G4VIA8_SCHMA Loading...

Transmembrane protein

AlphaFold DB , UniProt , Accession G4VIA8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 103 aa.

						>G4VIA8_SCHMA|G4VIA8
MCEIELYRKTKIDIPLLAAGMILCILSCLMISVGIARVREDVWIAGILVAIVGLPLFLFSLIVFCVIRTNNYTEVLPKQYVLGKIPPPTFTSIPSALGSIYHA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.4	Very low	60.1	Low	210 Å²	210	126 Å²	126	100%	1.034	61%	0.608	S	S	*	*				0	-32.4	0	-83.9	169	168	0	0	113.2	E3 I4	M1-E3 VanDerWaalsContact C-N 3.34Å; M1-E3 PolarHBondContact O-N 3.37Å; M1-I4 PolarHBondContact O-N 3.07Å
2	C	53	Low	61.2	Low	107 Å²	107	122 Å²	122	72%	0.723	59%	0.591	S	S	*	*	H	α-helix	trans	-57.6	-33.8	178.5	-77.2	0	0	0	0	116	I4 E5 L6	C2-I4 VanDerWaalsContact C-N 3.35Å; C2-I4 PolarHBondContact O-N 3.36Å; C2-E5 PolarHBondContact O-N 3.05Å; C2-L6 PolarHBondContact O-N 3Å
3	E	61.2	Low	62.2	Low	147 Å²	147	113.7 Å²	113.7	69%	0.687	55%	0.551	S	S	*	*	H	α-helix	trans	-67.3	-37.2	-176.4	-58.7	-156.1	163.7	0	0	112.6	M1 E5 L6 Y7	M1-E3 VanDerWaalsContact C-N 3.34Å; M1-E3 PolarHBondContact O-N 3.37Å; E3-E5 VanDerWaalsContact C-N 3.31Å; E3-E5 PolarHBondContact O-N 3.24Å; E3-L6 WeakPolarHBondContact O-CB 3.38Å; E3-L6 PolarHBondContact O-N 3Å; E3-L6 VanDerWaalsContact O-N 3.13Å; E3-Y7 WeakPolarHBondContact O-CD2 3.35Å; E3-Y7 PolarHBondContact O-N 3.17Å; E3-Y7 VanDerWaalsContact O-N 3.08Å
4	I	59	Low	63.3	Low	75 Å²	75	112.7 Å²	112.7	39%	0.385	55%	0.548	S	S	.	.	H	α-helix	trans	-68.4	-34.5	-178	-39.4	172	0	0	0	110.6	M1 C2 R8 V66 I67	M1-I4 PolarHBondContact O-N 3.07Å; C2-I4 VanDerWaalsContact C-N 3.35Å; C2-I4 PolarHBondContact O-N 3.36Å; I4-R8 WeakPolarHBondContact O-CB 3.45Å; I4-R8 PolarHBondContact O-N 3.38Å; I4-R8 VanDerWaalsContact O-N 3.09Å; I4-V66 HydrophobicContact CG2-CG1 4.5Å; I4-I67 HydrophobicContact CG2-CG1 4.45Å
5	E	59	Low	64.7	Low	143 Å²	143	110.1 Å²	110.1	67%	0.668	54%	0.544	S	S	*	.	H	α-helix	trans	-66.9	-39.4	171.9	-80.7	-161.5	145	0	0	112.2	C2 E3 R8 K9	C2-E5 PolarHBondContact O-N 3.05Å; E3-E5 VanDerWaalsContact C-N 3.31Å; E3-E5 PolarHBondContact O-N 3.24Å; E5-R8 PolarHBondContact O-N 2.99Å; E5-K9 WeakPolarHBondContact O-CB 3.36Å; E5-K9 PolarHBondContact O-N 3.04Å
6	L	59	Low	65.8	Low	115 Å²	115	106.1 Å²	106.1	60%	0.602	53%	0.525	S	S	*	.	H	α-helix	trans	-60.8	-48	177.3	-162.4	83.5	0	0	0	111	C2 E3 R8 K9 T10	C2-L6 PolarHBondContact O-N 3Å; E3-L6 WeakPolarHBondContact O-CB 3.38Å; E3-L6 PolarHBondContact O-N 3Å; E3-L6 VanDerWaalsContact O-N 3.13Å; L6-R8 PolarHBondContact O-N 3.49Å; L6-K9 PolarHBondContact O-N 3.24Å; L6-T10 WeakPolarHBondContact O-CB 3.36Å; L6-T10 PolarHBondContact O-N 3.42Å; L6-T10 PolarHBondContact O-OG1 3.1Å
7	Y	59.5	Low	66.8	Low	62 Å²	62	102.5 Å²	102.5	24%	0.243	51%	0.508	C	S	.	.	H	α-helix	trans	-57.7	-46.6	174.9	-80.3	-77.8	0	0	0	111.5	E3 K9 T10 K11 I12 V63	E3-Y7 WeakPolarHBondContact O-CD2 3.35Å; E3-Y7 PolarHBondContact O-N 3.17Å; E3-Y7 VanDerWaalsContact O-N 3.08Å; Y7-K9 VanDerWaalsContact C-N 3.31Å; Y7-K9 PolarHBondContact O-N 3.17Å; Y7-T10 PolarHBondContact O-N 3.11Å; Y7-T10 PolarHBondContact O-OG1 3.2Å; Y7-K11 PolarHBondContact O-N 3.29Å; Y7-I12 HydrophobicContact CD1-CB 4.49Å; Y7-V63 HydrophobicContact CD1-CG1 4.22Å; Y7-V63 HydrophobicContact CG-CG1 4.25Å
8	R	63.5	Low	67.9	Low	120 Å²	120	99.4 Å²	99.4	45%	0.453	50%	0.501	S	S	.	.	H	α-helix	trans	-60.7	-37.2	178.1	-165	178.7	-169.4	-177.8	3.5	113	I4 E5 L6 N71	I4-R8 WeakPolarHBondContact O-CB 3.45Å; I4-R8 PolarHBondContact O-N 3.38Å; I4-R8 VanDerWaalsContact O-N 3.09Å; E5-R8 PolarHBondContact O-N 2.99Å; L6-R8 PolarHBondContact O-N 3.49Å; R8-N71 PolarHBondContact NH2-OD1 3.16Å
9	K	61.6	Low	68.9	Low	192 Å²	192	96.5 Å²	96.5	84%	0.835	49%	0.494	S	S	*	.	H	α-helix	trans	-78	-35.1	-177.2	-143	172.3	-168.9	174.7	0	112.3	E5 L6 Y7	E5-K9 WeakPolarHBondContact O-CB 3.36Å; E5-K9 PolarHBondContact O-N 3.04Å; L6-K9 PolarHBondContact O-N 3.24Å; Y7-K9 VanDerWaalsContact C-N 3.31Å; Y7-K9 PolarHBondContact O-N 3.17Å
10	T	65.2	Low	69.8	Low	70 Å²	70	91.7 Å²	91.7	43%	0.429	47%	0.469	S	S	.	.	H	α-helix	trans	-91.2	-12.3	-177.2	52.1	0	0	0	0	113.8	L6 Y7 I12	L6-T10 WeakPolarHBondContact O-CB 3.36Å; L6-T10 PolarHBondContact O-N 3.42Å; L6-T10 PolarHBondContact O-OG1 3.1Å; Y7-T10 PolarHBondContact O-N 3.11Å; Y7-T10 PolarHBondContact O-OG1 3.2Å; T10-I12 HydrophobicContact CG2-CD1 4.16Å; T10-I12 PolarHBondContact O-N 2.91Å; T10-I12 VanDerWaalsContact O-N 3.12Å; T10-I12 WeakPolarHBondContact OG1-CD1 3.42Å; T10-I12 WeakPolarHBondContact OG1-CG1 3.28Å
11	K	70.5	Confident	70.6	Confident	145 Å²	145	91.2 Å²	91.2	63%	0.63	47%	0.466	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.1	29.5	-177.6	-66.8	-175.8	176.4	-179.1	0	113.2	Y7 D13 P15	Y7-K11 PolarHBondContact O-N 3.29Å; K11-D13 VanDerWaalsContact CA-OD1 3.26Å; K11-D13 WeakPolarHBondContact CA-OD1 3.36Å; K11-D13 PolarHBondContact O-N 3.28Å; K11-P15 WeakPolarHBondContact O-CD 3.48Å
12	I	73.4	Confident	72.6	Confident	78 Å²	78	86 Å²	86	40%	0.4	44%	0.441	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.5	-21	-177.6	-64	166	0	0	0	111	Y7 T10 I14 P15 L16	Y7-I12 HydrophobicContact CD1-CB 4.49Å; T10-I12 HydrophobicContact CG2-CD1 4.16Å; T10-I12 PolarHBondContact O-N 2.91Å; T10-I12 VanDerWaalsContact O-N 3.12Å; T10-I12 WeakPolarHBondContact OG1-CD1 3.42Å; T10-I12 WeakPolarHBondContact OG1-CG1 3.28Å; I12-I14 VanDerWaalsContact C-N 3.32Å; I12-I14 PolarHBondContact O-N 3.46Å; I12-P15 WeakPolarHBondContact O-CD 3.24Å; I12-P15 VanDerWaalsContact O-CG 3.26Å; I12-P15 WeakPolarHBondContact O-CG 3.48Å; I12-L16 WeakPolarHBondContact O-CB 2.93Å; I12-L16 PolarHBondContact O-N 3.28Å
13	D	74.4	Confident	74.2	Confident	14 Å²	14	83.7 Å²	83.7	8%	0.075	42%	0.422	C	S	.	.	H	α-helix	trans	-56.3	-39.3	177.2	38.9	-52.4	0	0	0	113.2	K11 L17 V63 I67	K11-D13 VanDerWaalsContact CA-OD1 3.26Å; K11-D13 WeakPolarHBondContact CA-OD1 3.36Å; K11-D13 PolarHBondContact O-N 3.28Å; D13-L17 VanDerWaalsContact O-CB 3.32Å; D13-L17 WeakPolarHBondContact O-CB 3.37Å; D13-L17 PolarHBondContact O-N 3.48Å; D13-V63 HydrophobicContact CB-CG1 4.25Å; D13-I67 HydrophobicContact CB-CD1 4.01Å
