G4VIE3_SCHMA Loading...

Putative homeobox protein SMOX-4

AlphaFold DB , UniProt , Accession G4VIE3, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 35 aa.

						>G4VIE3_SCHMA|G4VIE3
MLSCKLNSFVYPLKELNNLYNPMLITFIQFKRFIS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.9	Low	62	Low	220 Å²	220	123.6 Å²	123.6	100%	1.084	64%	0.644	S	S	*	*				0	9.7	0	-143.8	160.6	172.2	0	0	114.1
2	L	55.6	Low	63.3	Low	141 Å²	141	118.3 Å²	118.3	74%	0.738	62%	0.623	S	S	*	*	H	α-helix	trans	-73.1	-31.4	179.7	-118.4	109.9	0	0	0	113.6	C4 K5 L6	L2-C4 PolarHBondContact O-N 3.32Å; L2-K5 PolarHBondContact O-N 3.44Å; L2-L6 PolarHBondContact O-N 2.9Å
3	S	57.6	Low	64.7	Low	85 Å²	85	117.6 Å²	117.6	59%	0.594	62%	0.619	S	S	*	*	H	α-helix	trans	-70	-28	-173	-30.3	0	0	0	0	113.8	N7	S3-N7 PolarHBondContact O-N 3.39Å; S3-N7 PolarHBondContact O-ND2 3.26Å; S3-N7 VanDerWaalsContact O-ND2 3.13Å
4	C	59.9	Low	66	Low	92 Å²	92	119 Å²	119	62%	0.622	62%	0.617	S	S	*	*	H	α-helix	trans	-68.7	-40.5	176.8	-171.1	0	0	0	0	111.4	L2 N7 S8	L2-C4 PolarHBondContact O-N 3.32Å; C4-N7 PolarHBondContact O-N 2.87Å; C4-S8 VanDerWaalsContact O-CB 3.27Å; C4-S8 WeakPolarHBondContact O-CB 3.39Å; C4-S8 PolarHBondContact O-N 3.3Å
5	K	61.1	Low	67.2	Low	150 Å²	150	119 Å²	119	65%	0.652	61%	0.613	S	S	*	*	H	α-helix	trans	-62.6	-47.8	176.1	-79.5	-178	176.2	-179.4	0	111.2	L2 N7 S8 F9	L2-K5 PolarHBondContact O-N 3.44Å; K5-N7 PolarHBondContact O-N 2.9Å; K5-S8 PolarHBondContact O-N 2.95Å; K5-F9 HydrophobicContact CB-CD2 4.33Å; K5-F9 HydrophobicContact CB-CE2 4.31Å; K5-F9 WeakPolarHBondContact O-CD2 3.33Å; K5-F9 PolarHBondContact O-N 3.26Å
6	L	60	Low	68.1	Low	108 Å²	108	116.9 Å²	116.9	57%	0.565	60%	0.603	S	S	*	*	H	α-helix	trans	-56.6	-50	178.4	-89.3	151.9	0	0	0	111.8	L2 S8 F9 V10	L2-L6 PolarHBondContact O-N 2.9Å; L6-S8 PolarHBondContact O-N 3.48Å; L6-F9 PolarHBondContact O-N 2.93Å; L6-V10 VanDerWaalsContact O-CB 3.28Å; L6-V10 WeakPolarHBondContact O-CB 3.41Å; L6-V10 WeakPolarHBondContact O-CG2 3.44Å; L6-V10 PolarHBondContact O-N 2.76Å
7	N	62.4	Low	68.8	Low	114 Å²	114	116.2 Å²	116.2	61%	0.61	60%	0.6	S	S	*	*	H	α-helix	trans	-65.5	-38.2	179.1	-71.5	-42.1	0	0	0	112.8	S3 C4 K5 V10 Y11	S3-N7 PolarHBondContact O-N 3.39Å; S3-N7 PolarHBondContact O-ND2 3.26Å; S3-N7 VanDerWaalsContact O-ND2 3.13Å; C4-N7 PolarHBondContact O-N 2.87Å; K5-N7 PolarHBondContact O-N 2.9Å; N7-V10 PolarHBondContact O-N 3.36Å; N7-Y11 PolarHBondContact O-N 3.3Å
