G4VIK8_SCHMA Loading...

60S ribosomal protein L29

AlphaFold DB , UniProt , Accession G4VIK8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 69 aa.

						>G4VIK8_SCHMA|G4VIK8
MAKSKNHTSHNQNRKQHRNGIHKPKKQRYPSLKGVDPKFLRNMRFAKKHNKRGNKNVQPEVTPAVPECK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	80.8	Confident	92.9	Very high	242 Å²	242	136.3 Å²	136.3	100%	1.192	72%	0.72	S	S	*	*				0	121.8	0	-170.8	144.1	-171.6	0	0	108.9
2	A	87.8	Confident	93.1	Very high	97 Å²	97	130.8 Å²	130.8	80%	0.802	69%	0.688	S	S	*	*			trans	-81.2	136	176.9	0	0	0	0	0	109.9
3	K	93.5	Very high	93.3	Very high	209 Å²	209	128.3 Å²	128.3	91%	0.909	68%	0.675	S	S	*	*			trans	-77.5	137.1	176.4	-63	-169.5	-65.5	-174.6	0	109.9
4	S	94.2	Very high	93.5	Very high	102 Å²	102	129 Å²	129	71%	0.713	66%	0.664	S	S	*	*			trans	-106.7	174.9	172.8	63.3	0	0	0	0	111.1
5	K	94.2	Very high	93.6	Very high	163 Å²	163	126.7 Å²	126.7	71%	0.709	65%	0.648	S	S	*	*			trans	-72.6	131.5	175.6	-175.5	168.7	-166.4	151	0	110.5	H7	K5-H7 WeakPolarHBondContact CE-O 3.43Å
6	N	91.8	Very high	93.8	Very high	161 Å²	161	125.1 Å²	125.1	86%	0.861	64%	0.636	S	S	*	*			trans	-82.5	-30.9	-176.2	-60	-31.8	0	0	0	114.1
7	H	96.6	Very high	94	Very high	156 Å²	156	124.4 Å²	124.4	72%	0.722	63%	0.63	S	S	*	*			trans	-158.3	146.5	-177	-179.6	70.2	0	0	0	113.3	K5	K5-H7 WeakPolarHBondContact CE-O 3.43Å
8	T	95.6	Very high	94.1	Very high	71 Å²	71	126.6 Å²	126.6	44%	0.436	63%	0.629	S	S	.	*			trans	-153.9	140.7	168.8	-171.9	0	0	0	0	113.8	H10	T8-H10 WeakPolarHBondContact OG1-CB 3.22Å; T8-H10 PolarHBondContact OG1-N 3.06Å
9	S	95.3	Very high	94	Very high	68 Å²	68	127.3 Å²	127.3	48%	0.476	64%	0.635	S	S	.	*			trans	-105.6	11.7	170.4	-163	0	0	0	0	113.3	N11 Q12	S9-N11 VanDerWaalsContact C-N 3.28Å; S9-N11 PolarHBondContact O-N 3.12Å; S9-Q12 WeakPolarHBondContact O-CG 3.41Å; S9-Q12 PolarHBondContact O-N 3.31Å; S9-Q12 VanDerWaalsContact O-N 3.08Å; S9-Q12 WeakPolarHBondContact OG-CG 3.07Å
10	H	96.8	Very high	94	Very high	175 Å²	175	122.6 Å²	122.6	81%	0.81	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.6	-37.3	-165.4	-178.4	62.9	0	0	0	114.9	T8	T8-H10 WeakPolarHBondContact OG1-CB 3.22Å; T8-H10 PolarHBondContact OG1-N 3.06Å
