Å; L15-L19 HydrophobicContact CD1-CG 4.33Å; L15-L19 HydrophobicContact CG-CD1 4.19Å; L15-L19 WeakPolarHBondContact O-CG 3.41Å; L15-L19 PolarHBondContact O-N 3.24Å; A16-L19 PolarHBondContact O-N 3.46Å; R17-L19 VanDerWaalsContact C-N 3.35Å; L19-I22 PolarHBondContact O-N 2.83Å; L19-G23 PolarHBondContact O-N 2.91Å
20	S	96.8	Very high	93.1	Very high	66 Å²	66	99.6 Å²	99.6	46%	0.462	51%	0.513	S	S	.	.	H	α-helix	trans	-60.3	-46.3	174.4	-169	0	0	0	0	111.8	A16 R17 K18 I22 G23 D24	A16-S20 PolarHBondContact O-N 3.43Å; R17-S20 WeakPolarHBondContact O-CB 3.43Å; R17-S20 PolarHBondContact O-N 2.83Å; K18-S20 VanDerWaalsContact C-N 3.34Å; S20-I22 VanDerWaalsContact C-N 3.33Å; S20-I22 PolarHBondContact O-N 2.98Å; S20-G23 PolarHBondContact O-N 3.32Å; S20-D24 VanDerWaalsContact O-CG 3.3Å; S20-D24 PolarHBondContact O-N 3.3Å
21	I	96.4	Very high	93.9	Very high	93 Å²	93	100.4 Å²	100.4	48%	0.477	52%	0.516	S	S	.	.	H	α-helix	trans	-61.2	-44.3	178.5	-66.4	164.7	0	0	0	110.7	R17 K18 G23 D24 E25	R17-I21 WeakPolarHBondContact O-CG1 3.2Å; R17-I21 PolarHBondContact O-N 3.13Å; R17-I21 VanDerWaalsContact O-N 3.07Å; K18-I21 PolarHBondContact O-N 3.47Å; I21-G23 VanDerWaalsContact C-N 3.31Å; I21-G23 PolarHBondContact O-N 3.37Å; I21-D24 PolarHBondContact O-N 3.01Å; I21-E25 WeakPolarHBondContact O-CG 3.49Å; I21-E25 PolarHBondContact O-N 3.24Å
22	I	96.3	Very high	94.5	Very high	101 Å²	101	97 Å²	97	52%	0.518	50%	0.502	S	S	.	.	H	α-helix	trans	-62.4	-40.5	177.2	-67	165.9	0	0	0	111	K18 L19 S20 E25 F26	K18-I22 WeakPolarHBondContact O-CG1 3.38Å; K18-I22 PolarHBondContact O-N 2.76Å; K18-I22 VanDerWaalsContact O-N 3.09Å; L19-I22 PolarHBondContact O-N 2.83Å; S20-I22 VanDerWaalsContact C-N 3.33Å; S20-I22 PolarHBondContact O-N 2.98Å; I22-E25 PolarHBondContact O-N 3.05Å; I22-F26 WeakPolarHBondContact O-CB 3.49Å; I22-F26 PolarHBondContact O-N 3.43Å
23	G	96.8	Very high	95.1	Very high	29 Å²	29	97.2 Å²	97.2	30%	0.299	50%	0.497	S	S	.	.	H	α-helix	trans	-60.2	-48.6	174.9	0	0	0	0	0	112.2	L19 S20 I21 E25 F26 D27	L19-G23 PolarHBondContact O-N 2.91Å; S20-G23 PolarHBondContact O-N 3.32Å; I21-G23 VanDerWaalsContact C-N 3.31Å; I21-G23 PolarHBondContact O-N 3.37Å; G23-E25 PolarHBondContact O-N 2.83Å; G23-F26 PolarHBondContact O-N 3.47Å; G23-D27 WeakPolarHBondContact O-CB 3.31Å; G23-D27 PolarHBondContact O-N 2.88Å
