G4VIH0_SCHMA Loading...

Smp_202480

AlphaFold DB , UniProt , Accession G4VIH0, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 55 aa.

						>G4VIH0_SCHMA|G4VIH0
MFYQVRPYYPASGSVATAQPNYVVPINTTSAWSVIDGSGNNMMHQQKISSLNPFH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.3	Low	51.8	Low	173 Å²	173	132.1 Å²	132.1	85%	0.852	63%	0.634	S	S	*	*				0	149.8	0	-81.6	127	170.9	0	0	107.2	I26	M1-I26 PolarHBondContact N-O 2.78Å; M1-I26 WeakPolarHBondContact O-CA 3.48Å; M1-I26 VanDerWaalsContact O-CB 3.29Å; M1-I26 WeakPolarHBondContact O-CB 3.37Å; M1-I26 PolarHBondContact O-N 2.87Å
2	F	49.8	Very low	51.4	Low	139 Å²	139	131.3 Å²	131.3	61%	0.61	65%	0.652	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-127.3	145.9	-176.9	-64.4	-70	0	0	0	108.9	V23 P25	F2-V23 HydrophobicContact CB-CG1 3.63Å; F2-V23 HydrophobicContact CD1-CB 4.41Å; F2-V23 HydrophobicContact CD1-CG1 2.98Å; F2-V23 HydrophobicContact CD2-CG1 3.93Å; F2-V23 HydrophobicContact CE1-CG1 3.46Å; F2-V23 VanDerWaalsContact CE1-CG1 3.46Å; F2-V23 HydrophobicContact CE2-CG1 4.34Å; F2-V23 HydrophobicContact CG-CG1 3.24Å; F2-V23 HydrophobicContact CZ-CG1 4.13Å; F2-P25 HydrophobicContact CD1-CB 4.35Å; F2-P25 VanDerWaalsContact CE1-CA 3.5Å; F2-P25 HydrophobicContact CE1-CB 3.82Å; F2-P25 HydrophobicContact CE1-CG 3.91Å
3	Y	48	Very low	50.9	Low	72 Å²	72	126.1 Å²	126.1	28%	0.282	65%	0.652	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-113.4	136.3	175.5	57.1	-57.5	0	0	0	108.3	V5 V24 I26	Y3-V5 HydrophobicContact CD2-CG2 4.12Å; Y3-V5 HydrophobicContact CE2-CG2 4.16Å; Y3-V24 WeakPolarHBondContact CD1-O 3.38Å; Y3-V24 HydrophobicContact CE1-CB 3.78Å; Y3-V24 HydrophobicContact CE1-CG1 3.95Å; Y3-V24 WeakPolarHBondContact CE1-O 3.45Å; Y3-I26 HydrophobicContact CD1-CB 4.39Å; Y3-I26 HydrophobicContact CD1-CD1 2.99Å; Y3-I26 HydrophobicContact CD1-CG1 3.1Å; Y3-I26 HydrophobicContact CD2-CD1 4.47Å; Y3-I26 HydrophobicContact CE1-CD1 3.65Å; Y3-I26 HydrophobicContact CE1-CG1 3.22Å; Y3-I26 HydrophobicContact CG-CD1 3.44Å; Y3-I26 VanDerWaalsContact CG-CD1 3.44Å; Y3-I26 HydrophobicContact CG-CG1 4.05Å
4	Q	51.5	Low	50.1	Low	159 Å²	159	125.5 Å²	125.5	74%	0.743	67%	0.665	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-85.4	116.2	-179.9	-163	175.7	-2.8	0	0	108.3	N21	Q4-N21 PolarHBondContact NE2-ND2 2.73Å
5	V	54	Low	49.5	Very low	65 Å²	65	124.9 Å²	124.9	39%	0.394	67%	0.667	S	S	.	*	P	Polyproline II helix	trans	-89.4	132.1	173.9	-168.5	0	0	0	0	108.2	Y3 P7	Y3-V5 HydrophobicContact CD2-CG2 4.12Å; Y3-V5 HydrophobicContact CE2-CG2 4.16Å; V5-P7 WeakPolarHBondContact O-CD 3.41Å