8	S	61.9	Low	69.7	Low	79 Å²	79	115.9 Å²	115.9	55%	0.552	60%	0.6	S	S	*	*	H	α-helix	trans	-73.8	-24.2	179.7	-168.5	0	0	0	0	113.8	C4 K5 L6 P12	C4-S8 VanDerWaalsContact O-CB 3.27Å; C4-S8 WeakPolarHBondContact O-CB 3.39Å; C4-S8 PolarHBondContact O-N 3.3Å; K5-S8 PolarHBondContact O-N 2.95Å; L6-S8 PolarHBondContact O-N 3.48Å; S8-P12 WeakPolarHBondContact O-CD 3.39Å; S8-P12 WeakPolarHBondContact O-CG 3.45Å
9	F	67.4	Low	70.5	Confident	139 Å²	139	116.1 Å²	116.1	61%	0.61	60%	0.601	S	S	*	*	H	α-helix	trans	-82.4	-34.1	168.1	-77.5	-70.8	0	0	0	111.4	K5 L6 Y11 P12 L13	K5-F9 HydrophobicContact CB-CD2 4.33Å; K5-F9 HydrophobicContact CB-CE2 4.31Å; K5-F9 WeakPolarHBondContact O-CD2 3.33Å; K5-F9 PolarHBondContact O-N 3.26Å; L6-F9 PolarHBondContact O-N 2.93Å; F9-Y11 VanDerWaalsContact C-N 3.32Å; F9-Y11 PolarHBondContact O-N 3.41Å; F9-P12 VanDerWaalsContact O-CD 3.24Å; F9-P12 WeakPolarHBondContact O-CD 3.23Å; F9-P12 VanDerWaalsContact O-CG 3.26Å; F9-P12 WeakPolarHBondContact O-CG 3.49Å; F9-L13 WeakPolarHBondContact O-CB 3.26Å; F9-L13 VanDerWaalsContact O-CD1 3.31Å; F9-L13 WeakPolarHBondContact O-CD1 3.39Å; F9-L13 VanDerWaalsContact O-CG 3.29Å; F9-L13 WeakPolarHBondContact O-CG 2.85Å; F9-L13 PolarHBondContact O-N 3.26Å
10	V	69.9	Low	71.3	Confident	70 Å²	70	117.6 Å²	117.6	42%	0.424	60%	0.6	S	S	.	*	H	α-helix	trans	-67.9	-32.1	176.7	170.2	0	0	0	0	111.4	L6 N7 L13 K14	L6-V10 VanDerWaalsContact O-CB 3.28Å; L6-V10 WeakPolarHBondContact O-CB 3.41Å; L6-V10 WeakPolarHBondContact O-CG2 3.44Å; L6-V10 PolarHBondContact O-N 2.76Å; N7-V10 PolarHBondContact O-N 3.36Å; V10-L13 CarbonylContact O-C 3.59Å; V10-L13 PolarHBondContact O-N 2.88Å; V10-K14 WeakPolarHBondContact O-CA 3.23Å; V10-K14 WeakPolarHBondContact O-CB 3.37Å; V10-K14 PolarHBondContact O-N 3.39Å
11	Y	73.3	Confident	72	Confident	162 Å²	162	115.9 Å²	115.9	64%	0.635	59%	0.592	S	S	*	*	H	α-helix	trans	-60.8	-54.7	177.6	-158.7	-83.9	0	0	0	113.5	N7 F9 L13 K14 E15	N7-Y11 PolarHBondContact O-N 3.3Å; F9-Y11 VanDerWaalsContact C-N 3.32Å; F9-Y11 PolarHBondContact O-N 3.41Å; Y11-L13 VanDerWaalsContact C-N 3.3Å; Y11-L13 PolarHBondContact O-N 2.87Å; Y11-K14 PolarHBondContact O-N 3.25Å; Y11-E15 WeakPolarHBondContact O-CB 3.18Å; Y11-E15 PolarHBondContact O-N 3.4Å