24	D	97.1	Very high	95.4	Very high	105 Å²	105	100.3 Å²	100.3	56%	0.561	51%	0.505	S	S	*	.	H	α-helix	trans	-62.3	-40.9	179.2	-65.1	-22.7	0	0	0	112.1	S20 I21 K28	S20-D24 VanDerWaalsContact O-CG 3.3Å; S20-D24 PolarHBondContact O-N 3.3Å; I21-D24 PolarHBondContact O-N 3.01Å; D24-K28 WeakPolarHBondContact O-CB 3.37Å; D24-K28 PolarHBondContact O-N 3.44Å
25	E	97.7	Very high	95.4	Very high	130 Å²	130	100.1 Å²	100.1	61%	0.607	50%	0.504	S	S	*	.	H	α-helix	trans	-65.7	-41.9	176.4	-75.1	179.5	-176.3	0	0	112	I21 I22 G23 K28 E29	I21-E25 WeakPolarHBondContact O-CG 3.49Å; I21-E25 PolarHBondContact O-N 3.24Å; I22-E25 PolarHBondContact O-N 3.05Å; G23-E25 PolarHBondContact O-N 2.83Å; E25-K28 PolarHBondContact O-N 2.98Å; E25-E29 PolarHBondContact O-N 3.23Å; E25-E29 VanDerWaalsContact O-N 3.07Å
26	F	97.5	Very high	95	Very high	127 Å²	127	101.3 Å²	101.3	56%	0.557	51%	0.505	S	S	*	.	H	α-helix	trans	-64.7	-45.7	176.8	-179.6	-104	0	0	0	112	I22 G23 K28 E29 L30	I22-F26 WeakPolarHBondContact O-CB 3.49Å; I22-F26 PolarHBondContact O-N 3.43Å; G23-F26 PolarHBondContact O-N 3.47Å; F26-K28 VanDerWaalsContact C-N 3.29Å; F26-K28 PolarHBondContact O-N 2.91Å; F26-E29 PolarHBondContact O-N 3.44Å; F26-L30 HydrophobicContact CD1-CD1 3.88Å; F26-L30 HydrophobicContact CD1-CG 4.33Å; F26-L30 HydrophobicContact CE1-CD1 3.33Å; F26-L30 HydrophobicContact CE1-CG 3.98Å; F26-L30 HydrophobicContact CE2-CG 4.42Å; F26-L30 HydrophobicContact CZ-CD1 3.74Å; F26-L30 HydrophobicContact CZ-CD2 4.15Å; F26-L30 HydrophobicContact CZ-CG 4.02Å; F26-L30 WeakPolarHBondContact O-CG 3.42Å; F26-L30 PolarHBondContact O-N 3.18Å
27	D	97.1	Very high	94.5	Very high	102 Å²	102	102.6 Å²	102.6	55%	0.545	50%	0.503	S	S	.	.	H	α-helix	trans	-61.8	-38.9	178	-78.4	-14	0	0	0	111.7	G23 M31	G23-D27 WeakPolarHBondContact O-CB 3.31Å; G23-D27 PolarHBondContact O-N 2.88Å; D27-M31 PolarHBondContact O-N 2.94Å
28	K	97.4	Very high	94	Very high	145 Å²	145	100.8 Å²	100.8	63%	0.63	50%	0.503	S	S	*	.	H	α-helix	trans	-62.9	-44.8	174.6	-175.1	-178.6	177.7	-174.7	0	111.7	D24 E25 F26 M31 N32	D24-K28 WeakPolarHBondContact O-CB 3.37Å; D24-K28 PolarHBondContact O-N 3.44Å; E25-K28 PolarHBondContact O-N 2.98Å; F26-K28 VanDerWaalsContact C-N 3.29Å; F26-K28 PolarHBondContact O-N 2.91Å; K28-M31 WeakPolarHBondContact O-CB 3.49Å; K28-M31 PolarHBondContact O-N 3.12Å; K28-N32 VanDerWaalsContact O-CG 3.25Å; K28-N32 PolarHBondContact O-N 3.18Å; K28-N32 PolarHBondContact O-ND2 3.48Å; K28-N32 PolarHBondContact O-OD1 3.38Å