11	N	95.4	Very high	94	Very high	55 Å²	55	122.1 Å²	122.1	29%	0.294	62%	0.619	S	S	.	*	T	Hydrogen-bonded Turn	trans	-109.2	9.9	-176.7	-171.9	38.8	0	0	0	113.8	S9 R14 K15	S9-N11 VanDerWaalsContact C-N 3.28Å; S9-N11 PolarHBondContact O-N 3.12Å; N11-R14 VanDerWaalsContact CG-NH2 3.32Å; N11-R14 PolarHBondContact ND2-NH2 3.28Å; N11-R14 PolarHBondContact OD1-NE 3.46Å; N11-R14 PolarHBondContact OD1-NH2 3.29Å; N11-K15 WeakPolarHBondContact O-CE 3.25Å; N11-K15 WeakPolarHBondContact O-CG 3.46Å; N11-K15 PolarHBondContact O-N 3.07Å
12	Q	95.5	Very high	94.7	Very high	71 Å²	71	118.3 Å²	118.3	33%	0.332	60%	0.598	S	S	.	*	H	α-helix	trans	-73.8	-48.9	-173.7	-52.1	-55.1	-20.9	0	0	111.2	S9 R14 K15 Q16	S9-Q12 WeakPolarHBondContact O-CG 3.41Å; S9-Q12 PolarHBondContact O-N 3.31Å; S9-Q12 VanDerWaalsContact O-N 3.08Å; S9-Q12 WeakPolarHBondContact OG-CG 3.07Å; Q12-R14 VanDerWaalsContact C-N 3.33Å; Q12-R14 PolarHBondContact O-N 2.95Å; Q12-K15 PolarHBondContact O-N 3.25Å; Q12-K15 VanDerWaalsContact O-N 3.14Å; Q12-Q16 WeakPolarHBondContact O-CG 3.28Å; Q12-Q16 PolarHBondContact O-N 3.47Å; Q12-Q16 PolarHBondContact O-OE1 2.97Å
13	N	95.2	Very high	95.1	Very high	98 Å²	98	122.8 Å²	122.8	52%	0.524	60%	0.599	S	S	.	*	H	α-helix	trans	-57.3	-43.8	178	-77	-53.9	0	0	0	112.5	K15 Q16 H17	N13-K15 VanDerWaalsContact C-N 3.35Å; N13-K15 PolarHBondContact O-N 3.13Å; N13-Q16 PolarHBondContact O-N 3.21Å; N13-H17 PolarHBondContact O-N 3.09Å; N13-H17 PolarHBondContact O-ND1 3.19Å
14	R	96.2	Very high	95.2	Very high	138 Å²	138	118.5 Å²	118.5	52%	0.521	59%	0.592	S	S	.	*	H	α-helix	trans	-62	-42.4	178.5	-172.1	-178.5	63.1	124.4	0.3	111.6	N11 Q12 R18	N11-R14 VanDerWaalsContact CG-NH2 3.32Å; N11-R14 PolarHBondContact ND2-NH2 3.28Å; N11-R14 PolarHBondContact OD1-NE 3.46Å; N11-R14 PolarHBondContact OD1-NH2 3.29Å; Q12-R14 VanDerWaalsContact C-N 3.33Å; Q12-R14 PolarHBondContact O-N 2.95Å; R14-R18 VanDerWaalsContact CZ-NH2 3.3Å; R14-R18 WeakPolarHBondContact O-CG 3.34Å; R14-R18 PolarHBondContact O-N 3.21Å; R14-R18 VanDerWaalsContact O-N 3.1Å
15	K	95.9	Very high	95.2	Very high	95 Å²	95	122.8 Å²	122.8	41%	0.413	60%	0.598	S	S	.	*	H	α-helix	trans	-65.8	-42.7	176.6	-72	-176.4	-61.6	169	0	112.2	N11 Q12 N13 H17 R18	N11-K15 WeakPolarHBondContact O-CE 3.25Å; N11-K15 WeakPolarHBondContact O-CG 3.46Å; N11-K15 PolarHBondContact O-N 3.07Å; Q12-K15 PolarHBondContact O-N 3.25Å; Q12-K15 VanDerWaalsContact O-N 3.14Å; N13-K15 VanDerWaalsContact C-N 3.35Å; N13-K15 PolarHBondContact O-N 3.13Å; K15-H17 VanDerWaalsContact C-N 3.31Å; K15-H17 PolarHBondContact O-N 3.06Å; K15-R18 PolarHBondContact O-N 3.24Å