14	I	78.2	Confident	75.5	Confident	100 Å²	100	77.9 Å²	77.9	51%	0.513	40%	0.397	S	S	.	.	H	α-helix	trans	-69	-54.6	178.3	-58.4	171.7	0	0	0	112.7	I12 L16 L17 A18	I12-I14 VanDerWaalsContact C-N 3.32Å; I12-I14 PolarHBondContact O-N 3.46Å; I14-L16 VanDerWaalsContact C-N 3.28Å; I14-L16 PolarHBondContact O-N 3.38Å; I14-L17 WeakPolarHBondContact O-CB 3.07Å; I14-L17 PolarHBondContact O-N 3.09Å; I14-A18 PolarHBondContact O-N 2.92Å
15	P	83.8	Confident	77.1	Confident	74 Å²	74	78.9 Å²	78.9	48%	0.481	40%	0.402	S	S	.	.	H	α-helix	trans	-65.6	-31.7	178.2	24.9	-33.1	0	0	0	112.2	K11 I12 A18 A19	K11-P15 WeakPolarHBondContact O-CD 3.48Å; I12-P15 WeakPolarHBondContact O-CD 3.24Å; I12-P15 VanDerWaalsContact O-CG 3.26Å; I12-P15 WeakPolarHBondContact O-CG 3.48Å; P15-A18 PolarHBondContact O-N 2.8Å; P15-A19 WeakPolarHBondContact O-CB 3.29Å; P15-A19 PolarHBondContact O-N 3.39Å
16	L	82.5	Confident	78.6	Confident	46 Å²	46	76.2 Å²	76.2	24%	0.241	39%	0.392	C	S	.	.	H	α-helix	trans	-66.4	-39.2	175.2	-162.4	72.7	0	0	0	111.5	I12 I14 A19 G20 L56 F59	I12-L16 WeakPolarHBondContact O-CB 2.93Å; I12-L16 PolarHBondContact O-N 3.28Å; I14-L16 VanDerWaalsContact C-N 3.28Å; I14-L16 PolarHBondContact O-N 3.38Å; L16-A19 PolarHBondContact O-N 2.95Å; L16-G20 PolarHBondContact O-N 3.01Å; L16-L56 HydrophobicContact CD1-CD2 4.07Å; L16-L56 HydrophobicContact CG-CD2 4.36Å; L16-F59 HydrophobicContact CD2-CD1 4.39Å
17	L	83.3	Confident	80.1	Confident	44 Å²	44	71 Å²	71	23%	0.23	37%	0.365	C	S	.	.	H	α-helix	trans	-64.3	-44.6	173.9	-167.4	85.3	0	0	0	111.1	D13 I14 G20 M21 F57 S60 L61	D13-L17 VanDerWaalsContact O-CB 3.32Å; D13-L17 WeakPolarHBondContact O-CB 3.37Å; D13-L17 PolarHBondContact O-N 3.48Å; I14-L17 WeakPolarHBondContact O-CB 3.07Å; I14-L17 PolarHBondContact O-N 3.09Å; L17-G20 PolarHBondContact O-N 3.35Å; L17-M21 WeakPolarHBondContact O-CB 3.4Å; L17-M21 WeakPolarHBondContact O-CG 3.48Å; L17-M21 PolarHBondContact O-N 2.95Å; L17-F57 HydrophobicContact CD1-CD2 4.48Å; L17-F57 HydrophobicContact CD1-CE2 3.99Å; L17-F57 HydrophobicContact CG-CE2 4.4Å; L17-S60 WeakPolarHBondContact CA-OG 3.22Å; L17-S60 WeakPolarHBondContact CB-OG 3.32Å; L17-S60 VanDerWaalsContact CD1-OG 3.24Å; L17-S60 WeakPolarHBondContact CD1-OG 3.23Å; L17-S60 PolarHBondContact N-OG 3.41Å; L17-L61 HydrophobicContact CD1-CB 4.31Å; L17-L61 HydrophobicContact CD1-CG 4.45Å
18	A	86.1	Confident	81.6	Confident	47 Å²	47	72 Å²	72	39%	0.388	38%	0.38	S	S	.	.	H	α-helix	trans	-61.8	-45.7	176.9	0	0	0	0	0	111.5	I14 P15 G20 M21 I22	I14-A18 PolarHBondContact O-N 2.92Å; P15-A18 PolarHBondContact O-N 2.8Å; A18-G20 PolarHBondContact O-N 3.46Å; A18-M21 PolarHBondContact O-N 3.46Å; A18-I22 WeakPolarHBondContact O-CB 3.31Å; A18-I22 WeakPolarHBondContact O-CD1 3.2Å; A18-I22 WeakPolarHBondContact O-CG1 3.44Å; A18-I22 PolarHBondContact O-N 2.95Å
19	A	87.1	Confident	83	Confident	44 Å²	44	70.9 Å²	70.9	36%	0.364	38%	0.382	S	S	.	.	H	α-helix	trans	-61.6	-44.5	176.8	0	0	0	0	0	111.8	P15 L16 M21 I22 L23	P15-A19 WeakPolarHBondContact O-CB 3.29Å; P15-A19 PolarHBondContact O-N 3.39Å; L16-A19 PolarHBondContact O-N 2.95Å; A19-M21 PolarHBondContact O-N 3.49Å; A19-I22 PolarHBondContact O-N 3.5Å; A19-L23 WeakPolarHBondContact O-CB 3.36Å; A19-L23 WeakPolarHBondContact O-CG 3.36Å; A19-L23 PolarHBondContact O-N 2.85Å
20	G	85.6	Confident	84.3	Confident	0 Å²	0	65 Å²	65	0%	0	36%	0.359	C	S	.	.	H	α-helix	trans	-59.7	-45.1	174.9	0	0	0	0	0	112.5	L16 L17 A18 L23 C24	L16-G20 PolarHBondContact O-N 3.01Å; L17-G20 PolarHBondContact O-N 3.35Å; A18-G20 PolarHBondContact O-N 3.46Å; G20-L23 PolarHBondContact O-N 2.95Å; G20-C24 PolarHBondContact O-N 3.33Å; G20-C24 PolarHBondContact O-SG 2.87Å
21	M	87.5	Confident	85.5	Confident	83 Å²	83	63.7 Å²	63.7	41%	0.409	35%	0.349	S	S	.	.	H	α-helix	trans	-60.2	-46.5	175.5	-78.4	-64.6	-66.4	0	0	112.3	L17 A18 A19 L23 C24 I25 F57	L17-M21 WeakPolarHBondContact O-CB 3.4Å; L17-M21 WeakPolarHBondContact O-CG 3.48Å; L17-M21 PolarHBondContact O-N 2.95Å; A18-M21 PolarHBondContact O-N 3.46Å; A19-M21 PolarHBondContact O-N 3.49Å; M21-L23 VanDerWaalsContact C-N 3.33Å; M21-L23 PolarHBondContact O-N 3.32Å; M21-C24 PolarHBondContact O-N 3.49Å; M21-I25 VanDerWaalsContact O-CG1 3.32Å; M21-I25 WeakPolarHBondContact O-CG1 3.23Å; M21-I25 PolarHBondContact O-N 3.43Å; M21-F57 HydrophobicContact CG-CD2 3.98Å; M21-F57 HydrophobicContact CG-CE2 3.44Å; M21-F57 VanDerWaalsContact CG-CE2 3.44Å; M21-F57 HydrophobicContact CG-CZ 4.21Å; M21-F57 HydrophobicContact SD-CD2 3.96Å; M21-F57 HydrophobicContact SD-CE1 4.24Å; M21-F57 HydrophobicContact SD-CE2 3.16Å; M21-F57 WeakPolarHBondContact SD-CE2 3.47Å; M21-F57 HydrophobicContact SD-CZ 3.31Å; M21-F57 WeakPolarHBondContact SD-CZ 3.5Å
22	I	91.4	Very high	86.5	Confident	99 Å²	99	59.8 Å²	59.8	51%	0.508	34%	0.34	S	S	.	.	H	α-helix	trans	-62.2	-43.2	-179.8	-69.4	163.4	0	0	0	110.4	A18 A19 I25 L26	A18-I22 WeakPolarHBondContact O-CB 3.31Å; A18-I22 WeakPolarHBondContact O-CD1 3.2Å; A18-I22 WeakPolarHBondContact O-CG1 3.44Å; A18-I22 PolarHBondContact O-N 2.95Å; A19-I22 PolarHBondContact O-N 3.5Å; I22-I25 PolarHBondContact O-N 3.37Å; I22-L26 HydrophobicContact CG2-CD1 3.73Å; I22-L26 HydrophobicContact CG2-CG 4.46Å; I22-L26 WeakPolarHBondContact O-CB 3.33Å; I22-L26 WeakPolarHBondContact O-CG 3.18Å; I22-L26 PolarHBondContact O-N 3.42Å
23	L	87	Confident	87.4	Confident	60 Å²	60	59.7 Å²	59.7	31%	0.314	34%	0.343	S	S	.	.	H	α-helix	trans	-63	-43.3	176.6	-75.4	166.8	0	0	0	112.2	A19 G20 M21 I25 L26 S27 V49	A19-L23 WeakPolarHBondContact O-CB 3.36Å; A19-L23 WeakPolarHBondContact O-CG 3.36Å; A19-L23 PolarHBondContact O-N 2.85Å; G20-L23 PolarHBondContact O-N 2.95Å; M21-L23 VanDerWaalsContact C-N 3.33Å; M21-L23 PolarHBondContact O-N 3.32Å; L23-I25 PolarHBondContact O-N 2.97Å; L23-L26 PolarHBondContact O-N 3.43Å; L23-S27 WeakPolarHBondContact O-CB 3.4Å; L23-S27 PolarHBondContact O-N 2.83Å; L23-V49 HydrophobicContact CD2-CG1 4.26Å