6	R	59.8	Low	48.9	Very low	233 Å²	233	124 Å²	124	88%	0.879	68%	0.683	S	S	*	*	P	Polyproline II helix	trans	-67.8	125.9	175.8	-86.3	-179.6	154.7	-152.7	-4.5	109.8	Y8	R6-Y8 PolarHBondContact O-N 3.2Å
7	P	53.9	Low	48.4	Very low	34 Å²	34	122.6 Å²	122.6	22%	0.221	68%	0.679	C	S	.	*	P	Polyproline II helix	trans	-49.6	133.9	169.8	-34.8	41.7	0	0	0	113.2	V5 Y9 Q19	V5-P7 WeakPolarHBondContact O-CD 3.41Å; P7-Y9 HydrophobicContact CB-CD2 4.38Å; P7-Y9 HydrophobicContact CB-CE1 4.19Å; P7-Y9 HydrophobicContact CB-CE2 3.77Å; P7-Y9 PolarHBondContact O-N 3.29Å; P7-Q19 VanDerWaalsContact CB-CD 3.5Å; P7-Q19 VanDerWaalsContact CB-OE1 3.31Å; P7-Q19 HydrophobicContact CG-CB 4.49Å
8	Y	52.4	Low	48.1	Very low	202 Å²	202	121.4 Å²	121.4	79%	0.792	69%	0.688	S	S	*	*			trans	-84.5	103.9	168.9	-153.9	-87	0	0	0	107.8	R6	R6-Y8 PolarHBondContact O-N 3.2Å
9	Y	54.6	Low	47.9	Very low	166 Å²	166	118.9 Å²	118.9	65%	0.651	67%	0.669	S	S	*	*	P	Polyproline II helix	trans	-85.9	126.6	170.8	-59	-75.3	0	0	0	108.4	P7 A11	P7-Y9 HydrophobicContact CB-CD2 4.38Å; P7-Y9 HydrophobicContact CB-CE1 4.19Å; P7-Y9 HydrophobicContact CB-CE2 3.77Å; P7-Y9 PolarHBondContact O-N 3.29Å; Y9-A11 PolarHBondContact O-N 3.03Å
10	P	47.1	Very low	47.8	Very low	108 Å²	108	117.4 Å²	117.4	70%	0.701	66%	0.664	S	S	*	*	P	Polyproline II helix	trans	-60.9	129.4	166.4	25.4	-30.4	0	0	0	108.1	S12	P10-S12 PolarHBondContact O-N 2.85Å
11	A	48.8	Very low	48	Very low	102 Å²	102	116.1 Å²	116.1	84%	0.843	66%	0.656	S	S	*	*	S	Bend	trans	-60	124.1	176.4	0	0	0	0	0	108.8	Y9	Y9-A11 PolarHBondContact O-N 3.03Å
12	S	46.2	Very low	48	Very low	123 Å²	123	116 Å²	116	86%	0.86	65%	0.648	S	S	*	*	S	Bend	trans	83	99.5	173.6	-150.7	0	0	0	0	116.4	P10	P10-S12 PolarHBondContact O-N 2.85Å
13	G	45.7	Very low	48.1	Very low	63 Å²	63	113.1 Å²	113.1	65%	0.649	64%	0.641	S	S	*	*			trans	90	127.8	146.8	0	0	0	0	0	116.2
14	S	39.1	Very low	48.5	Very low	118 Å²	118	112.3 Å²	112.3	83%	0.825	64%	0.643	S	S	*	*			trans	100	108.7	157.3	-34.9	0	0	0	0	116.7
15	V	40.6	Very low	48.8	Very low	117 Å²	117	107.3 Å²	107.3	71%	0.709	63%	0.625	S	S	*	*			trans	73.7	105.7	160.4	-156.5	0	0	0	0	116	T17	V15-T17 HydrophobicContact CB-CG2 4.2Å; V15-T17 HydrophobicContact CG1-CG2 3.51Å; V15-T17 PolarHBondContact O-N 3.11Å
16	A	41.3	Very low	49	Very low	110 Å²	110	105.8 Å²	105.8	91%	0.909	61%	0.614	S	S	*	*			trans	-60.5	71.8	153.4	0	0	0	0	0	109.4