16	Q	95.7	Very high	95.2	Very high	100 Å²	100	125.1 Å²	125.1	47%	0.467	61%	0.608	S	S	.	*	H	α-helix	trans	-61.5	-41	178.3	-71.3	166.4	-38.8	0	0	111.5	Q12 N13 G20 I21	Q12-Q16 WeakPolarHBondContact O-CG 3.28Å; Q12-Q16 PolarHBondContact O-N 3.47Å; Q12-Q16 PolarHBondContact O-OE1 2.97Å; N13-Q16 PolarHBondContact O-N 3.21Å; Q16-G20 PolarHBondContact O-N 3.15Å; Q16-I21 HydrophobicContact CB-CD1 4.21Å; Q16-I21 HydrophobicContact CB-CG1 4.29Å
17	H	96.9	Very high	95.3	Very high	114 Å²	114	124.8 Å²	124.8	53%	0.528	60%	0.602	S	S	.	*	H	α-helix	trans	-78.6	-21.4	179.7	-64.7	127.7	0	0	0	114.7	N13 K15 N19 G20 I21	N13-H17 PolarHBondContact O-N 3.09Å; N13-H17 PolarHBondContact O-ND1 3.19Å; K15-H17 VanDerWaalsContact C-N 3.31Å; K15-H17 PolarHBondContact O-N 3.06Å; H17-N19 PolarHBondContact O-N 2.94Å; H17-G20 PolarHBondContact O-N 3.02Å; H17-I21 WeakPolarHBondContact NE2-CD1 3.35Å
18	R	96.5	Very high	95.3	Very high	164 Å²	164	127.5 Å²	127.5	62%	0.619	61%	0.605	S	S	*	*	H	α-helix	trans	-55.1	-40.4	174.8	-82.6	178.2	-173.6	-165.5	-1.4	112.7	R14 K15	R14-R18 VanDerWaalsContact CZ-NH2 3.3Å; R14-R18 WeakPolarHBondContact O-CG 3.34Å; R14-R18 PolarHBondContact O-N 3.21Å; R14-R18 VanDerWaalsContact O-N 3.1Å; K15-R18 PolarHBondContact O-N 3.24Å
19	N	91.6	Very high	95.3	Very high	139 Å²	139	132.2 Å²	132.2	74%	0.743	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.3	-3.7	177.7	-64	-13.7	0	0	0	112.7	H17 H22	H17-N19 PolarHBondContact O-N 2.94Å; N19-H22 PolarHBondContact O-NE2 3.12Å
20	G	94	Very high	95.3	Very high	33 Å²	33	133.8 Å²	133.8	34%	0.34	63%	0.625	S	S	.	*			trans	76.5	142.7	-172	0	0	0	0	0	113.8	Q16 H17 H22	Q16-G20 PolarHBondContact O-N 3.15Å; H17-G20 PolarHBondContact O-N 3.02Å; G20-H22 PolarHBondContact O-N 3.42Å
21	I	95	Very high	95.2	Very high	114 Å²	114	130.3 Å²	130.3	59%	0.585	62%	0.62	S	S	*	*			trans	-92.5	91.4	169.6	-57.8	178.1	0	0	0	107.6	Q16 H17	Q16-I21 HydrophobicContact CB-CD1 4.21Å; Q16-I21 HydrophobicContact CB-CG1 4.29Å; H17-I21 WeakPolarHBondContact NE2-CD1 3.35Å
22	H	95.7	Very high	95.2	Very high	161 Å²	161	131.8 Å²	131.8	75%	0.745	63%	0.628	S	S	*	*	P	Polyproline II helix	trans	-79.2	135.9	-179.8	-63	-58	0	0	0	112	N19 G20	N19-H22 PolarHBondContact O-NE2 3.12Å; G20-H22 PolarHBondContact O-N 3.42Å