29	E	96.7	Very high	93.4	Very high	107 Å²	107	99.3 Å²	99.3	50%	0.5	50%	0.498	S	S	.	.	H	α-helix	trans	-66.9	-39.8	-179.9	-171.6	58.3	-163.6	0	0	112.1	E25 F26 M31 N32 I33	E25-E29 PolarHBondContact O-N 3.23Å; E25-E29 VanDerWaalsContact O-N 3.07Å; F26-E29 PolarHBondContact O-N 3.44Å; E29-M31 VanDerWaalsContact C-N 3.28Å; E29-M31 PolarHBondContact O-N 2.91Å; E29-N32 WeakPolarHBondContact O-CB 3.47Å; E29-N32 PolarHBondContact O-N 3.03Å; E29-N32 PolarHBondContact OE2-ND2 2.95Å; E29-N32 VanDerWaalsContact OE2-ND2 3.12Å; E29-I33 HydrophobicContact CG-CD1 4.38Å; E29-I33 WeakPolarHBondContact O-CG1 3.33Å; E29-I33 PolarHBondContact O-N 3.39Å
30	L	95.8	Very high	92.3	Very high	83 Å²	83	95.4 Å²	95.4	44%	0.435	48%	0.48	S	S	.	.	H	α-helix	trans	-59.5	-40.5	171.9	-72.8	-176.9	0	0	0	112.1	F26 I33 K34	F26-L30 HydrophobicContact CD1-CD1 3.88Å; F26-L30 HydrophobicContact CD1-CG 4.33Å; F26-L30 HydrophobicContact CE1-CD1 3.33Å; F26-L30 HydrophobicContact CE1-CG 3.98Å; F26-L30 HydrophobicContact CE2-CG 4.42Å; F26-L30 HydrophobicContact CZ-CD1 3.74Å; F26-L30 HydrophobicContact CZ-CD2 4.15Å; F26-L30 HydrophobicContact CZ-CG 4.02Å; F26-L30 WeakPolarHBondContact O-CG 3.42Å; F26-L30 PolarHBondContact O-N 3.18Å; L30-I33 PolarHBondContact O-N 3.44Å; L30-K34 WeakPolarHBondContact O-CB 3.48Å; L30-K34 PolarHBondContact O-N 3.07Å
31	M	95.8	Very high	90.9	Very high	102 Å²	102	96.3 Å²	96.3	50%	0.502	49%	0.485	S	S	.	.	H	α-helix	trans	-65.5	-40.9	175.8	-167.7	62.3	68.8	0	0	111.7	D27 K28 E29 I33 K34 I35	D27-M31 PolarHBondContact O-N 2.94Å; K28-M31 WeakPolarHBondContact O-CB 3.49Å; K28-M31 PolarHBondContact O-N 3.12Å; E29-M31 VanDerWaalsContact C-N 3.28Å; E29-M31 PolarHBondContact O-N 2.91Å; M31-I33 PolarHBondContact O-N 3.27Å; M31-K34 PolarHBondContact O-N 3.47Å; M31-K34 HydrophobicContact SD-CD 4.36Å; M31-I35 HydrophobicContact CG-CD1 3.99Å; M31-I35 HydrophobicContact CG-CG1 4.49Å; M31-I35 VanDerWaalsContact O-CG1 3.31Å; M31-I35 WeakPolarHBondContact O-CG1 3.46Å; M31-I35 PolarHBondContact O-N 3.45Å