24	C	89.2	Confident	88.1	Confident	25 Å²	25	59 Å²	59	17%	0.169	34%	0.339	C	S	.	.	H	α-helix	trans	-60.4	-46.2	175.3	-77.2	0	0	0	0	111.3	G20 M21 S27 C28	G20-C24 PolarHBondContact O-N 3.33Å; G20-C24 PolarHBondContact O-SG 2.87Å; M21-C24 PolarHBondContact O-N 3.49Å; C24-S27 PolarHBondContact O-N 2.89Å; C24-S27 PolarHBondContact O-OG 2.86Å; C24-C28 PolarHBondContact O-N 2.89Å; C24-C28 VanDerWaalsContact O-N 3.08Å
25	I	91.7	Very high	88.6	Confident	95 Å²	95	59.4 Å²	59.4	49%	0.487	34%	0.341	S	S	.	.	H	α-helix	trans	-63.3	-46.8	178.8	-67.2	166.6	0	0	0	110.8	M21 I22 L23 S27 C28 L29	M21-I25 VanDerWaalsContact O-CG1 3.32Å; M21-I25 WeakPolarHBondContact O-CG1 3.23Å; M21-I25 PolarHBondContact O-N 3.43Å; I22-I25 PolarHBondContact O-N 3.37Å; L23-I25 PolarHBondContact O-N 2.97Å; I25-S27 VanDerWaalsContact C-N 3.28Å; I25-S27 PolarHBondContact O-N 2.88Å; I25-C28 PolarHBondContact O-N 3.36Å; I25-L29 HydrophobicContact CG2-CD1 4.09Å; I25-L29 HydrophobicContact CG2-CG 4.44Å; I25-L29 WeakPolarHBondContact O-CG 3.39Å; I25-L29 PolarHBondContact O-N 3.29Å
26	L	90.2	Very high	89	Confident	87 Å²	87	59.8 Å²	59.8	46%	0.455	35%	0.35	S	S	.	.	H	α-helix	trans	-58.4	-41.7	176.5	-82.3	163.1	0	0	0	111.6	I22 L23 L29 M30	I22-L26 HydrophobicContact CG2-CD1 3.73Å; I22-L26 HydrophobicContact CG2-CG 4.46Å; I22-L26 WeakPolarHBondContact O-CB 3.33Å; I22-L26 WeakPolarHBondContact O-CG 3.18Å; I22-L26 PolarHBondContact O-N 3.42Å; L23-L26 PolarHBondContact O-N 3.43Å; L26-L29 PolarHBondContact O-N 2.69Å; L26-M30 WeakPolarHBondContact O-CG 3.38Å; L26-M30 PolarHBondContact O-N 3.39Å
27	S	90.1	Very high	89.3	Confident	6 Å²	6	66.9 Å²	66.9	4%	0.042	37%	0.374	C	S	.	.	H	α-helix	trans	-63	-45.8	179	79.5	0	0	0	0	111.6	L23 C24 I25 L29 M30 I31	L23-S27 WeakPolarHBondContact O-CB 3.4Å; L23-S27 PolarHBondContact O-N 2.83Å; C24-S27 PolarHBondContact O-N 2.89Å; C24-S27 PolarHBondContact O-OG 2.86Å; I25-S27 VanDerWaalsContact C-N 3.28Å; I25-S27 PolarHBondContact O-N 2.88Å; S27-L29 VanDerWaalsContact C-N 3.32Å; S27-L29 PolarHBondContact O-N 3.28Å; S27-M30 PolarHBondContact O-N 3.34Å; S27-I31 WeakPolarHBondContact O-CD1 3.5Å; S27-I31 VanDerWaalsContact O-CG1 3.23Å; S27-I31 WeakPolarHBondContact O-CG1 3.37Å; S27-I31 PolarHBondContact O-N 3.23Å
28	C	92.3	Very high	89.5	Confident	82 Å²	82	71 Å²	71	55%	0.554	40%	0.401	S	S	*	.	H	α-helix	trans	-59.8	-40.5	173.6	-77.1	0	0	0	0	112.3	C24 I25 I31 S32	C24-C28 PolarHBondContact O-N 2.89Å; C24-C28 VanDerWaalsContact O-N 3.08Å; I25-C28 PolarHBondContact O-N 3.36Å; C28-I31 PolarHBondContact O-N 2.83Å; C28-S32 WeakPolarHBondContact O-CB 3.36Å; C28-S32 PolarHBondContact O-N 2.98Å; C28-S32 PolarHBondContact O-OG 3.08Å
29	L	92.2	Very high	89.6	Confident	97 Å²	97	76.7 Å²	76.7	51%	0.508	41%	0.412	S	S	.	.	H	α-helix	trans	-65.9	-43.1	176.8	-70.6	175.6	0	0	0	111.7	I25 L26 S27 I31 S32 V33	I25-L29 HydrophobicContact CG2-CD1 4.09Å; I25-L29 HydrophobicContact CG2-CG 4.44Å; I25-L29 WeakPolarHBondContact O-CG 3.39Å; I25-L29 PolarHBondContact O-N 3.29Å; L26-L29 PolarHBondContact O-N 2.69Å; S27-L29 VanDerWaalsContact C-N 3.32Å; S27-L29 PolarHBondContact O-N 3.28Å; L29-I31 PolarHBondContact O-N 3.26Å; L29-S32 WeakPolarHBondContact CA-OG 3.38Å; L29-S32 PolarHBondContact O-N 2.99Å; L29-S32 PolarHBondContact O-OG 3.3Å; L29-V33 VanDerWaalsContact O-CB 3.29Å; L29-V33 WeakPolarHBondContact O-CB 3.27Å; L29-V33 WeakPolarHBondContact O-CG2 3.37Å; L29-V33 PolarHBondContact O-N 2.9Å
30	M	89.2	Confident	89.6	Confident	69 Å²	69	80.9 Å²	80.9	34%	0.34	42%	0.424	S	S	.	.	H	α-helix	trans	-64.5	-40.9	176.6	-71.5	-162.2	81.4	0	0	112.3	L26 S27 G34 V42 A45	L26-M30 WeakPolarHBondContact O-CG 3.38Å; L26-M30 PolarHBondContact O-N 3.39Å; S27-M30 PolarHBondContact O-N 3.34Å; M30-G34 PolarHBondContact O-N 2.95Å; M30-V42 HydrophobicContact CE-CG1 4.16Å; M30-A45 HydrophobicContact CE-CB 4.19Å
31	I	91	Very high	89.8	Confident	43 Å²	43	87.3 Å²	87.3	22%	0.221	46%	0.459	C	S	.	.	H	α-helix	trans	-63.2	-50.5	177.2	-65.7	164.2	0	0	0	110	S27 C28 L29 V33 G34 I35 I47	S27-I31 WeakPolarHBondContact O-CD1 3.5Å; S27-I31 VanDerWaalsContact O-CG1 3.23Å; S27-I31 WeakPolarHBondContact O-CG1 3.37Å; S27-I31 PolarHBondContact O-N 3.23Å; C28-I31 PolarHBondContact O-N 2.83Å; L29-I31 PolarHBondContact O-N 3.26Å; I31-V33 PolarHBondContact O-N 3.37Å; I31-G34 PolarHBondContact O-N 3.42Å; I31-I35 HydrophobicContact CG2-CD1 3.76Å; I31-I35 WeakPolarHBondContact O-CD1 3.38Å; I31-I35 VanDerWaalsContact O-CG1 3.24Å; I31-I35 WeakPolarHBondContact O-CG1 3.48Å; I31-I35 PolarHBondContact O-N 3.5Å; I31-I47 HydrophobicContact CD1-CG1 4.07Å; I31-I47 HydrophobicContact CG1-CG1 4.18Å
32	S	91.6	Very high	89.9	Confident	62 Å²	62	85.2 Å²	85.2	43%	0.434	45%	0.45	S	S	.	.	H	α-helix	trans	-63.6	-42.7	-179.8	54.4	0	0	0	0	112.9	C28 L29 A36	C28-S32 WeakPolarHBondContact O-CB 3.36Å; C28-S32 PolarHBondContact O-N 2.98Å; C28-S32 PolarHBondContact O-OG 3.08Å; L29-S32 WeakPolarHBondContact CA-OG 3.38Å; L29-S32 PolarHBondContact O-N 2.99Å; L29-S32 PolarHBondContact O-OG 3.3Å; S32-A36 VanDerWaalsContact O-CB 3.31Å; S32-A36 WeakPolarHBondContact O-CB 3.38Å; S32-A36 PolarHBondContact O-N 2.89Å
33	V	91.7	Very high	89.9	Confident	77 Å²	77	84.7 Å²	84.7	47%	0.467	44%	0.442	S	S	.	.	H	α-helix	trans	-66.9	-40.5	176.3	171.4	0	0	0	0	111.4	L29 I31 A36 R37	L29-V33 VanDerWaalsContact O-CB 3.29Å; L29-V33 WeakPolarHBondContact O-CB 3.27Å; L29-V33 WeakPolarHBondContact O-CG2 3.37Å; L29-V33 PolarHBondContact O-N 2.9Å; I31-V33 PolarHBondContact O-N 3.37Å; V33-A36 PolarHBondContact O-N 3.22Å; V33-R37 HydrophobicContact CG1-CG 4.32Å; V33-R37 WeakPolarHBondContact O-CB 3.34Å; V33-R37 WeakPolarHBondContact O-CG 3.36Å; V33-R37 PolarHBondContact O-N 3.33Å