12	P	78.1	Confident	73.7	Confident	60 Å²	60	108.4 Å²	108.4	39%	0.39	56%	0.56	S	S	.	*	H	α-helix	trans	-64.5	-35	175	25.5	-32.9	0	0	0	111.4	S8 F9 K14 E15 L16	S8-P12 WeakPolarHBondContact O-CD 3.39Å; S8-P12 WeakPolarHBondContact O-CG 3.45Å; F9-P12 VanDerWaalsContact O-CD 3.24Å; F9-P12 WeakPolarHBondContact O-CD 3.23Å; F9-P12 VanDerWaalsContact O-CG 3.26Å; F9-P12 WeakPolarHBondContact O-CG 3.49Å; P12-K14 PolarHBondContact O-N 2.91Å; P12-E15 PolarHBondContact O-N 2.86Å; P12-L16 WeakPolarHBondContact O-CB 3.4Å; P12-L16 WeakPolarHBondContact O-CD1 3.31Å; P12-L16 WeakPolarHBondContact O-CG 3.39Å; P12-L16 PolarHBondContact O-N 3.29Å
13	L	80.7	Confident	75.4	Confident	109 Å²	109	108.1 Å²	108.1	57%	0.571	56%	0.557	S	S	*	*	H	α-helix	trans	-63.2	-40	173.7	-78.6	164.2	0	0	0	112.5	F9 V10 Y11 N17	F9-L13 WeakPolarHBondContact O-CB 3.26Å; F9-L13 VanDerWaalsContact O-CD1 3.31Å; F9-L13 WeakPolarHBondContact O-CD1 3.39Å; F9-L13 VanDerWaalsContact O-CG 3.29Å; F9-L13 WeakPolarHBondContact O-CG 2.85Å; F9-L13 PolarHBondContact O-N 3.26Å; V10-L13 CarbonylContact O-C 3.59Å; V10-L13 PolarHBondContact O-N 2.88Å; Y11-L13 VanDerWaalsContact C-N 3.3Å; Y11-L13 PolarHBondContact O-N 2.87Å; L13-N17 VanDerWaalsContact O-CB 3.26Å; L13-N17 WeakPolarHBondContact O-CB 3.26Å; L13-N17 PolarHBondContact O-N 3.43Å
14	K	83.3	Confident	76.9	Confident	137 Å²	137	108.8 Å²	108.8	60%	0.596	55%	0.553	S	S	*	*	H	α-helix	trans	-72.3	-40.2	179.8	-171	175.2	-175.5	-177.5	0	110.8	V10 Y11 P12 N17 N18	V10-K14 WeakPolarHBondContact O-CA 3.23Å; V10-K14 WeakPolarHBondContact O-CB 3.37Å; V10-K14 PolarHBondContact O-N 3.39Å; Y11-K14 PolarHBondContact O-N 3.25Å; P12-K14 PolarHBondContact O-N 2.91Å; K14-N17 PolarHBondContact O-N 3.47Å; K14-N18 VanDerWaalsContact O-CB 3.3Å; K14-N18 WeakPolarHBondContact O-CB 3.47Å; K14-N18 PolarHBondContact O-N 3.44Å
15	E	84	Confident	78.3	Confident	119 Å²	119	108 Å²	108	56%	0.556	54%	0.542	S	S	*	.	H	α-helix	trans	-66.4	-43.2	174.8	-164.6	162.9	96.6	0	0	111.2	Y11 P12 N18 L19	Y11-E15 WeakPolarHBondContact O-CB 3.18Å; Y11-E15 PolarHBondContact O-N 3.4Å; P12-E15 PolarHBondContact O-N 2.86Å; E15-N18 PolarHBondContact O-N 2.82Å; E15-L19 WeakPolarHBondContact O-CB 3.3Å; E15-L19 PolarHBondContact O-N 3.3Å
16	L	80.9	Confident	79.8	Confident	85 Å²	85	105 Å²	105	45%	0.445	54%	0.536	S	S	.	.	H	α-helix	trans	-59.9	-47.1	171.6	-73.8	166.1	0	0	0	111.2	P12 N18 L19 Y20	P12-L16 WeakPolarHBondContact O-CB 3.4Å; P12-L16 WeakPolarHBondContact O-CD1 3.31Å; P12-L16 WeakPolarHBondContact O-CG 3.39Å; P12-L16 PolarHBondContact O-N 3.29Å; L16-N18 VanDerWaalsContact C-N 3.32Å; L16-N18 PolarHBondContact O-N 2.81Å; L16-L19 PolarHBondContact O-N 2.87Å; L16-L19 VanDerWaalsContact O-N 3.11Å; L16-Y20 HydrophobicContact CB-CD2 4.28Å; L16-Y20 HydrophobicContact CB-CE2 4.38Å; L16-Y20 HydrophobicContact CD2-CE2 3.96Å; L16-Y20 WeakPolarHBondContact O-CB 3.46Å; L16-Y20 WeakPolarHBondContact O-CD2 3.08Å; L16-Y20 PolarHBondContact O-N 2.83Å