32	N	94.3	Very high	89.5	Confident	72 Å²	72	95.4 Å²	95.4	39%	0.385	49%	0.487	S	S	.	.	H	α-helix	trans	-58.9	-46.8	175.4	-65.8	-24.8	0	0	0	111.3	K28 E29 K34 I35 F36	K28-N32 VanDerWaalsContact O-CG 3.25Å; K28-N32 PolarHBondContact O-N 3.18Å; K28-N32 PolarHBondContact O-ND2 3.48Å; K28-N32 PolarHBondContact O-OD1 3.38Å; E29-N32 WeakPolarHBondContact O-CB 3.47Å; E29-N32 PolarHBondContact O-N 3.03Å; E29-N32 PolarHBondContact OE2-ND2 2.95Å; E29-N32 VanDerWaalsContact OE2-ND2 3.12Å; N32-K34 VanDerWaalsContact C-N 3.32Å; N32-K34 PolarHBondContact O-N 3.43Å; N32-I35 PolarHBondContact O-N 2.98Å; N32-F36 WeakPolarHBondContact O-CB 3.34Å; N32-F36 PolarHBondContact O-N 3.31Å
33	I	91.7	Very high	87.8	Confident	78 Å²	78	96.2 Å²	96.2	40%	0.4	49%	0.489	S	S	.	.	H	α-helix	trans	-61	-43.2	177.6	-67	165	0	0	0	110.6	E29 L30 M31 F36 N37	E29-I33 HydrophobicContact CG-CD1 4.38Å; E29-I33 WeakPolarHBondContact O-CG1 3.33Å; E29-I33 PolarHBondContact O-N 3.39Å; L30-I33 PolarHBondContact O-N 3.44Å; M31-I33 PolarHBondContact O-N 3.27Å; I33-F36 PolarHBondContact O-N 2.94Å; I33-N37 WeakPolarHBondContact O-CB 3.46Å; I33-N37 PolarHBondContact O-N 3.19Å; I33-N37 PolarHBondContact O-ND2 3.09Å
34	K	92.6	Very high	85.8	Confident	123 Å²	123	99.8 Å²	99.8	54%	0.535	50%	0.501	S	S	.	.	H	α-helix	trans	-62.6	-45.7	178	-175.1	-178.6	179	-178.3	0	112	L30 M31 N32 N37 M38	L30-K34 WeakPolarHBondContact O-CB 3.48Å; L30-K34 PolarHBondContact O-N 3.07Å; M31-K34 PolarHBondContact O-N 3.47Å; M31-K34 HydrophobicContact SD-CD 4.36Å; N32-K34 VanDerWaalsContact C-N 3.32Å; N32-K34 PolarHBondContact O-N 3.43Å; K34-N37 PolarHBondContact O-N 3.07Å; K34-M38 WeakPolarHBondContact O-CG 3.42Å; K34-M38 PolarHBondContact O-N 3.45Å
35	I	91	Very high	83.6	Confident	76 Å²	76	105 Å²	105	39%	0.39	51%	0.513	S	S	.	.	H	α-helix	trans	-61.8	-49.5	177.3	-69.1	166.9	0	0	0	109.7	M31 N32 N37 M38 E39	M31-I35 HydrophobicContact CG-CD1 3.99Å; M31-I35 HydrophobicContact CG-CG1 4.49Å; M31-I35 VanDerWaalsContact O-CG1 3.31Å; M31-I35 WeakPolarHBondContact O-CG1 3.46Å; M31-I35 PolarHBondContact O-N 3.45Å; N32-I35 PolarHBondContact O-N 2.98Å; I35-N37 VanDerWaalsContact C-N 3.28Å; I35-N37 PolarHBondContact O-N 3.48Å; I35-M38 PolarHBondContact O-N 3.35Å; I35-E39 HydrophobicContact CG2-CG 4.2Å; I35-E39 WeakPolarHBondContact CG2-OE1 3.3Å; I35-E39 WeakPolarHBondContact O-CG 3.41Å; I35-E39 PolarHBondContact O-N 2.98Å