34	G	88.1	Confident	90	Very high	0 Å²	0	86.1 Å²	86.1	0%	0	45%	0.449	C	S	.	.	H	α-helix	trans	-65.1	-39.8	178.9	0	0	0	0	0	112.4	M30 I31 V38 R39	M30-G34 PolarHBondContact O-N 2.95Å; I31-G34 PolarHBondContact O-N 3.42Å; G34-V38 PolarHBondContact O-N 2.88Å; G34-V38 VanDerWaalsContact O-N 3.11Å; G34-R39 PolarHBondContact O-N 3.41Å
35	I	89.9	Confident	90.1	Very high	108 Å²	108	86.7 Å²	86.7	55%	0.554	46%	0.456	S	S	*	.	H	α-helix	trans	-65.1	-47.2	172.6	-64.5	163.9	0	0	0	110.2	I31 R37 V38 W43	I31-I35 HydrophobicContact CG2-CD1 3.76Å; I31-I35 WeakPolarHBondContact O-CD1 3.38Å; I31-I35 VanDerWaalsContact O-CG1 3.24Å; I31-I35 WeakPolarHBondContact O-CG1 3.48Å; I31-I35 PolarHBondContact O-N 3.5Å; I35-R37 VanDerWaalsContact C-N 3.27Å; I35-R37 PolarHBondContact O-N 3.03Å; I35-V38 PolarHBondContact O-N 3Å; I35-W43 HydrophobicContact CG1-CB 4.36Å; I35-W43 HydrophobicContact CG1-CG 4.47Å
36	A	90.7	Very high	90	Very high	81 Å²	81	82.2 Å²	82.2	67%	0.669	43%	0.432	S	S	*	.	H	α-helix	trans	-63.4	-31	-178.7	0	0	0	0	0	113.4	S32 V33	S32-A36 VanDerWaalsContact O-CB 3.31Å; S32-A36 WeakPolarHBondContact O-CB 3.38Å; S32-A36 PolarHBondContact O-N 2.89Å; V33-A36 PolarHBondContact O-N 3.22Å
37	R	89.4	Confident	90.1	Very high	196 Å²	196	81.3 Å²	81.3	74%	0.74	43%	0.428	S	S	*	.	T	Hydrogen-bonded Turn	trans	-96.3	2.2	179.7	-66.4	-67.5	-171.7	148.7	0.6	113.7	V33 I35 R39	V33-R37 HydrophobicContact CG1-CG 4.32Å; V33-R37 WeakPolarHBondContact O-CB 3.34Å; V33-R37 WeakPolarHBondContact O-CG 3.36Å; V33-R37 PolarHBondContact O-N 3.33Å; I35-R37 VanDerWaalsContact C-N 3.27Å; I35-R37 PolarHBondContact O-N 3.03Å; R37-R39 HydrophobicContact CB-CG 4.31Å; R37-R39 PolarHBondContact O-N 3.48Å; R37-R39 VanDerWaalsContact O-N 3.17Å
38	V	88.3	Confident	90.2	Very high	131 Å²	131	86.9 Å²	86.9	79%	0.794	46%	0.456	S	S	*	.	T	Hydrogen-bonded Turn	trans	48.5	40.8	-175.3	-163.1	0	0	0	0	111	G34 I35	G34-V38 PolarHBondContact O-N 2.88Å; G34-V38 VanDerWaalsContact O-N 3.11Å; I35-V38 PolarHBondContact O-N 3Å
39	R	86.7	Confident	90.1	Very high	166 Å²	166	85.2 Å²	85.2	63%	0.626	44%	0.443	S	S	*	.			trans	-109.8	101.9	178	-79.6	-170.5	168.3	-163.9	-4.1	108.8	G34 R37 D41 V42 W43	G34-R39 PolarHBondContact O-N 3.41Å; R37-R39 HydrophobicContact CB-CG 4.31Å; R37-R39 PolarHBondContact O-N 3.48Å; R37-R39 VanDerWaalsContact O-N 3.17Å; R39-D41 VanDerWaalsContact C-N 3.3Å; R39-D41 PolarHBondContact O-N 3.5Å; R39-V42 HydrophobicContact CB-CB 4.25Å; R39-V42 HydrophobicContact CB-CG2 3.85Å; R39-V42 PolarHBondContact O-N 2.88Å; R39-V42 VanDerWaalsContact O-N 3.16Å; R39-W43 VanDerWaalsContact O-CD1 3.31Å; R39-W43 PolarHBondContact O-N 3.45Å
40	E	87.8	Confident	90	Very high	132 Å²	132	81.7 Å²	81.7	62%	0.617	43%	0.428	S	S	*	.	H	α-helix	trans	-54.7	-46.9	-179	-79.2	-178	162.7	0	0	112.4	V42 W43 I44	E40-V42 PolarHBondContact O-N 3.48Å; E40-W43 PolarHBondContact O-N 2.92Å; E40-I44 HydrophobicContact CB-CD1 4.11Å; E40-I44 WeakPolarHBondContact O-CB 3.18Å; E40-I44 WeakPolarHBondContact O-CD1 3.2Å; E40-I44 WeakPolarHBondContact O-CG1 3.42Å; E40-I44 PolarHBondContact O-N 3.37Å
41	D	89.8	Confident	90.1	Very high	135 Å²	135	83.9 Å²	83.9	72%	0.722	44%	0.44	S	S	*	.	H	α-helix	trans	-54	-34.9	-179.2	-52.8	-33.2	0	0	0	113.2	R39 A45	R39-D41 VanDerWaalsContact C-N 3.3Å; R39-D41 PolarHBondContact O-N 3.5Å; D41-A45 VanDerWaalsContact O-CB 3.28Å; D41-A45 WeakPolarHBondContact O-CB 3.48Å; D41-A45 PolarHBondContact O-N 3.47Å; D41-A45 VanDerWaalsContact O-N 3.1Å
42	V	88.6	Confident	90	Very high	38 Å²	38	86.2 Å²	86.2	23%	0.23	46%	0.456	C	S	.	.	H	α-helix	trans	-80.3	-46.3	-172.9	-178.3	0	0	0	0	111.7	M30 R39 E40 I44 A45 G46	M30-V42 HydrophobicContact CE-CG1 4.16Å; R39-V42 HydrophobicContact CB-CB 4.25Å; R39-V42 HydrophobicContact CB-CG2 3.85Å; R39-V42 PolarHBondContact O-N 2.88Å; R39-V42 VanDerWaalsContact O-N 3.16Å; E40-V42 PolarHBondContact O-N 3.48Å; V42-I44 VanDerWaalsContact C-N 3.34Å; V42-A45 PolarHBondContact O-N 3.33Å; V42-G46 PolarHBondContact O-N 2.93Å
43	W	91.4	Very high	89.7	Confident	88 Å²	88	83.3 Å²	83.3	33%	0.333	44%	0.436	S	S	.	.	H	α-helix	trans	-73.9	-30	-180	71	-91.4	0	0	0	111.6	I35 R39 E40 G46 I47	I35-W43 HydrophobicContact CG1-CB 4.36Å; I35-W43 HydrophobicContact CG1-CG 4.47Å; R39-W43 VanDerWaalsContact O-CD1 3.31Å; R39-W43 PolarHBondContact O-N 3.45Å; E40-W43 PolarHBondContact O-N 2.92Å; W43-G46 PolarHBondContact O-N 3.5Å; W43-I47 HydrophobicContact CE3-CD1 3.4Å; W43-I47 HydrophobicContact CE3-CG1 4.36Å; W43-I47 HydrophobicContact CZ3-CD1 3.32Å; W43-I47 WeakPolarHBondContact O-CG1 3.33Å; W43-I47 PolarHBondContact O-N 3.38Å
44	I	90.9	Very high	89.5	Confident	90 Å²	90	84.4 Å²	84.4	46%	0.462	44%	0.439	S	S	.	.	H	α-helix	trans	-64.8	-44.4	171.2	-71.3	158.9	0	0	0	111	E40 V42 G46 I47 L48	E40-I44 HydrophobicContact CB-CD1 4.11Å; E40-I44 WeakPolarHBondContact O-CB 3.18Å; E40-I44 WeakPolarHBondContact O-CD1 3.2Å; E40-I44 WeakPolarHBondContact O-CG1 3.42Å; E40-I44 PolarHBondContact O-N 3.37Å; V42-I44 VanDerWaalsContact C-N 3.34Å; I44-G46 VanDerWaalsContact C-N 3.26Å; I44-G46 PolarHBondContact O-N 3.31Å; I44-I47 PolarHBondContact O-N 2.97Å; I44-I47 VanDerWaalsContact O-N 3.17Å; I44-L48 PolarHBondContact O-N 3.35Å
45	A	90.5	Very high	89.5	Confident	38 Å²	38	87.7 Å²	87.7	31%	0.314	46%	0.46	S	S	.	.	H	α-helix	trans	-59.5	-39.4	172.6	0	0	0	0	0	111.6	M30 D41 V42 I47 L48 V49	M30-A45 HydrophobicContact CE-CB 4.19Å; D41-A45 VanDerWaalsContact O-CB 3.28Å; D41-A45 WeakPolarHBondContact O-CB 3.48Å; D41-A45 PolarHBondContact O-N 3.47Å; D41-A45 VanDerWaalsContact O-N 3.1Å; V42-A45 PolarHBondContact O-N 3.33Å; A45-I47 PolarHBondContact O-N 2.9Å; A45-L48 WeakPolarHBondContact O-CB 3.29Å; A45-L48 PolarHBondContact O-N 2.97Å; A45-V49 WeakPolarHBondContact O-CG2 3.32Å; A45-V49 PolarHBondContact O-N 2.85Å
46	G	89.9	Confident	89.4	Confident	0 Å²	0	85.5 Å²	85.5	0%	0	45%	0.449	C	S	.	.	H	α-helix	trans	-58.9	-43.1	173.7	0	0	0	0	0	113.3	V42 W43 I44 V49 A50	V42-G46 PolarHBondContact O-N 2.93Å; W43-G46 PolarHBondContact O-N 3.5Å; I44-G46 VanDerWaalsContact C-N 3.26Å; I44-G46 PolarHBondContact O-N 3.31Å; G46-V49 PolarHBondContact O-N 3.23Å; G46-A50 PolarHBondContact O-N 3.3Å