17	T	39.9	Very low	48.8	Very low	101 Å²	101	98.8 Å²	98.8	62%	0.62	59%	0.594	S	S	*	*			trans	-78.8	117.8	155.5	56.6	0	0	0	0	104.3	V15 Q19	V15-T17 HydrophobicContact CB-CG2 4.2Å; V15-T17 HydrophobicContact CG1-CG2 3.51Å; V15-T17 PolarHBondContact O-N 3.11Å; T17-Q19 VanDerWaalsContact C-N 3.3Å; T17-Q19 PolarHBondContact O-N 3.41Å
18	A	43.6	Very low	49.1	Very low	101 Å²	101	99.9 Å²	99.9	84%	0.835	60%	0.6	S	S	*	*			trans	-55.1	101.6	172.3	0	0	0	0	0	107	P20	A18-P20 WeakPolarHBondContact O-CD 3.29Å
19	Q	43.6	Very low	49.5	Very low	73 Å²	73	93.8 Å²	93.8	34%	0.341	58%	0.584	S	S	.	*			trans	-63.9	124.9	-179.3	-171.6	-175.3	-61	0	0	106.4	P7 T17 N21	P7-Q19 VanDerWaalsContact CB-CD 3.5Å; P7-Q19 VanDerWaalsContact CB-OE1 3.31Å; P7-Q19 HydrophobicContact CG-CB 4.49Å; T17-Q19 VanDerWaalsContact C-N 3.3Å; T17-Q19 PolarHBondContact O-N 3.41Å; Q19-N21 PolarHBondContact O-N 3.3Å; Q19-N21 VanDerWaalsContact O-N 3.11Å
20	P	45.9	Very low	50.2	Low	88 Å²	88	88.4 Å²	88.4	57%	0.571	57%	0.571	S	S	*	*			trans	-59.7	124.6	177.8	23.3	-31.2	0	0	0	107.6	A18 Y22	A18-P20 WeakPolarHBondContact O-CD 3.29Å; P20-Y22 HydrophobicContact CG-CE2 4.24Å; P20-Y22 PolarHBondContact O-N 3.49Å
21	N	52	Low	51.3	Low	92 Å²	92	86.3 Å²	86.3	49%	0.492	56%	0.562	S	S	.	*			trans	-55.6	104.8	169.3	-89.8	26	0	0	0	107	Q4 Q19 V23	Q4-N21 PolarHBondContact NE2-ND2 2.73Å; Q19-N21 PolarHBondContact O-N 3.3Å; Q19-N21 VanDerWaalsContact O-N 3.11Å; N21-V23 HydrophobicContact CB-CG2 4.46Å; N21-V23 PolarHBondContact O-N 3.48Å
22	Y	49.4	Very low	52.8	Low	171 Å²	171	87.1 Å²	87.1	67%	0.671	54%	0.544	S	S	*	.			trans	-70.9	104.9	172.3	-96.7	-89	0	0	0	107.5	P20	P20-Y22 HydrophobicContact CG-CE2 4.24Å; P20-Y22 PolarHBondContact O-N 3.49Å
23	V	52.9	Low	54.6	Low	77 Å²	77	84.7 Å²	84.7	47%	0.467	53%	0.527	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.8	99.3	177.5	171.2	0	0	0	0	106.9	F2 N21	F2-V23 HydrophobicContact CB-CG1 3.63Å; F2-V23 HydrophobicContact CD1-CB 4.41Å; F2-V23 HydrophobicContact CD1-CG1 2.98Å; F2-V23 HydrophobicContact CD2-CG1 3.93Å; F2-V23 HydrophobicContact CE1-CG1 3.46Å; F2-V23 VanDerWaalsContact CE1-CG1 3.46Å; F2-V23 HydrophobicContact CE2-CG1 4.34Å; F2-V23 HydrophobicContact CG-CG1 3.24Å; F2-V23 HydrophobicContact CZ-CG1 4.13Å; N21-V23 HydrophobicContact CB-CG2 4.46Å; N21-V23 PolarHBondContact O-N 3.48Å
24	V	56.9	Low	56.4	Low	56 Å²	56	85.1 Å²	85.1	34%	0.339	52%	0.516	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.6	122.4	172.6	178.7	0	0	0	0	108.1	Y3 I26	Y3-V24 WeakPolarHBondContact CD1-O 3.38Å; Y3-V24 HydrophobicContact CE1-CB 3.78Å; Y3-V24 HydrophobicContact CE1-CG1 3.95Å; Y3-V24 WeakPolarHBondContact CE1-O 3.45Å; V24-I26 PolarHBondContact O-N 3.16Å; V24-I26 VanDerWaalsContact O-N 3.16Å