17	N	80.9	Confident	81.3	Confident	105 Å²	105	105.6 Å²	105.6	56%	0.561	54%	0.535	S	S	*	.	H	α-helix	trans	-64.5	-38.7	178.5	-162.7	25.1	0	0	0	111.6	L13 K14 L19 Y20 N21	L13-N17 VanDerWaalsContact O-CB 3.26Å; L13-N17 WeakPolarHBondContact O-CB 3.26Å; L13-N17 PolarHBondContact O-N 3.43Å; K14-N17 PolarHBondContact O-N 3.47Å; N17-L19 VanDerWaalsContact C-N 3.27Å; N17-L19 PolarHBondContact O-N 3.47Å; N17-Y20 PolarHBondContact O-N 2.91Å; N17-N21 WeakPolarHBondContact O-CB 3.12Å; N17-N21 PolarHBondContact O-N 3.11Å
18	N	84.5	Confident	82.7	Confident	112 Å²	112	104.8 Å²	104.8	60%	0.599	53%	0.529	S	S	*	.	H	α-helix	trans	-64.6	-28.9	173.3	-94.6	15.9	0	0	0	113.1	K14 E15 L16 P22	K14-N18 VanDerWaalsContact O-CB 3.3Å; K14-N18 WeakPolarHBondContact O-CB 3.47Å; K14-N18 PolarHBondContact O-N 3.44Å; E15-N18 PolarHBondContact O-N 2.82Å; L16-N18 VanDerWaalsContact C-N 3.32Å; L16-N18 PolarHBondContact O-N 2.81Å; N18-P22 WeakPolarHBondContact O-CD 3.21Å; N18-P22 WeakPolarHBondContact O-CG 3.49Å
19	L	86.1	Confident	84.2	Confident	118 Å²	118	106.9 Å²	106.9	62%	0.618	53%	0.53	S	S	*	.	H	α-helix	trans	-81.2	-43.6	176	-172.1	69.1	0	0	0	111.6	E15 L16 N17 P22	E15-L19 WeakPolarHBondContact O-CB 3.3Å; E15-L19 PolarHBondContact O-N 3.3Å; L16-L19 PolarHBondContact O-N 2.87Å; L16-L19 VanDerWaalsContact O-N 3.11Å; N17-L19 VanDerWaalsContact C-N 3.27Å; N17-L19 PolarHBondContact O-N 3.47Å; L19-P22 WeakPolarHBondContact O-CD 3.08Å; L19-P22 WeakPolarHBondContact O-CG 3.13Å
20	Y	85.1	Confident	85.4	Confident	147 Å²	147	106.3 Å²	106.3	58%	0.576	53%	0.528	S	S	*	.	H	α-helix	trans	-73.4	-35.3	-178.8	-78.7	-66.6	0	0	0	113	L16 N17 M23 L24	L16-Y20 HydrophobicContact CB-CD2 4.28Å; L16-Y20 HydrophobicContact CB-CE2 4.38Å; L16-Y20 HydrophobicContact CD2-CE2 3.96Å; L16-Y20 WeakPolarHBondContact O-CB 3.46Å; L16-Y20 WeakPolarHBondContact O-CD2 3.08Å; L16-Y20 PolarHBondContact O-N 2.83Å; N17-Y20 PolarHBondContact O-N 2.91Å; Y20-M23 PolarHBondContact O-N 3.37Å; Y20-L24 VanDerWaalsContact O-CB 3.26Å; Y20-L24 WeakPolarHBondContact O-CB 3.28Å; Y20-L24 PolarHBondContact O-N 3.49Å