47	I	92	Very high	89.2	Confident	69 Å²	69	83.6 Å²	83.6	35%	0.354	43%	0.426	S	S	.	.	H	α-helix	trans	-64	-42.4	175.2	-68.7	170.3	0	0	0	111.2	I31 W43 I44 A45 V49 A50 I51	I31-I47 HydrophobicContact CD1-CG1 4.07Å; I31-I47 HydrophobicContact CG1-CG1 4.18Å; W43-I47 HydrophobicContact CE3-CD1 3.4Å; W43-I47 HydrophobicContact CE3-CG1 4.36Å; W43-I47 HydrophobicContact CZ3-CD1 3.32Å; W43-I47 WeakPolarHBondContact O-CG1 3.33Å; W43-I47 PolarHBondContact O-N 3.38Å; I44-I47 PolarHBondContact O-N 2.97Å; I44-I47 VanDerWaalsContact O-N 3.17Å; A45-I47 PolarHBondContact O-N 2.9Å; I47-V49 VanDerWaalsContact C-N 3.29Å; I47-V49 PolarHBondContact O-N 3.44Å; I47-A50 WeakPolarHBondContact O-CB 3.42Å; I47-A50 PolarHBondContact O-N 3.29Å; I47-A50 VanDerWaalsContact O-N 3.09Å; I47-I51 HydrophobicContact CG2-CD1 4.01Å; I47-I51 HydrophobicContact CG2-CG1 4.43Å; I47-I51 WeakPolarHBondContact O-CG1 3.31Å; I47-I51 PolarHBondContact O-N 3.41Å
48	L	91.2	Very high	89.1	Confident	123 Å²	123	78.5 Å²	78.5	64%	0.644	41%	0.413	S	S	*	.	H	α-helix	trans	-58.8	-43.7	177.3	-164.2	85.3	0	0	0	111.1	I44 A45 A50 I51 V52	I44-L48 PolarHBondContact O-N 3.35Å; A45-L48 WeakPolarHBondContact O-CB 3.29Å; A45-L48 PolarHBondContact O-N 2.97Å; L48-A50 VanDerWaalsContact C-N 3.34Å; L48-I51 PolarHBondContact O-N 3.35Å; L48-V52 PolarHBondContact O-N 3.34Å
49	V	90.7	Very high	89	Confident	47 Å²	47	77.3 Å²	77.3	29%	0.285	40%	0.397	S	S	.	.	H	α-helix	trans	-65.1	-38.9	175.2	177.3	0	0	0	0	111	L23 A45 G46 I47 I51 V52 G53	L23-V49 HydrophobicContact CD2-CG1 4.26Å; A45-V49 WeakPolarHBondContact O-CG2 3.32Å; A45-V49 PolarHBondContact O-N 2.85Å; G46-V49 PolarHBondContact O-N 3.23Å; I47-V49 VanDerWaalsContact C-N 3.29Å; I47-V49 PolarHBondContact O-N 3.44Å; V49-I51 PolarHBondContact O-N 2.87Å; V49-V52 PolarHBondContact O-N 2.82Å; V49-G53 PolarHBondContact O-N 2.84Å
50	A	90.7	Very high	88.9	Confident	23 Å²	23	69.4 Å²	69.4	19%	0.19	37%	0.367	C	S	.	.	H	α-helix	trans	-62.4	-40.3	177	0	0	0	0	0	112.3	G46 I47 L48 V52 G53 L54	G46-A50 PolarHBondContact O-N 3.3Å; I47-A50 WeakPolarHBondContact O-CB 3.42Å; I47-A50 PolarHBondContact O-N 3.29Å; I47-A50 VanDerWaalsContact O-N 3.09Å; L48-A50 VanDerWaalsContact C-N 3.34Å; A50-V52 PolarHBondContact O-N 3.41Å; A50-G53 PolarHBondContact O-N 3.19Å; A50-L54 WeakPolarHBondContact O-CB 3.19Å; A50-L54 PolarHBondContact O-N 3.08Å
51	I	91.6	Very high	88.7	Confident	115 Å²	115	66.2 Å²	66.2	59%	0.59	35%	0.354	S	S	*	.	H	α-helix	trans	-61.2	-32.6	178.9	-68.6	165.4	0	0	0	111.6	I47 L48 V49 P55	I47-I51 HydrophobicContact CG2-CD1 4.01Å; I47-I51 HydrophobicContact CG2-CG1 4.43Å; I47-I51 WeakPolarHBondContact O-CG1 3.31Å; I47-I51 PolarHBondContact O-N 3.41Å; L48-I51 PolarHBondContact O-N 3.35Å; V49-I51 PolarHBondContact O-N 2.87Å; I51-P55 WeakPolarHBondContact O-CD 3.24Å; I51-P55 WeakPolarHBondContact O-CG 3.36Å
52	V	88.3	Confident	88.4	Confident	92 Å²	92	64.8 Å²	64.8	56%	0.558	35%	0.345	S	S	*	.	H	α-helix	trans	-88.5	-40.7	177.1	-177.8	0	0	0	0	111.5	L48 V49 A50 P55 L56	L48-V52 PolarHBondContact O-N 3.34Å; V49-V52 PolarHBondContact O-N 2.82Å; A50-V52 PolarHBondContact O-N 3.41Å; V52-P55 WeakPolarHBondContact O-CD 2.96Å; V52-P55 WeakPolarHBondContact O-CG 3.2Å; V52-L56 WeakPolarHBondContact O-CB 3.16Å; V52-L56 PolarHBondContact O-N 3.35Å
53	G	85.1	Confident	88.1	Confident	0 Å²	0	64 Å²	64	0%	0	34%	0.341	C	S	.	.	H	α-helix	trans	-68.2	-40.7	-176.9	0	0	0	0	0	113.3	V49 A50 L56 F57	V49-G53 PolarHBondContact O-N 2.84Å; A50-G53 PolarHBondContact O-N 3.19Å; G53-L56 PolarHBondContact O-N 3.04Å; G53-F57 WeakPolarHBondContact O-CB 3.4Å; G53-F57 PolarHBondContact O-N 3.43Å
54	L	87.5	Confident	87.6	Confident	101 Å²	101	63.1 Å²	63.1	53%	0.529	34%	0.339	S	S	.	.	H	α-helix	trans	-62.1	-51.3	-178.6	-161.1	100.5	0	0	0	113.5	A50 L56 F57 L58	A50-L54 WeakPolarHBondContact O-CB 3.19Å; A50-L54 PolarHBondContact O-N 3.08Å; L54-L56 VanDerWaalsContact C-N 3.3Å; L54-L56 PolarHBondContact O-N 3.37Å; L54-F57 PolarHBondContact O-N 3.13Å; L54-L58 HydrophobicContact CD2-CD1 4.21Å; L54-L58 HydrophobicContact CG-CD1 4.4Å; L54-L58 WeakPolarHBondContact O-CB 3.48Å; L54-L58 WeakPolarHBondContact O-CG 3.36Å; L54-L58 PolarHBondContact O-N 3.42Å
55	P	88.7	Confident	87.1	Confident	69 Å²	69	61.7 Å²	61.7	45%	0.448	34%	0.336	S	S	.	.	H	α-helix	trans	-66	-33.5	177.2	24.4	-33	0	0	0	112.2	I51 V52 L58 F59	I51-P55 WeakPolarHBondContact O-CD 3.24Å; I51-P55 WeakPolarHBondContact O-CG 3.36Å; V52-P55 WeakPolarHBondContact O-CD 2.96Å; V52-P55 WeakPolarHBondContact O-CG 3.2Å; P55-L58 PolarHBondContact O-N 3.35Å; P55-F59 VanDerWaalsContact O-CB 3.23Å; P55-F59 WeakPolarHBondContact O-CB 3.32Å; P55-F59 PolarHBondContact O-N 3.02Å
56	L	87.1	Confident	86.5	Confident	61 Å²	61	63.1 Å²	63.1	32%	0.319	34%	0.341	S	S	.	.	H	α-helix	trans	-67.5	-40.3	177.3	-154.6	142.7	0	0	0	111.1	L16 V52 G53 L54 S60	L16-L56 HydrophobicContact CD1-CD2 4.07Å; L16-L56 HydrophobicContact CG-CD2 4.36Å; V52-L56 WeakPolarHBondContact O-CB 3.16Å; V52-L56 PolarHBondContact O-N 3.35Å; G53-L56 PolarHBondContact O-N 3.04Å; L54-L56 VanDerWaalsContact C-N 3.3Å; L54-L56 PolarHBondContact O-N 3.37Å; L56-S60 WeakPolarHBondContact O-CB 3.11Å; L56-S60 PolarHBondContact O-N 2.98Å