36	F	86.1	Confident	81.5	Confident	129 Å²	129	105.9 Å²	105.9	57%	0.566	52%	0.521	S	S	*	.	H	α-helix	trans	-55.9	-43.2	177.3	178.3	-97.3	0	0	0	112.1	N32 I33 E39 S40	N32-F36 WeakPolarHBondContact O-CB 3.34Å; N32-F36 PolarHBondContact O-N 3.31Å; I33-F36 PolarHBondContact O-N 2.94Å; F36-E39 PolarHBondContact O-N 2.92Å; F36-S40 WeakPolarHBondContact O-CB 3.44Å; F36-S40 PolarHBondContact O-N 2.92Å; F36-S40 PolarHBondContact O-OG 3.45Å
37	N	81.4	Confident	79.1	Confident	85 Å²	85	105.7 Å²	105.7	46%	0.455	53%	0.525	S	S	.	.	H	α-helix	trans	-64.8	-41.1	176.4	-73.4	-18.7	0	0	0	112.1	I33 K34 I35 C41	I33-N37 WeakPolarHBondContact O-CB 3.46Å; I33-N37 PolarHBondContact O-N 3.19Å; I33-N37 PolarHBondContact O-ND2 3.09Å; K34-N37 PolarHBondContact O-N 3.07Å; I35-N37 VanDerWaalsContact C-N 3.28Å; I35-N37 PolarHBondContact O-N 3.48Å; N37-C41 WeakPolarHBondContact O-CB 3.45Å; N37-C41 PolarHBondContact O-N 3.37Å; N37-C41 PolarHBondContact O-SG 2.96Å
38	M	82.3	Confident	76.7	Confident	117 Å²	117	103 Å²	103	58%	0.576	52%	0.521	S	S	*	.	H	α-helix	trans	-67.4	-40.9	177	-74.7	-176.9	55.7	0	0	112.8	K34 I35 C41 S42	K34-M38 WeakPolarHBondContact O-CG 3.42Å; K34-M38 PolarHBondContact O-N 3.45Å; I35-M38 PolarHBondContact O-N 3.35Å; M38-C41 PolarHBondContact O-N 3.35Å; M38-S42 WeakPolarHBondContact O-CB 3.37Å; M38-S42 PolarHBondContact O-N 3.43Å; M38-S42 PolarHBondContact O-OG 3.07Å
39	E	83.9	Confident	74.3	Confident	109 Å²	109	105.1 Å²	105.1	51%	0.509	53%	0.533	S	S	.	.	H	α-helix	trans	-65.4	-44.7	175	-72.2	179.5	173	0	0	110.7	I35 F36 C41 S42 Q43	I35-E39 HydrophobicContact CG2-CG 4.2Å; I35-E39 WeakPolarHBondContact CG2-OE1 3.3Å; I35-E39 WeakPolarHBondContact O-CG 3.41Å; I35-E39 PolarHBondContact O-N 2.98Å; F36-E39 PolarHBondContact O-N 2.92Å; E39-C41 PolarHBondContact O-N 3.3Å; E39-S42 PolarHBondContact O-N 3Å; E39-S42 VanDerWaalsContact O-N 3.13Å; E39-Q43 WeakPolarHBondContact O-CG 3.33Å; E39-Q43 PolarHBondContact O-N 2.95Å
40	S	73.2	Confident	71.7	Confident	25 Å²	25	106.9 Å²	106.9	18%	0.175	55%	0.545	C	S	.	.	H	α-helix	trans	-61.9	-41.4	175.3	-61.8	0	0	0	0	111.8	F36 S42 Q43 N44	F36-S40 WeakPolarHBondContact O-CB 3.44Å; F36-S40 PolarHBondContact O-N 2.92Å; F36-S40 PolarHBondContact O-OG 3.45Å; S40-S42 VanDerWaalsContact C-N 3.33Å; S40-S42 PolarHBondContact O-N 3.07Å; S40-Q43 PolarHBondContact O-N 3.14Å; S40-N44 WeakPolarHBondContact O-CB 3.32Å; S40-N44 PolarHBondContact O-N 3.37Å; S40-N44 PolarHBondContact O-ND2 2.88Å