21	N	87.5	Confident	86.4	Confident	81 Å²	81	108.9 Å²	108.9	43%	0.433	53%	0.533	S	S	.	.	H	α-helix	trans	-59.1	-52.3	-178.9	-170.5	57.1	0	0	0	113.6	N17 M23 L24 I25	N17-N21 WeakPolarHBondContact O-CB 3.12Å; N17-N21 PolarHBondContact O-N 3.11Å; N21-M23 VanDerWaalsContact C-N 3.3Å; N21-M23 PolarHBondContact O-N 3.39Å; N21-L24 PolarHBondContact O-N 2.71Å; N21-I25 VanDerWaalsContact O-CG1 3.23Å; N21-I25 WeakPolarHBondContact O-CG1 3.29Å; N21-I25 PolarHBondContact O-N 2.88Å
22	P	88.4	Confident	87.2	Confident	64 Å²	64	111.1 Å²	111.1	42%	0.416	54%	0.54	S	S	.	.	H	α-helix	trans	-65.6	-33.5	176.9	26.5	-34.4	0	0	0	112.4	N18 L19 I25 T26	N18-P22 WeakPolarHBondContact O-CD 3.21Å; N18-P22 WeakPolarHBondContact O-CG 3.49Å; L19-P22 WeakPolarHBondContact O-CD 3.08Å; L19-P22 WeakPolarHBondContact O-CG 3.13Å; P22-I25 PolarHBondContact O-N 3.4Å; P22-T26 WeakPolarHBondContact O-CB 3.41Å; P22-T26 PolarHBondContact O-N 3.49Å; P22-T26 PolarHBondContact O-OG1 3.4Å
23	M	90.1	Very high	87.7	Confident	135 Å²	135	117 Å²	117	67%	0.665	56%	0.56	S	S	*	*	H	α-helix	trans	-66.2	-41.6	176.4	-156	175	-158.4	0	0	111.2	Y20 N21 T26 F27	Y20-M23 PolarHBondContact O-N 3.37Å; N21-M23 VanDerWaalsContact C-N 3.3Å; N21-M23 PolarHBondContact O-N 3.39Å; M23-T26 PolarHBondContact O-N 3.19Å; M23-F27 WeakPolarHBondContact O-CB 3.24Å; M23-F27 PolarHBondContact O-N 3.22Å
24	L	90.1	Very high	88.2	Confident	98 Å²	98	117.2 Å²	117.2	51%	0.513	56%	0.561	S	S	.	*	H	α-helix	trans	-64.8	-43.9	173.8	-174.9	69.2	0	0	0	111.3	Y20 N21 T26 F27 I28	Y20-L24 VanDerWaalsContact O-CB 3.26Å; Y20-L24 WeakPolarHBondContact O-CB 3.28Å; Y20-L24 PolarHBondContact O-N 3.49Å; N21-L24 PolarHBondContact O-N 2.71Å; L24-T26 VanDerWaalsContact C-N 3.33Å; L24-T26 PolarHBondContact O-N 2.84Å; L24-F27 PolarHBondContact O-N 2.84Å; L24-I28 HydrophobicContact CD1-CD1 4.39Å; L24-I28 HydrophobicContact CD2-CD1 4.48Å; L24-I28 HydrophobicContact CG-CD1 3.9Å; L24-I28 WeakPolarHBondContact O-CB 3.1Å; L24-I28 VanDerWaalsContact O-CG1 3.23Å; L24-I28 WeakPolarHBondContact O-CG1 3.31Å; L24-I28 PolarHBondContact O-N 2.89Å
25	I	89.7	Confident	87.6	Confident	75 Å²	75	118 Å²	118	39%	0.385	58%	0.583	S	S	.	*	H	α-helix	trans	-59.7	-46.2	175.5	-69.6	163.8	0	0	0	110.3	N21 P22 F27 I28 Q29	N21-I25 VanDerWaalsContact O-CG1 3.23Å; N21-I25 WeakPolarHBondContact O-CG1 3.29Å; N21-I25 PolarHBondContact O-N 2.88Å; P22-I25 PolarHBondContact O-N 3.4Å; I25-F27 VanDerWaalsContact C-N 3.32Å; I25-F27 PolarHBondContact O-N 3.13Å; I25-I28 PolarHBondContact O-N 3.49Å; I25-Q29 HydrophobicContact CG2-CG 4.39Å; I25-Q29 WeakPolarHBondContact O-CB 3.27Å; I25-Q29 WeakPolarHBondContact O-CG 3.26Å; I25-Q29 PolarHBondContact O-N 2.93Å