25	P	56.4	Low	58.7	Low	54 Å²	54	85.1 Å²	85.1	35%	0.351	51%	0.506	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-58	117.5	174.4	-18.4	28	0	0	0	111.6	F2 T28	F2-P25 HydrophobicContact CD1-CB 4.35Å; F2-P25 VanDerWaalsContact CE1-CA 3.5Å; F2-P25 HydrophobicContact CE1-CB 3.82Å; F2-P25 HydrophobicContact CE1-CG 3.91Å; P25-T28 HydrophobicContact CB-CG2 3.36Å; P25-T28 HydrophobicContact CG-CG2 4.02Å
26	I	58.2	Low	60.6	Low	33 Å²	33	81.6 Å²	81.6	17%	0.169	48%	0.483	C	S	.	.	T	Hydrogen-bonded Turn	trans	-81.3	132.2	162.6	-74.6	161.6	0	0	0	107.6	M1 Y3 V24 S50	M1-I26 PolarHBondContact N-O 2.78Å; M1-I26 WeakPolarHBondContact O-CA 3.48Å; M1-I26 VanDerWaalsContact O-CB 3.29Å; M1-I26 WeakPolarHBondContact O-CB 3.37Å; M1-I26 PolarHBondContact O-N 2.87Å; Y3-I26 HydrophobicContact CD1-CB 4.39Å; Y3-I26 HydrophobicContact CD1-CD1 2.99Å; Y3-I26 HydrophobicContact CD1-CG1 3.1Å; Y3-I26 HydrophobicContact CD2-CD1 4.47Å; Y3-I26 HydrophobicContact CE1-CD1 3.65Å; Y3-I26 HydrophobicContact CE1-CG1 3.22Å; Y3-I26 HydrophobicContact CG-CD1 3.44Å; Y3-I26 VanDerWaalsContact CG-CD1 3.44Å; Y3-I26 HydrophobicContact CG-CG1 4.05Å; V24-I26 PolarHBondContact O-N 3.16Å; V24-I26 VanDerWaalsContact O-N 3.16Å; I26-S50 WeakPolarHBondContact CD1-OG 3.48Å
27	N	56.8	Low	62.4	Low	86 Å²	86	81 Å²	81	46%	0.46	49%	0.487	S	S	.	.	T	Hydrogen-bonded Turn	trans	78.2	28.1	178.5	-41.4	-41.1	0	0	0	115.2	T29	N27-T29 PolarHBondContact O-N 3.17Å
28	T	58.8	Low	64.8	Low	56 Å²	56	80.5 Å²	80.5	34%	0.344	49%	0.488	S	S	.	.			trans	-70.9	104.2	162.2	44.2	0	0	0	0	108.5	P25 S30	P25-T28 HydrophobicContact CB-CG2 3.36Å; P25-T28 HydrophobicContact CG-CG2 4.02Å; T28-S30 VanDerWaalsContact C-N 3.32Å; T28-S30 PolarHBondContact O-N 3.19Å; T28-S30 VanDerWaalsContact O-N 3.09Å
29	T	61.1	Low	66.8	Low	74 Å²	74	78.3 Å²	78.3	45%	0.454	48%	0.475	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.2	94.7	163.3	-33.9	0	0	0	0	106.5	N27 A31 Q45	N27-T29 PolarHBondContact O-N 3.17Å; T29-A31 PolarHBondContact O-N 3.06Å; T29-Q45 HydrophobicContact CG2-CB 4.13Å; T29-Q45 HydrophobicContact CG2-CG 4.24Å
30	S	69.3	Low	68.6	Low	54 Å²	54	79.4 Å²	79.4	38%	0.378	48%	0.483	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.3	109.7	169.5	-71.4	0	0	0	0	106.9	T28 Q46	T28-S30 VanDerWaalsContact C-N 3.32Å; T28-S30 PolarHBondContact O-N 3.19Å; T28-S30 VanDerWaalsContact O-N 3.09Å; S30-Q46 PolarHBondContact N-O 3.07Å; S30-Q46 PolarHBondContact O-N 2.82Å