41	C	68.4	Low	69.3	Low	84 Å²	84	108.9 Å²	108.9	57%	0.568	56%	0.563	S	S	*	*	H	α-helix	trans	-62.6	-39.6	173.1	-77.4	0	0	0	0	112	N37 M38 E39 R45	N37-C41 WeakPolarHBondContact O-CB 3.45Å; N37-C41 PolarHBondContact O-N 3.37Å; N37-C41 PolarHBondContact O-SG 2.96Å; M38-C41 PolarHBondContact O-N 3.35Å; E39-C41 PolarHBondContact O-N 3.3Å; C41-R45 VanDerWaalsContact O-CB 3.29Å; C41-R45 WeakPolarHBondContact O-CB 3.47Å; C41-R45 PolarHBondContact O-N 3.16Å
42	S	65.9	Low	66.9	Low	74 Å²	74	107.3 Å²	107.3	52%	0.517	57%	0.573	S	S	.	*	H	α-helix	trans	-69.2	-40.1	178.2	-56.9	0	0	0	0	111.8	M38 E39 S40 R45 L46	M38-S42 WeakPolarHBondContact O-CB 3.37Å; M38-S42 PolarHBondContact O-N 3.43Å; M38-S42 PolarHBondContact O-OG 3.07Å; E39-S42 PolarHBondContact O-N 3Å; E39-S42 VanDerWaalsContact O-N 3.13Å; S40-S42 VanDerWaalsContact C-N 3.33Å; S40-S42 PolarHBondContact O-N 3.07Å; S42-R45 PolarHBondContact O-N 3.22Å; S42-L46 WeakPolarHBondContact O-CG 3.48Å; S42-L46 PolarHBondContact O-N 3.39Å
43	Q	61.5	Low	64.3	Low	118 Å²	118	110 Å²	110	55%	0.551	59%	0.592	S	S	*	*	H	α-helix	trans	-68.5	-43.1	173.9	-70.7	-179.9	-3.7	0	0	111.8	E39 S40 R45 L46 I47	E39-Q43 WeakPolarHBondContact O-CG 3.33Å; E39-Q43 PolarHBondContact O-N 2.95Å; S40-Q43 PolarHBondContact O-N 3.14Å; Q43-R45 PolarHBondContact O-N 2.9Å; Q43-L46 PolarHBondContact O-N 3.25Å; Q43-I47 WeakPolarHBondContact O-CG1 3.32Å; Q43-I47 PolarHBondContact O-N 2.95Å
44	N	54.3	Low	62.2	Low	105 Å²	105	114 Å²	114	56%	0.561	61%	0.614	S	S	*	*	H	α-helix	trans	-65.3	-27.5	174.2	-73.3	-16.7	0	0	0	112	S40 G48	S40-N44 WeakPolarHBondContact O-CB 3.32Å; S40-N44 PolarHBondContact O-N 3.37Å; S40-N44 PolarHBondContact O-ND2 2.88Å; N44-G48 WeakPolarHBondContact O-CA 3.38Å; N44-G48 PolarHBondContact O-N 3.44Å
45	R	51.9	Low	59.9	Low	213 Å²	213	115.1 Å²	115.1	80%	0.804	62%	0.624	S	S	*	*	H	α-helix	trans	-72.2	-29.8	171.8	-172.3	174	177	173.4	-0.5	112.5	C41 S42 Q43	C41-R45 VanDerWaalsContact O-CB 3.29Å; C41-R45 WeakPolarHBondContact O-CB 3.47Å; C41-R45 PolarHBondContact O-N 3.16Å; S42-R45 PolarHBondContact O-N 3.22Å; Q43-R45 PolarHBondContact O-N 2.9Å