26	T	91.3	Very high	87.8	Confident	88 Å²	88	118 Å²	118	54%	0.54	59%	0.585	S	S	.	*	H	α-helix	trans	-60.3	-44.2	177.4	-56.7	0	0	0	0	110.7	P22 M23 L24 Q29 F30	P22-T26 WeakPolarHBondContact O-CB 3.41Å; P22-T26 PolarHBondContact O-N 3.49Å; P22-T26 PolarHBondContact O-OG1 3.4Å; M23-T26 PolarHBondContact O-N 3.19Å; L24-T26 VanDerWaalsContact C-N 3.33Å; L24-T26 PolarHBondContact O-N 2.84Å; T26-Q29 PolarHBondContact O-N 3.45Å; T26-F30 VanDerWaalsContact O-CB 3.31Å; T26-F30 WeakPolarHBondContact O-CB 3.46Å; T26-F30 PolarHBondContact O-N 3.25Å
27	F	93	Very high	88.2	Confident	121 Å²	121	119.7 Å²	119.7	53%	0.531	59%	0.592	S	S	.	*	H	α-helix	trans	-62.6	-43.8	177.2	-177.4	-98.8	0	0	0	112.4	M23 L24 I25 F30 K31	M23-F27 WeakPolarHBondContact O-CB 3.24Å; M23-F27 PolarHBondContact O-N 3.22Å; L24-F27 PolarHBondContact O-N 2.84Å; I25-F27 VanDerWaalsContact C-N 3.32Å; I25-F27 PolarHBondContact O-N 3.13Å; F27-F30 PolarHBondContact O-N 3.48Å; F27-K31 HydrophobicContact CD1-CG 4.33Å; F27-K31 HydrophobicContact CE1-CG 3.97Å; F27-K31 HydrophobicContact CZ-CD 4.49Å; F27-K31 HydrophobicContact CZ-CG 4.1Å; F27-K31 WeakPolarHBondContact O-CB 2.87Å; F27-K31 WeakPolarHBondContact O-CG 3.36Å; F27-K31 PolarHBondContact O-N 3.2Å
28	I	91.4	Very high	88.6	Confident	96 Å²	96	120.5 Å²	120.5	49%	0.492	59%	0.594	S	S	.	*	H	α-helix	trans	-64.3	-44.2	177.2	-68.4	165	0	0	0	110.7	L24 I25 K31 R32	L24-I28 HydrophobicContact CD1-CD1 4.39Å; L24-I28 HydrophobicContact CD2-CD1 4.48Å; L24-I28 HydrophobicContact CG-CD1 3.9Å; L24-I28 WeakPolarHBondContact O-CB 3.1Å; L24-I28 VanDerWaalsContact O-CG1 3.23Å; L24-I28 WeakPolarHBondContact O-CG1 3.31Å; L24-I28 PolarHBondContact O-N 2.89Å; I25-I28 PolarHBondContact O-N 3.49Å; I28-K31 PolarHBondContact O-N 3.31Å; I28-R32 WeakPolarHBondContact O-CB 3.09Å; I28-R32 PolarHBondContact O-N 3.4Å
29	Q	92.8	Very high	88.8	Confident	123 Å²	123	121 Å²	121	58%	0.575	59%	0.594	S	S	*	*	H	α-helix	trans	-62.9	-44	177.4	-74.5	179.2	-37.7	0	0	111.7	I25 T26 R32 F33	I25-Q29 HydrophobicContact CG2-CG 4.39Å; I25-Q29 WeakPolarHBondContact O-CB 3.27Å; I25-Q29 WeakPolarHBondContact O-CG 3.26Å; I25-Q29 PolarHBondContact O-N 2.93Å; T26-Q29 PolarHBondContact O-N 3.45Å; Q29-R32 PolarHBondContact O-N 3.42Å; Q29-F33 PolarHBondContact O-N 3.36Å