57	F	87.1	Confident	85.7	Confident	42 Å²	42	64 Å²	64	18%	0.184	35%	0.345	C	S	.	.	H	α-helix	trans	-64.9	-47.2	172.3	179.3	-114.1	0	0	0	112.2	L17 M21 G53 L54 F59 S60 L61	L17-F57 HydrophobicContact CD1-CD2 4.48Å; L17-F57 HydrophobicContact CD1-CE2 3.99Å; L17-F57 HydrophobicContact CG-CE2 4.4Å; M21-F57 HydrophobicContact CG-CD2 3.98Å; M21-F57 HydrophobicContact CG-CE2 3.44Å; M21-F57 VanDerWaalsContact CG-CE2 3.44Å; M21-F57 HydrophobicContact CG-CZ 4.21Å; M21-F57 HydrophobicContact SD-CD2 3.96Å; M21-F57 HydrophobicContact SD-CE1 4.24Å; M21-F57 HydrophobicContact SD-CE2 3.16Å; M21-F57 WeakPolarHBondContact SD-CE2 3.47Å; M21-F57 HydrophobicContact SD-CZ 3.31Å; M21-F57 WeakPolarHBondContact SD-CZ 3.5Å; G53-F57 WeakPolarHBondContact O-CB 3.4Å; G53-F57 PolarHBondContact O-N 3.43Å; L54-F57 PolarHBondContact O-N 3.13Å; F57-F59 PolarHBondContact O-N 2.99Å; F57-S60 PolarHBondContact O-N 3.12Å; F57-L61 HydrophobicContact CE1-CD1 3.8Å; F57-L61 HydrophobicContact CE2-CD1 4.43Å; F57-L61 HydrophobicContact CZ-CD1 3.7Å; F57-L61 WeakPolarHBondContact O-CB 3.35Å; F57-L61 PolarHBondContact O-N 2.99Å
58	L	88	Confident	84.7	Confident	89 Å²	89	67 Å²	67	47%	0.466	35%	0.353	S	S	.	.	H	α-helix	trans	-61.1	-44.5	177.2	-75.3	171	0	0	0	112	L54 P55 L61 I62	L54-L58 HydrophobicContact CD2-CD1 4.21Å; L54-L58 HydrophobicContact CG-CD1 4.4Å; L54-L58 WeakPolarHBondContact O-CB 3.48Å; L54-L58 WeakPolarHBondContact O-CG 3.36Å; L54-L58 PolarHBondContact O-N 3.42Å; P55-L58 PolarHBondContact O-N 3.35Å; L58-L61 PolarHBondContact O-N 3.26Å; L58-I62 VanDerWaalsContact O-CG1 3.27Å; L58-I62 WeakPolarHBondContact O-CG1 3.14Å; L58-I62 PolarHBondContact O-N 3.24Å
59	F	86.4	Confident	83.5	Confident	106 Å²	106	65.3 Å²	65.3	47%	0.465	35%	0.347	S	S	.	.	H	α-helix	trans	-60.2	-47.6	177	179.7	-99.1	0	0	0	111.2	L16 P55 F57 L61 I62 V63	L16-F59 HydrophobicContact CD2-CD1 4.39Å; P55-F59 VanDerWaalsContact O-CB 3.23Å; P55-F59 WeakPolarHBondContact O-CB 3.32Å; P55-F59 PolarHBondContact O-N 3.02Å; F57-F59 PolarHBondContact O-N 2.99Å; F59-L61 VanDerWaalsContact C-N 3.31Å; F59-L61 PolarHBondContact O-N 2.66Å; F59-I62 PolarHBondContact O-N 2.7Å; F59-V63 HydrophobicContact CD1-CG2 4.38Å; F59-V63 HydrophobicContact CE1-CG2 3.98Å; F59-V63 HydrophobicContact CE2-CG2 4.46Å; F59-V63 HydrophobicContact CZ-CG2 4.02Å; F59-V63 WeakPolarHBondContact O-CG2 3.17Å; F59-V63 PolarHBondContact O-N 3.45Å
60	S	83.7	Confident	82.1	Confident	0 Å²	0	66.9 Å²	66.9	0%	0	35%	0.354	C	S	.	.	H	α-helix	trans	-58.5	-42.6	174.8	164.8	0	0	0	0	112.4	L17 L56 F57 V63 F64	L17-S60 WeakPolarHBondContact CA-OG 3.22Å; L17-S60 WeakPolarHBondContact CB-OG 3.32Å; L17-S60 VanDerWaalsContact CD1-OG 3.24Å; L17-S60 WeakPolarHBondContact CD1-OG 3.23Å; L17-S60 PolarHBondContact N-OG 3.41Å; L56-S60 WeakPolarHBondContact O-CB 3.11Å; L56-S60 PolarHBondContact O-N 2.98Å; F57-S60 PolarHBondContact O-N 3.12Å; S60-V63 PolarHBondContact O-N 3.46Å; S60-F64 WeakPolarHBondContact O-CB 3.26Å; S60-F64 PolarHBondContact O-N 3.44Å
61	L	82.8	Confident	80.4	Confident	65 Å²	65	68.8 Å²	68.8	34%	0.34	36%	0.361	S	S	.	.	H	α-helix	trans	-65.9	-41.4	-180	-151.6	164.9	0	0	0	110.9	L17 F57 L58 F59 F64 C65	L17-L61 HydrophobicContact CD1-CB 4.31Å; L17-L61 HydrophobicContact CD1-CG 4.45Å; F57-L61 HydrophobicContact CE1-CD1 3.8Å; F57-L61 HydrophobicContact CE2-CD1 4.43Å; F57-L61 HydrophobicContact CZ-CD1 3.7Å; F57-L61 WeakPolarHBondContact O-CB 3.35Å; F57-L61 PolarHBondContact O-N 2.99Å; L58-L61 PolarHBondContact O-N 3.26Å; F59-L61 VanDerWaalsContact C-N 3.31Å; F59-L61 PolarHBondContact O-N 2.66Å; L61-F64 PolarHBondContact O-N 2.9Å; L61-C65 VanDerWaalsContact O-CB 3.32Å; L61-C65 WeakPolarHBondContact O-CB 3.5Å; L61-C65 PolarHBondContact O-N 3.27Å
62	I	85.2	Confident	78.1	Confident	105 Å²	105	68.6 Å²	68.6	54%	0.538	35%	0.354	S	S	.	.	H	α-helix	trans	-60.4	-48.9	174.3	-68.3	163.7	0	0	0	110.4	L58 F59 F64 C65 V66	L58-I62 VanDerWaalsContact O-CG1 3.27Å; L58-I62 WeakPolarHBondContact O-CG1 3.14Å; L58-I62 PolarHBondContact O-N 3.24Å; F59-I62 PolarHBondContact O-N 2.7Å; I62-F64 VanDerWaalsContact C-N 3.34Å; I62-F64 PolarHBondContact O-N 3.46Å; I62-C65 PolarHBondContact O-N 2.82Å; I62-V66 HydrophobicContact CG2-CG2 4.3Å; I62-V66 VanDerWaalsContact O-CG2 3.29Å; I62-V66 WeakPolarHBondContact O-CG2 3.46Å; I62-V66 PolarHBondContact O-N 2.92Å
63	V	81.7	Confident	76.1	Confident	22 Å²	22	68.2 Å²	68.2	13%	0.133	35%	0.351	C	S	.	.	H	α-helix	trans	-59.7	-46.3	178.1	173.3	0	0	0	0	110.6	Y7 D13 F59 S60 C65 V66 I67	Y7-V63 HydrophobicContact CD1-CG1 4.22Å; Y7-V63 HydrophobicContact CG-CG1 4.25Å; D13-V63 HydrophobicContact CB-CG1 4.25Å; F59-V63 HydrophobicContact CD1-CG2 4.38Å; F59-V63 HydrophobicContact CE1-CG2 3.98Å; F59-V63 HydrophobicContact CE2-CG2 4.46Å; F59-V63 HydrophobicContact CZ-CG2 4.02Å; F59-V63 WeakPolarHBondContact O-CG2 3.17Å; F59-V63 PolarHBondContact O-N 3.45Å; S60-V63 PolarHBondContact O-N 3.46Å; V63-C65 PolarHBondContact O-N 3.46Å; V63-V66 PolarHBondContact O-N 3.32Å; V63-I67 HydrophobicContact CG1-CD1 3.67Å; V63-I67 HydrophobicContact CG1-CG1 4.37Å; V63-I67 WeakPolarHBondContact O-CB 3.26Å; V63-I67 VanDerWaalsContact O-CG1 3.28Å; V63-I67 WeakPolarHBondContact O-CG1 3.4Å; V63-I67 PolarHBondContact O-N 3.37Å
64	F	80.4	Confident	74.2	Confident	68 Å²	68	75.5 Å²	75.5	30%	0.298	39%	0.385	S	S	.	.	H	α-helix	trans	-59.3	-45.4	176.5	-175.8	-99.6	0	0	0	111.8	S60 L61 I62 I67 R68	S60-F64 WeakPolarHBondContact O-CB 3.26Å; S60-F64 PolarHBondContact O-N 3.44Å; L61-F64 PolarHBondContact O-N 2.9Å; I62-F64 VanDerWaalsContact C-N 3.34Å; I62-F64 PolarHBondContact O-N 3.46Å; F64-I67 PolarHBondContact O-N 2.81Å; F64-R68 VanDerWaalsContact O-CB 3.31Å; F64-R68 WeakPolarHBondContact O-CB 3.28Å; F64-R68 PolarHBondContact O-N 3.09Å
65	C	79.8	Confident	72.1	Confident	60 Å²	60	75.7 Å²	75.7	41%	0.405	39%	0.39	S	S	.	.	H	α-helix	trans	-62.8	-41.6	176.2	-84.4	0	0	0	0	112.8	L61 I62 V63 R68 T69	L61-C65 VanDerWaalsContact O-CB 3.32Å; L61-C65 WeakPolarHBondContact O-CB 3.5Å; L61-C65 PolarHBondContact O-N 3.27Å; I62-C65 PolarHBondContact O-N 2.82Å; V63-C65 PolarHBondContact O-N 3.46Å; C65-R68 PolarHBondContact O-N 3.29Å; C65-T69 WeakPolarHBondContact O-CB 3.46Å; C65-T69 PolarHBondContact O-N 3.46Å; C65-T69 PolarHBondContact O-OG1 2.93Å