46	L	51.6	Low	57.7	Low	150 Å²	150	117.9 Å²	117.9	79%	0.785	64%	0.639	S	S	*	*	H	α-helix	trans	-79.5	-30.4	174.1	-68.6	170.5	0	0	0	112.6	S42 Q43	S42-L46 WeakPolarHBondContact O-CG 3.48Å; S42-L46 PolarHBondContact O-N 3.39Å; Q43-L46 PolarHBondContact O-N 3.25Å
47	I	48.3	Very low	55.8	Low	123 Å²	123	120.3 Å²	120.3	63%	0.631	65%	0.652	S	S	*	*	H	α-helix	trans	-86.6	-25.6	175.7	-59.6	165.9	0	0	0	111.1	Q43 E49 L50	Q43-I47 WeakPolarHBondContact O-CG1 3.32Å; Q43-I47 PolarHBondContact O-N 2.95Å; I47-E49 VanDerWaalsContact C-N 3.28Å; I47-E49 PolarHBondContact O-N 3.39Å; I47-L50 PolarHBondContact O-N 2.69Å
48	G	45.6	Very low	54.5	Low	46 Å²	46	120.3 Å²	120.3	47%	0.474	66%	0.659	S	S	.	*	T	Hydrogen-bonded Turn	trans	-82	15.9	-173.5	0	0	0	0	0	116.2	N44 L50	N44-G48 WeakPolarHBondContact O-CA 3.38Å; N44-G48 PolarHBondContact O-N 3.44Å; G48-L50 PolarHBondContact O-N 2.98Å
49	E	48.4	Very low	52.9	Low	189 Å²	189	125.7 Å²	125.7	88%	0.883	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.7	-0.6	152	-74	-170.5	173.4	0	0	111.9	I47	I47-E49 VanDerWaalsContact C-N 3.28Å; I47-E49 PolarHBondContact O-N 3.39Å
50	L	41.5	Very low	51.1	Low	143 Å²	143	129.6 Å²	129.6	75%	0.749	69%	0.693	S	S	*	*	S	Bend	trans	-85.2	120.3	157	-134.4	81.1	0	0	0	110.1	I47 G48 G52	I47-L50 PolarHBondContact O-N 2.69Å; G48-L50 PolarHBondContact O-N 2.98Å; L50-G52 PolarHBondContact O-N 3.39Å
51	P	46.6	Very low	49.8	Very low	125 Å²	125	136.5 Å²	136.5	81%	0.812	72%	0.722	S	S	*	*			trans	-73.2	133.1	-167.1	29.3	-33.4	0	0	0	111.6
52	G	45.3	Very low	48.4	Very low	69 Å²	69	136 Å²	136	71%	0.711	73%	0.731	S	S	*	*			trans	97.1	67.8	156.2	0	0	0	0	0	116	L50	L50-G52 PolarHBondContact O-N 3.39Å
53	V	39.2	Very low	46.9	Very low	128 Å²	128	140 Å²	140	78%	0.776	75%	0.745	S	S	*	*			trans	-98	93.1	144.7	-174.3	0	0	0	0	106.7	I55	V53-I55 HydrophobicContact CG1-CG1 3.87Å; V53-I55 PolarHBondContact O-N 2.91Å
54	L	46.4	Very low	46.1	Very low	164 Å²	164	145.8 Å²	145.8	86%	0.859	78%	0.777	S	S	*	*			trans	-61	86.1	166.3	-69.9	164	0	0	0	108.1	N56	L54-N56 VanDerWaalsContact C-N 3.35Å; L54-N56 PolarHBondContact O-N 3.08Å; L54-N56 VanDerWaalsContact O-N 3.07Å
55	I	45.1	Very low	45.7	Very low	145 Å²	145	147.8 Å²	147.8	74%	0.744	79%	0.788	S	S	*	*			trans	-75.3	99.2	165.8	-57.1	-177.7	0	0	0	105.8	V53 Q57	V53-I55 HydrophobicContact CG1-CG1 3.87Å; V53-I55 PolarHBondContact O-N 2.91Å; I55-Q57 PolarHBondContact O-N 3.06Å; I55-Q57 VanDerWaalsContact O-N 3.09Å