30	F	92.6	Very high	89	Confident	128 Å²	128	121.2 Å²	121.2	56%	0.561	59%	0.592	S	S	*	*	H	α-helix	trans	-61.8	-43.8	176.3	-173.8	-104	0	0	0	111.8	T26 F27 R32 F33 I34	T26-F30 VanDerWaalsContact O-CB 3.31Å; T26-F30 WeakPolarHBondContact O-CB 3.46Å; T26-F30 PolarHBondContact O-N 3.25Å; F27-F30 PolarHBondContact O-N 3.48Å; F30-R32 PolarHBondContact O-N 3.38Å; F30-F33 PolarHBondContact O-N 2.87Å; F30-I34 HydrophobicContact CD1-CD1 3.62Å; F30-I34 HydrophobicContact CD2-CD1 4.22Å; F30-I34 HydrophobicContact CE1-CD1 3.2Å; F30-I34 HydrophobicContact CE2-CD1 3.87Å; F30-I34 HydrophobicContact CG-CD1 4.12Å; F30-I34 HydrophobicContact CZ-CD1 3.36Å; F30-I34 WeakPolarHBondContact O-CG1 3.43Å; F30-I34 PolarHBondContact O-N 3.38Å
31	K	91.8	Very high	89.2	Confident	123 Å²	123	119.5 Å²	119.5	54%	0.535	59%	0.593	S	S	.	*	H	α-helix	trans	-62.5	-40.1	174.6	-77.8	-67.5	-170.5	-179.5	0	112.7	F27 I28 F33 S35	F27-K31 HydrophobicContact CD1-CG 4.33Å; F27-K31 HydrophobicContact CE1-CG 3.97Å; F27-K31 HydrophobicContact CZ-CD 4.49Å; F27-K31 HydrophobicContact CZ-CG 4.1Å; F27-K31 WeakPolarHBondContact O-CB 2.87Å; F27-K31 WeakPolarHBondContact O-CG 3.36Å; F27-K31 PolarHBondContact O-N 3.2Å; I28-K31 PolarHBondContact O-N 3.31Å; K31-F33 VanDerWaalsContact C-N 3.33Å; K31-S35 PolarHBondContact O-N 2.9Å
32	R	89.5	Confident	89.4	Confident	209 Å²	209	122.2 Å²	122.2	79%	0.789	61%	0.605	S	S	*	*	H	α-helix	trans	-69.2	-29.3	177.4	-177.9	176.3	169.1	-177.2	-3.1	113	I28 Q29 F30	I28-R32 WeakPolarHBondContact O-CB 3.09Å; I28-R32 PolarHBondContact O-N 3.4Å; Q29-R32 PolarHBondContact O-N 3.42Å; F30-R32 PolarHBondContact O-N 3.38Å
33	F	89.3	Confident	89.4	Confident	185 Å²	185	126.7 Å²	126.7	81%	0.811	62%	0.619	S	S	*	*	H	α-helix	trans	-77	-29.4	178.6	-175	-98.4	0	0	0	113	Q29 F30 K31	Q29-F33 PolarHBondContact O-N 3.36Å; F30-F33 PolarHBondContact O-N 2.87Å; K31-F33 VanDerWaalsContact C-N 3.33Å
34	I	90.2	Very high	89.4	Confident	112 Å²	112	126 Å²	126	57%	0.574	62%	0.615	S	S	*	*	H	α-helix	trans	-86.4	-22.8	-177.7	-65.2	167.6	0	0	0	112.6	F30	F30-I34 HydrophobicContact CD1-CD1 3.62Å; F30-I34 HydrophobicContact CD2-CD1 4.22Å; F30-I34 HydrophobicContact CE1-CD1 3.2Å; F30-I34 HydrophobicContact CE2-CD1 3.87Å; F30-I34 HydrophobicContact CG-CD1 4.12Å; F30-I34 HydrophobicContact CZ-CD1 3.36Å; F30-I34 WeakPolarHBondContact O-CG1 3.43Å; F30-I34 PolarHBondContact O-N 3.38Å
35	S	71.2	Confident	89.3	Confident	154 Å²	154	128.5 Å²	128.5	100%	1.077	63%	0.625	S	S	*	*			trans	-92	0	176.9	-165.3	0	0	0	0	112.2	K31	K31-S35 PolarHBondContact O-N 2.9Å

Retrieved 35 of 35 residues in 29.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).