31	A	71.4	Confident	70.5	Confident	63 Å²	63	80 Å²	80	52%	0.521	48%	0.482	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	129.1	174.9	0	0	0	0	0	109.2	T29 H44 Q45	T29-A31 PolarHBondContact O-N 3.06Å; A31-H44 CarbonylContact C-O 3.59Å; A31-H44 VanDerWaalsContact CA-O 3.22Å; A31-H44 WeakPolarHBondContact CA-O 3.34Å; A31-Q45 HydrophobicContact CB-CG 4.04Å
32	W	79.2	Confident	72	Confident	120 Å²	120	80.1 Å²	80.1	46%	0.455	48%	0.481	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131	148.2	169.9	65.4	91.9	0	0	0	109.9	H44 Q46	W32-H44 HydrophobicContact CD2-CB 4.17Å; W32-H44 HydrophobicContact CZ2-CB 3.86Å; W32-H44 PolarHBondContact N-O 3.09Å; W32-H44 PolarHBondContact O-N 2.95Å; W32-Q46 HydrophobicContact CH2-CB 4.02Å; W32-Q46 HydrophobicContact CZ3-CB 3.77Å
33	S	83.8	Confident	73.5	Confident	72 Å²	72	78.2 Å²	78.2	50%	0.503	48%	0.479	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	134.9	174.4	49.8	0	0	0	0	110.3	N41 M42	S33-N41 WeakPolarHBondContact CB-OD1 3.23Å; S33-M42 WeakPolarHBondContact CA-O 3.44Å
34	V	84.7	Confident	74.8	Confident	71 Å²	71	79.5 Å²	79.5	43%	0.43	48%	0.48	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.9	124.7	167.2	-177.9	0	0	0	0	107.4	M42	V34-M42 PolarHBondContact N-O 2.81Å; V34-M42 PolarHBondContact O-N 2.89Å
35	I	86.7	Confident	75.7	Confident	118 Å²	118	83.1 Å²	83.1	61%	0.605	49%	0.493	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-86.5	121.2	168.4	-57	-179.1	0	0	0	106.8	N40	I35-N40 WeakPolarHBondContact CA-O 3.41Å
36	D	80.1	Confident	76.2	Confident	44 Å²	44	85.2 Å²	85.2	24%	0.235	50%	0.498	C	S	.	.			trans	-78	168.8	175.2	70.2	23.3	0	0	0	112.1	S38 G39 N40 M42	D36-S38 PolarHBondContact O-N 3Å; D36-S38 VanDerWaalsContact O-N 3.07Å; D36-S38 WeakPolarHBondContact OD1-CA 3.22Å; D36-S38 WeakPolarHBondContact OD1-CB 3.05Å; D36-S38 PolarHBondContact OD1-N 3.43Å; D36-S38 PolarHBondContact OD1-OG 2.94Å; D36-S38 PolarHBondContact OD2-OG 3.3Å; D36-G39 PolarHBondContact O-N 2.99Å; D36-G39 PolarHBondContact OD1-N 3.26Å; D36-G39 VanDerWaalsContact OD1-N 3.08Å; D36-N40 PolarHBondContact N-O 3.45Å; D36-N40 PolarHBondContact OD1-N 2.91Å; D36-M42 HydrophobicContact CB-CE 4.18Å
37	G	80.2	Confident	76.7	Confident	96 Å²	96	91.7 Å²	91.7	99%	0.99	53%	0.525	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.2	-11	-179.7	0	0	0	0	0	114.6
38	S	90.4	Very high	76.9	Confident	91 Å²	91	91 Å²	91	64%	0.636	52%	0.521	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.3	-0.3	172.2	32.5	0	0	0	0	113.3	D36 N40	D36-S38 PolarHBondContact O-N 3Å; D36-S38 VanDerWaalsContact O-N 3.07Å; D36-S38 WeakPolarHBondContact OD1-CA 3.22Å; D36-S38 WeakPolarHBondContact OD1-CB 3.05Å; D36-S38 PolarHBondContact OD1-N 3.43Å; D36-S38 PolarHBondContact OD1-OG 2.94Å; D36-S38 PolarHBondContact OD2-OG 3.3Å; S38-N40 PolarHBondContact OG-ND2 2.84Å