56	N	44.8	Very low	45.4	Very low	134 Å²	134	144.4 Å²	144.4	72%	0.717	79%	0.787	S	S	*	*			trans	-22.1	104.7	170.6	-83.1	-36	0	0	0	113.6	L54 S58	L54-N56 VanDerWaalsContact C-N 3.35Å; L54-N56 PolarHBondContact O-N 3.08Å; L54-N56 VanDerWaalsContact O-N 3.07Å; N56-S58 PolarHBondContact O-N 3.4Å; N56-S58 VanDerWaalsContact O-N 3.12Å
57	Q	46.5	Very low	45	Very low	180 Å²	180	144.1 Å²	144.1	84%	0.841	79%	0.787	S	S	*	*			trans	-74.5	19.3	168.5	-69.7	-170.9	-24.8	0	0	113	I55 Y59	I55-Q57 PolarHBondContact O-N 3.06Å; I55-Q57 VanDerWaalsContact O-N 3.09Å; Q57-Y59 PolarHBondContact O-N 3.13Å; Q57-Y59 VanDerWaalsContact O-N 3.11Å
58	S	53.1	Low	44.8	Very low	85 Å²	85	145.3 Å²	145.3	59%	0.594	80%	0.797	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75.5	4.8	-174.8	41.4	0	0	0	0	115	N56	N56-S58 PolarHBondContact O-N 3.4Å; N56-S58 VanDerWaalsContact O-N 3.12Å
59	Y	49.5	Very low	44.8	Very low	230 Å²	230	151.5 Å²	151.5	90%	0.902	82%	0.817	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.5	-9.8	173.8	-101	-82.9	0	0	0	115.5	Q57	Q57-Y59 PolarHBondContact O-N 3.13Å; Q57-Y59 VanDerWaalsContact O-N 3.11Å
60	E	46.9	Very low	44.5	Very low	191 Å²	191	149 Å²	149	89%	0.893	81%	0.812	S	S	*	*	S	Bend	trans	-102.1	-1.5	177.6	-77.3	-159.8	163.5	0	0	115.2	G62	E60-G62 PolarHBondContact O-N 3.07Å
61	Q	45.9	Very low	44.8	Very low	171 Å²	171	149.4 Å²	149.4	80%	0.799	82%	0.817	S	S	*	*			trans	-95.4	62.6	166.8	-78.1	160.5	5.6	0	0	110.1	I63	Q61-I63 VanDerWaalsContact C-N 3.32Å; Q61-I63 PolarHBondContact O-N 3.11Å
62	G	37.6	Very low	44.6	Very low	73 Å²	73	151.3 Å²	151.3	75%	0.753	82%	0.817	S	S	*	*			trans	-63.6	97.9	154.6	0	0	0	0	0	108.6	E60 I64	E60-G62 PolarHBondContact O-N 3.07Å; G62-I64 PolarHBondContact O-N 3.24Å
63	I	34.5	Very low	44.6	Very low	159 Å²	159	158.2 Å²	158.2	82%	0.815	83%	0.826	S	S	*	*			trans	-48.7	111.5	174.8	-61.1	161.2	0	0	0	111	Q61	Q61-I63 VanDerWaalsContact C-N 3.32Å; Q61-I63 PolarHBondContact O-N 3.11Å
64	I	45.1	Very low	45.1	Very low	238 Å²	238	160.9 Å²	160.9	100%	1.221	83%	0.831	S	S	*	*			trans	-140.9	0	133.8	-56.6	-174.8	0	0	0	107.3	G62	G62-I64 PolarHBondContact O-N 3.24Å

Retrieved 64 of 64 residues in 21.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).