66	V	78.4	Confident	69.7	Low	68 Å²	68	77.3 Å²	77.3	41%	0.412	40%	0.395	S	S	.	.	H	α-helix	trans	-65.8	-46.1	178	170.4	0	0	0	0	110.6	I4 I62 V63 R68 T69 N70	I4-V66 HydrophobicContact CG2-CG1 4.5Å; I62-V66 HydrophobicContact CG2-CG2 4.3Å; I62-V66 VanDerWaalsContact O-CG2 3.29Å; I62-V66 WeakPolarHBondContact O-CG2 3.46Å; I62-V66 PolarHBondContact O-N 2.92Å; V63-V66 PolarHBondContact O-N 3.32Å; V66-R68 VanDerWaalsContact C-N 3.34Å; V66-R68 PolarHBondContact O-N 2.94Å; V66-T69 PolarHBondContact O-N 3.11Å; V66-N70 WeakPolarHBondContact O-CB 3.31Å; V66-N70 PolarHBondContact O-N 2.83Å
67	I	73.4	Confident	67.6	Low	18 Å²	18	79.2 Å²	79.2	9%	0.092	41%	0.411	C	S	.	.	H	α-helix	trans	-61.9	-44.2	177.3	-67.4	169.2	0	0	0	110.2	I4 D13 V63 F64 N71	I4-I67 HydrophobicContact CG2-CG1 4.45Å; D13-I67 HydrophobicContact CB-CD1 4.01Å; V63-I67 HydrophobicContact CG1-CD1 3.67Å; V63-I67 HydrophobicContact CG1-CG1 4.37Å; V63-I67 WeakPolarHBondContact O-CB 3.26Å; V63-I67 VanDerWaalsContact O-CG1 3.28Å; V63-I67 WeakPolarHBondContact O-CG1 3.4Å; V63-I67 PolarHBondContact O-N 3.37Å; F64-I67 PolarHBondContact O-N 2.81Å; I67-N71 PolarHBondContact O-N 3.27Å; I67-N71 PolarHBondContact O-ND2 3.06Å
68	R	70	Confident	65.4	Low	134 Å²	134	86 Å²	86	51%	0.506	44%	0.44	S	S	.	.	H	α-helix	trans	-68	-42.8	179.5	-145.7	-168.2	-179.5	-175.5	4.5	111.7	F64 C65 V66 N70 N71 Y72	F64-R68 VanDerWaalsContact O-CB 3.31Å; F64-R68 WeakPolarHBondContact O-CB 3.28Å; F64-R68 PolarHBondContact O-N 3.09Å; C65-R68 PolarHBondContact O-N 3.29Å; V66-R68 VanDerWaalsContact C-N 3.34Å; V66-R68 PolarHBondContact O-N 2.94Å; R68-N70 VanDerWaalsContact C-N 3.31Å; R68-N70 PolarHBondContact O-N 3.06Å; R68-N71 WeakPolarHBondContact O-CA 3.48Å; R68-N71 WeakPolarHBondContact O-CB 3.42Å; R68-N71 PolarHBondContact O-N 3.35Å; R68-Y72 HydrophobicContact CB-CE2 4.26Å; R68-Y72 HydrophobicContact CG-CD2 4.29Å; R68-Y72 HydrophobicContact CG-CE2 3.54Å; R68-Y72 VanDerWaalsContact CZ-OH 3.26Å; R68-Y72 PolarHBondContact NE-OH 3.4Å; R68-Y72 PolarHBondContact NH2-OH 3.01Å; R68-Y72 WeakPolarHBondContact O-CD2 3.5Å; R68-Y72 PolarHBondContact O-N 2.74Å; R68-Y72 VanDerWaalsContact O-N 3.13Å
69	T	66.9	Low	63.3	Low	86 Å²	86	90.3 Å²	90.3	53%	0.528	46%	0.458	S	S	.	.	H	α-helix	trans	-59.7	-41.1	177.5	-60.7	0	0	0	0	111.6	C65 V66 N71 Y72 T73	C65-T69 WeakPolarHBondContact O-CB 3.46Å; C65-T69 PolarHBondContact O-N 3.46Å; C65-T69 PolarHBondContact O-OG1 2.93Å; V66-T69 PolarHBondContact O-N 3.11Å; T69-N71 VanDerWaalsContact C-N 3.27Å; T69-N71 PolarHBondContact O-N 2.97Å; T69-Y72 PolarHBondContact O-N 3.38Å; T69-T73 PolarHBondContact O-N 3.4Å; T69-T73 VanDerWaalsContact O-N 3.11Å
70	N	62.1	Low	61.1	Low	80 Å²	80	95.1 Å²	95.1	43%	0.428	48%	0.475	S	S	.	.	H	α-helix	trans	-65.2	-31.3	176.3	-161.4	-3.7	0	0	0	112.3	V66 R68 Y72 T73	V66-N70 WeakPolarHBondContact O-CB 3.31Å; V66-N70 PolarHBondContact O-N 2.83Å; R68-N70 VanDerWaalsContact C-N 3.31Å; R68-N70 PolarHBondContact O-N 3.06Å; N70-Y72 VanDerWaalsContact C-N 3.32Å; N70-T73 WeakPolarHBondContact CA-OG1 2.99Å; N70-T73 PolarHBondContact O-OG1 3.03Å
71	N	53.2	Low	59.2	Low	63 Å²	63	100 Å²	100	34%	0.337	50%	0.504	S	S	.	.	H	α-helix	trans	-71.3	-25.3	170.6	-71.4	-70.2	0	0	0	112.8	R8 I67 R68 T69	R8-N71 PolarHBondContact NH2-OD1 3.16Å; I67-N71 PolarHBondContact O-N 3.27Å; I67-N71 PolarHBondContact O-ND2 3.06Å; R68-N71 WeakPolarHBondContact O-CA 3.48Å; R68-N71 WeakPolarHBondContact O-CB 3.42Å; R68-N71 PolarHBondContact O-N 3.35Å; T69-N71 VanDerWaalsContact C-N 3.27Å; T69-N71 PolarHBondContact O-N 2.97Å
72	Y	45	Very low	57.4	Low	112 Å²	112	105.6 Å²	105.6	44%	0.439	53%	0.533	S	S	.	.	H	α-helix	trans	-82.4	-24.2	177.7	-70.6	-67.7	0	0	0	114	R68 T69 N70 E74 V75 L76	R68-Y72 HydrophobicContact CB-CE2 4.26Å; R68-Y72 HydrophobicContact CG-CD2 4.29Å; R68-Y72 HydrophobicContact CG-CE2 3.54Å; R68-Y72 VanDerWaalsContact CZ-OH 3.26Å; R68-Y72 PolarHBondContact NE-OH 3.4Å; R68-Y72 PolarHBondContact NH2-OH 3.01Å; R68-Y72 WeakPolarHBondContact O-CD2 3.5Å; R68-Y72 PolarHBondContact O-N 2.74Å; R68-Y72 VanDerWaalsContact O-N 3.13Å; T69-Y72 PolarHBondContact O-N 3.38Å; N70-Y72 VanDerWaalsContact C-N 3.32Å; Y72-E74 PolarHBondContact O-N 3.13Å; Y72-E74 VanDerWaalsContact O-N 3.16Å; Y72-V75 PolarHBondContact O-N 3.16Å; Y72-L76 PolarHBondContact O-N 3.21Å
73	T	45.7	Very low	55.3	Low	83 Å²	83	103.9 Å²	103.9	51%	0.509	54%	0.542	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.3	-15	171.7	33.4	0	0	0	0	113.3	T69 N70 P77	T69-T73 PolarHBondContact O-N 3.4Å; T69-T73 VanDerWaalsContact O-N 3.11Å; N70-T73 WeakPolarHBondContact CA-OG1 2.99Å; N70-T73 PolarHBondContact O-OG1 3.03Å; T73-P77 WeakPolarHBondContact O-CD 3.26Å; T73-P77 VanDerWaalsContact O-CG 3.26Å; T73-P77 WeakPolarHBondContact O-CG 3.18Å
74	E	44.3	Very low	53.4	Low	153 Å²	153	111.7 Å²	111.7	72%	0.715	57%	0.574	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.9	-19.7	171.4	-66.2	-172.4	173.4	0	0	113.4	Y72	Y72-E74 PolarHBondContact O-N 3.13Å; Y72-E74 VanDerWaalsContact O-N 3.16Å
75	V	44.9	Very low	52.1	Low	105 Å²	105	115.9 Å²	115.9	64%	0.636	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	-97	-18.9	-174.6	-170.3	0	0	0	0	112.8	Y72	Y72-V75 PolarHBondContact O-N 3.16Å
76	L	37.6	Very low	50.8	Low	104 Å²	104	118 Å²	118	55%	0.545	61%	0.61	S	S	.	*	S	Bend	trans	-135.7	19.7	-173.6	-94.8	123.3	0	0	0	120.7	Y72 K78 Y80	Y72-L76 PolarHBondContact O-N 3.21Å; L76-K78 PolarHBondContact O-N 3.3Å; L76-Y80 HydrophobicContact CD2-CE2 4.41Å
77	P	42.8	Very low	49.5	Very low	101 Å²	101	120 Å²	120	66%	0.656	63%	0.625	S	S	*	*	S	Bend	trans	-84.1	15.1	169.3	36	-34.8	0	0	0	113.7	T73	T73-P77 WeakPolarHBondContact O-CD 3.26Å; T73-P77 VanDerWaalsContact O-CG 3.26Å; T73-P77 WeakPolarHBondContact O-CG 3.18Å
78	K	42.1	Very low	48.5	Very low	184 Å²	184	123.4 Å²	123.4	80%	0.8	65%	0.649	S	S	*	*	S	Bend	trans	-112.6	-0.5	-168.1	-102.4	-164.2	-178.1	-179.5	0	119.5	L76	L76-K78 PolarHBondContact O-N 3.3Å
79	Q	42	Very low	47.4	Very low	179 Å²	179	123.1 Å²	123.1	84%	0.836	66%	0.662	S	S	*	*	S	Bend	trans	-138.7	9.8	-173.8	-69.1	-166.1	-24.8	0	0	118.8	V81	Q79-V81 VanDerWaalsContact C-N 3.28Å; Q79-V81 PolarHBondContact O-N 3.33Å