39	G	85	Confident	77.1	Confident	55 Å²	55	92.2 Å²	92.2	57%	0.567	53%	0.532	S	S	*	.	S	Bend	trans	85.3	5.2	178.8	0	0	0	0	0	114.4	D36	D36-G39 PolarHBondContact O-N 2.99Å; D36-G39 PolarHBondContact OD1-N 3.26Å; D36-G39 VanDerWaalsContact OD1-N 3.08Å
40	N	80.5	Confident	77	Confident	96 Å²	96	91 Å²	91	51%	0.513	53%	0.526	S	S	.	.			trans	-82.3	137.8	178.4	-60.4	-52.2	0	0	0	110.6	I35 D36 S38	I35-N40 WeakPolarHBondContact CA-O 3.41Å; D36-N40 PolarHBondContact N-O 3.45Å; D36-N40 PolarHBondContact OD1-N 2.91Å; S38-N40 PolarHBondContact OG-ND2 2.84Å
41	N	86.4	Confident	76.3	Confident	101 Å²	101	95.4 Å²	95.4	54%	0.54	55%	0.545	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.4	110.3	177.8	-170.8	-36.3	0	0	0	110.3	S33	S33-N41 WeakPolarHBondContact CB-OD1 3.23Å
42	M	83.5	Confident	75.4	Confident	95 Å²	95	95.8 Å²	95.8	47%	0.468	54%	0.538	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.4	110.8	172.1	-71.6	-165.1	-76.8	0	0	110.4	S33 V34 D36	S33-M42 WeakPolarHBondContact CA-O 3.44Å; V34-M42 PolarHBondContact N-O 2.81Å; V34-M42 PolarHBondContact O-N 2.89Å; D36-M42 HydrophobicContact CB-CE 4.18Å
43	M	81.4	Confident	74.2	Confident	130 Å²	130	95.6 Å²	95.6	64%	0.64	55%	0.552	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-87.9	125	177	-157.1	-157.6	-56.4	0	0	110.5
44	H	80.3	Confident	72.7	Confident	104 Å²	104	99.8 Å²	99.8	48%	0.481	56%	0.562	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-111.3	134.6	172.6	-91.7	68.7	0	0	0	110.3	A31 W32	A31-H44 CarbonylContact C-O 3.59Å; A31-H44 VanDerWaalsContact CA-O 3.22Å; A31-H44 WeakPolarHBondContact CA-O 3.34Å; W32-H44 HydrophobicContact CD2-CB 4.17Å; W32-H44 HydrophobicContact CZ2-CB 3.86Å; W32-H44 PolarHBondContact N-O 3.09Å; W32-H44 PolarHBondContact O-N 2.95Å
45	Q	75.5	Confident	70.6	Confident	133 Å²	133	107.1 Å²	107.1	62%	0.621	59%	0.591	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-117.7	122.3	173.3	-70.5	-178.4	36.2	0	0	109.5	T29 A31	T29-Q45 HydrophobicContact CG2-CB 4.13Å; T29-Q45 HydrophobicContact CG2-CG 4.24Å; A31-Q45 HydrophobicContact CB-CG 4.04Å
46	Q	67.7	Low	69.8	Low	97 Å²	97	106.6 Å²	106.6	45%	0.453	59%	0.59	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-100.3	117.9	170.5	-173.8	179.4	26.5	0	0	109.3	S30 W32 I48	S30-Q46 PolarHBondContact N-O 3.07Å; S30-Q46 PolarHBondContact O-N 2.82Å; W32-Q46 HydrophobicContact CH2-CB 4.02Å; W32-Q46 HydrophobicContact CZ3-CB 3.77Å; Q46-I48 HydrophobicContact CG-CG1 4.19Å
47	K	68.2	Low	69.2	Low	169 Å²	169	109.8 Å²	109.8	74%	0.735	61%	0.609	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-88.8	115.9	161.6	-100.5	-162.8	177.5	-173.8	0	108.8	S49	K47-S49 PolarHBondContact O-N 3.49Å
48	I	60.9	Low	68.6	Low	73 Å²	73	110.6 Å²	110.6	37%	0.374	59%	0.587	S	S	.	*			trans	-86.6	105.1	166.5	-55.1	179.7	0	0	0	106.9	Q46	Q46-I48 HydrophobicContact CG-CG1 4.19Å
49	S	62.7	Low	67.3	Low	81 Å²	81	111.8 Å²	111.8	57%	0.566	59%	0.585	S	S	*	*			trans	-82.4	132	164.6	48.3	0	0	0	0	108.1	K47 L51	K47-S49 PolarHBondContact O-N 3.49Å; S49-L51 PolarHBondContact O-N 2.9Å
50	S	58.4	Low	66.2	Low	48 Å²	48	115.3 Å²	115.3	34%	0.336	59%	0.586	S	S	.	*			trans	-71.7	73.7	167.2	63.4	0	0	0	0	108.7	I26 N52	I26-S50 WeakPolarHBondContact CD1-OG 3.48Å; S50-N52 PolarHBondContact O-N 3.08Å
51	L	55.9	Low	65.3	Low	147 Å²	147	116.6 Å²	116.6	77%	0.77	59%	0.59	S	S	*	*			trans	-67.1	99.3	154	-91.3	131.9	0	0	0	104.6	S49 P53	S49-L51 PolarHBondContact O-N 2.9Å; L51-P53 VanDerWaalsContact O-CD 3.23Å; L51-P53 WeakPolarHBondContact O-CD 3.35Å
52	N	51.6	Low	63.8	Low	71 Å²	71	117.7 Å²	117.7	38%	0.38	59%	0.594	S	S	.	*			trans	-50.2	115.3	169.4	179.4	3	0	0	0	106.9	S50 F54 H55	S50-N52 PolarHBondContact O-N 3.08Å; N52-F54 PolarHBondContact O-N 2.99Å; N52-F54 WeakPolarHBondContact OD1-CB 3.39Å; N52-F54 WeakPolarHBondContact OD1-CD2 3.41Å; N52-F54 PolarHBondContact OD1-N 2.61Å; N52-F54 VanDerWaalsContact OD1-N 3.17Å; N52-H55 PolarHBondContact ND2-CD2 2.91Å; N52-H55 PolarHBondContact O-N 3.21Å
53	P	55.1	Low	62.3	Low	116 Å²	116	119.5 Å²	119.5	75%	0.753	60%	0.604	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.1	3.3	-178.2	27.7	-33.7	0	0	0	113.1	L51	L51-P53 VanDerWaalsContact O-CD 3.23Å; L51-P53 WeakPolarHBondContact O-CD 3.35Å
54	F	52	Low	60.7	Low	160 Å²	160	118.6 Å²	118.6	70%	0.702	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	-108.2	17.1	-179.1	-59.3	-71.1	0	0	0	114.8	N52	N52-F54 PolarHBondContact O-N 2.99Å; N52-F54 WeakPolarHBondContact OD1-CB 3.39Å; N52-F54 WeakPolarHBondContact OD1-CD2 3.41Å; N52-F54 PolarHBondContact OD1-N 2.61Å; N52-F54 VanDerWaalsContact OD1-N 3.17Å
55	H	39.5	Very low	58.9	Low	224 Å²	224	119.9 Å²	119.9	100%	1.037	61%	0.612	S	S	*	*			trans	-130.6	0	170.1	-72.6	-62.2	0	0	0	112.4	N52	N52-H55 PolarHBondContact ND2-CD2 2.91Å; N52-H55 PolarHBondContact O-N 3.21Å

Retrieved 55 of 55 residues in 60.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).