80	Y	41.4	Very low	46.4	Very low	208 Å²	208	126.3 Å²	126.3	82%	0.816	67%	0.668	S	S	*	*			trans	-96.9	43.8	162.1	-51.4	-76	0	0	0	111.5	L76 L82	L76-Y80 HydrophobicContact CD2-CE2 4.41Å; Y80-L82 VanDerWaalsContact C-N 3.34Å; Y80-L82 PolarHBondContact O-N 3.45Å
81	V	43.9	Very low	45.6	Very low	102 Å²	102	128 Å²	128	62%	0.618	68%	0.682	S	S	*	*			trans	-86.9	90.4	157.1	-174.5	0	0	0	0	106	Q79 G83	Q79-V81 VanDerWaalsContact C-N 3.28Å; Q79-V81 PolarHBondContact O-N 3.33Å; V81-G83 PolarHBondContact O-N 2.83Å
82	L	44.1	Very low	45.2	Very low	182 Å²	182	130.3 Å²	130.3	95%	0.953	70%	0.703	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.6	90.8	158.9	-138.8	81.6	0	0	0	106.9	Y80	Y80-L82 VanDerWaalsContact C-N 3.34Å; Y80-L82 PolarHBondContact O-N 3.45Å
83	G	42.1	Very low	45.4	Very low	69 Å²	69	129.8 Å²	129.8	71%	0.711	71%	0.707	S	S	*	*	T	Hydrogen-bonded Turn	trans	145.5	-1.9	171.8	0	0	0	0	0	120.2	V81	V81-G83 PolarHBondContact O-N 2.83Å
84	K	41.5	Very low	45.3	Very low	186 Å²	186	130.4 Å²	130.4	81%	0.809	71%	0.712	S	S	*	*			trans	-159.5	78.1	171.7	-101.3	-179.3	-169.8	172.7	0	111.9	P86	K84-P86 VanDerWaalsContact O-CD 3.29Å; K84-P86 WeakPolarHBondContact O-CD 3.29Å
85	I	53.9	Low	45.8	Very low	157 Å²	157	129.4 Å²	129.4	81%	0.805	72%	0.722	S	S	*	*			trans	-82	110.8	159.1	-67	161.6	0	0	0	105.8
86	P	51.1	Low	46.1	Very low	103 Å²	103	128.5 Å²	128.5	67%	0.669	73%	0.725	S	S	*	*	P	Polyproline II helix	trans	-62.7	140.1	166.5	27	-31	0	0	0	108.1	K84	K84-P86 VanDerWaalsContact O-CD 3.29Å; K84-P86 WeakPolarHBondContact O-CD 3.29Å
87	P	52.1	Low	46.7	Very low	112 Å²	112	128.2 Å²	128.2	73%	0.727	72%	0.724	S	S	*	*	P	Polyproline II helix	trans	-57	141.3	-177.8	24	-32.7	0	0	0	109.7	T89	P87-T89 PolarHBondContact O-N 2.87Å; P87-T89 VanDerWaalsContact O-N 3.09Å
88	P	51.4	Low	47	Very low	89 Å²	89	125.9 Å²	125.9	58%	0.578	72%	0.719	S	S	*	*	P	Polyproline II helix	trans	-57	121.5	178.2	23.8	-32.5	0	0	0	108.8	F90	P88-F90 VanDerWaalsContact C-N 3.27Å; P88-F90 HydrophobicContact CB-CE2 4.43Å; P88-F90 HydrophobicContact CG-CD2 4.31Å; P88-F90 HydrophobicContact CG-CE2 3.73Å; P88-F90 HydrophobicContact CG-CZ 4.14Å; P88-F90 WeakPolarHBondContact O-CD2 3.34Å; P88-F90 PolarHBondContact O-N 3.09Å
89	T	47.6	Very low	47.6	Very low	127 Å²	127	121.8 Å²	121.8	78%	0.779	71%	0.713	S	S	*	*			trans	-66.5	94.2	170	-21	0	0	0	0	106.8	P87 T91	P87-T89 PolarHBondContact O-N 2.87Å; P87-T89 VanDerWaalsContact O-N 3.09Å; T89-T91 PolarHBondContact O-N 2.86Å
90	F	45.5	Very low	48.2	Very low	153 Å²	153	118.7 Å²	118.7	67%	0.671	70%	0.701	S	S	*	*			trans	-66.8	86.2	169	-73.2	-82.1	0	0	0	108.4	P88 S92 I93	P88-F90 VanDerWaalsContact C-N 3.27Å; P88-F90 HydrophobicContact CB-CE2 4.43Å; P88-F90 HydrophobicContact CG-CD2 4.31Å; P88-F90 HydrophobicContact CG-CE2 3.73Å; P88-F90 HydrophobicContact CG-CZ 4.14Å; P88-F90 WeakPolarHBondContact O-CD2 3.34Å; P88-F90 PolarHBondContact O-N 3.09Å; F90-S92 PolarHBondContact O-N 3.38Å; F90-I93 HydrophobicContact CB-CD1 3.88Å; F90-I93 HydrophobicContact CB-CG1 3.97Å; F90-I93 HydrophobicContact CD1-CD1 4.46Å; F90-I93 HydrophobicContact CD1-CG1 4.22Å; F90-I93 HydrophobicContact CG-CD1 4.09Å; F90-I93 HydrophobicContact CG-CG1 4.24Å
91	T	46.5	Very low	48.5	Very low	117 Å²	117	118.4 Å²	118.4	72%	0.718	70%	0.7	S	S	*	*	S	Bend	trans	-75.3	113.8	160.5	54.3	0	0	0	0	106.8	T89	T89-T91 PolarHBondContact O-N 2.86Å
92	S	44.2	Very low	48.6	Very low	111 Å²	111	122.1 Å²	122.1	78%	0.776	71%	0.71	S	S	*	*			trans	68.4	76.6	-178.7	68.7	0	0	0	0	117	F90	F90-S92 PolarHBondContact O-N 3.38Å
93	I	49.5	Very low	48.6	Very low	101 Å²	101	121 Å²	121	52%	0.518	73%	0.727	S	S	.	*			trans	-73.5	121.3	144.6	-65.1	158	0	0	0	106	F90 S95	F90-I93 HydrophobicContact CB-CD1 3.88Å; F90-I93 HydrophobicContact CB-CG1 3.97Å; F90-I93 HydrophobicContact CD1-CD1 4.46Å; F90-I93 HydrophobicContact CD1-CG1 4.22Å; F90-I93 HydrophobicContact CG-CD1 4.09Å; F90-I93 HydrophobicContact CG-CG1 4.24Å; I93-S95 PolarHBondContact O-N 3.28Å
94	P	43.9	Very low	48.9	Very low	95 Å²	95	123.6 Å²	123.6	62%	0.617	73%	0.728	S	S	*	*			trans	-61.6	127.6	168.1	24.9	-29.4	0	0	0	107.6	A96 L97	P94-A96 PolarHBondContact O-N 3.26Å; P94-L97 PolarHBondContact O-N 2.72Å
95	S	53.2	Low	49.3	Very low	133 Å²	133	120.3 Å²	120.3	93%	0.93	72%	0.724	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.4	15.7	-173.7	28	0	0	0	0	115.7	I93	I93-S95 PolarHBondContact O-N 3.28Å
96	A	52.3	Low	49	Very low	85 Å²	85	118.3 Å²	118.3	70%	0.702	72%	0.719	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.1	-10	174.7	0	0	0	0	0	114.1	P94	P94-A96 PolarHBondContact O-N 3.26Å
97	L	49.4	Very low	48.9	Very low	98 Å²	98	119.2 Å²	119.2	51%	0.513	72%	0.722	S	S	.	*	S	Bend	trans	-114.6	17.3	-173.8	-132.7	77.7	0	0	0	114.6	P94 I100	P94-L97 PolarHBondContact O-N 2.72Å; L97-I100 HydrophobicContact CD1-CD1 4.1Å; L97-I100 HydrophobicContact CG-CD1 4.18Å
98	G	48.5	Very low	48.7	Very low	53 Å²	53	119.6 Å²	119.6	55%	0.546	72%	0.722	S	S	.	*	S	Bend	trans	-81.5	-16.9	-179	0	0	0	0	0	115.2
99	S	54.9	Low	48.5	Very low	98 Å²	98	121.7 Å²	121.7	69%	0.685	73%	0.732	S	S	*	*	S	Bend	trans	-87.2	-10.6	-175.4	62.8	0	0	0	0	114.8
100	I	56.3	Low	48.6	Very low	114 Å²	114	121.3 Å²	121.3	59%	0.585	73%	0.728	S	S	*	*	S	Bend	trans	-88.4	-16.8	-173.2	-47.6	179.2	0	0	0	112	L97	L97-I100 HydrophobicContact CD1-CD1 4.1Å; L97-I100 HydrophobicContact CG-CD1 4.18Å
101	Y	46.5	Very low	48.8	Very low	201 Å²	201	118.8 Å²	118.8	79%	0.788	73%	0.733	S	S	*	*	S	Bend	trans	-103.4	6.3	-177.6	-73	-80.7	0	0	0	114.4
102	H	46.8	Very low	49	Very low	181 Å²	181	119 Å²	119	84%	0.838	73%	0.734	S	S	*	*			trans	-122.6	16.9	-176.9	-105	-64.4	0	0	0	114.9
103	A	42.8	Very low	49.4	Very low	158 Å²	158	119.7 Å²	119.7	100%	1.306	73%	0.73	S	S	*	*			trans	-119.3	0	171.5	0	0	0	0	0	111

Retrieved 103 of 103 residues in 103.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).