23	K	95.7	Very high	95.2	Very high	192 Å²	192	137.5 Å²	137.5	84%	0.835	65%	0.652	S	S	*	*	P	Polyproline II helix	trans	-65.3	148.8	169.4	-64.7	-178.8	-178.8	179.2	0	109.6	K25	K23-K25 PolarHBondContact O-N 3.27Å
24	P	95.3	Very high	95.2	Very high	118 Å²	118	136.9 Å²	136.9	77%	0.766	67%	0.668	S	S	*	*	P	Polyproline II helix	trans	-59.1	140	175.1	25.7	-34.3	0	0	0	110.6	K26	P24-K26 PolarHBondContact O-N 3.42Å
25	K	94.6	Very high	95.2	Very high	193 Å²	193	132.8 Å²	132.8	84%	0.839	66%	0.658	S	S	*	*	P	Polyproline II helix	trans	-66.8	126.3	-179.5	-65.2	-175.3	179.5	-178.8	0	110	K23	K23-K25 PolarHBondContact O-N 3.27Å
26	K	94.4	Very high	95.3	Very high	212 Å²	212	132.5 Å²	132.5	92%	0.922	66%	0.661	S	S	*	*	P	Polyproline II helix	trans	-81.4	133.1	173.1	-61.7	-175.2	-179.3	-177.8	0	109.5	P24	P24-K26 PolarHBondContact O-N 3.42Å
27	Q	94.4	Very high	95.4	Very high	154 Å²	154	132.2 Å²	132.2	72%	0.72	67%	0.668	S	S	*	*			trans	-114	145.7	178.7	-71.6	-93.4	-9.5	0	0	109.1	Y29	Q27-Y29 PolarHBondContact O-N 2.98Å
28	R	96.3	Very high	95.4	Very high	212 Å²	212	134.9 Å²	134.9	80%	0.8	68%	0.678	S	S	*	*	S	Bend	trans	-60.4	-34.3	179.2	-173.8	177.5	-177.7	-179.4	0.3	112.3
29	Y	95.7	Very high	95.4	Very high	171 Å²	171	132.2 Å²	132.2	67%	0.671	67%	0.671	S	S	*	*	S	Bend	trans	-125.4	99	-178.7	-56.1	-63.4	0	0	0	110.4	Q27	Q27-Y29 PolarHBondContact O-N 2.98Å
30	P	93.9	Very high	95.7	Very high	101 Å²	101	127.2 Å²	127.2	66%	0.656	64%	0.644	S	S	*	*			trans	-73.6	162	174.8	31	-34.7	0	0	0	111.7
31	S	94.7	Very high	95.8	Very high	101 Å²	101	133.4 Å²	133.4	71%	0.706	66%	0.657	S	S	*	*			trans	-67.3	143.1	173.8	65.9	0	0	0	0	111.5	K33	S31-K33 PolarHBondContact O-N 3.37Å
32	L	95.3	Very high	95.9	Very high	86 Å²	86	133 Å²	133	45%	0.45	66%	0.657	S	S	.	*			trans	-84.6	24.3	174.3	-58.1	176.9	0	0	0	113.4	G34 V35 L40 M43	L32-G34 PolarHBondContact O-N 3.2Å; L32-V35 HydrophobicContact CB-CG2 4.14Å; L32-V35 HydrophobicContact CD2-CG2 4.37Å; L32-V35 WeakPolarHBondContact O-CG2 3.21Å; L32-V35 PolarHBondContact O-N 3.22Å; L32-L40 HydrophobicContact CB-CD2 4.11Å; L32-L40 HydrophobicContact CD1-CD2 4.23Å; L32-M43 HydrophobicContact CD1-CE 3.36Å; L32-M43 HydrophobicContact CD1-SD 3.97Å
33	K	95.5	Very high	95.9	Very high	192 Å²	192	127.3 Å²	127.3	84%	0.835	63%	0.631	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.1	130.7	178	-173.5	179.9	179.7	-178.2	0	109.1	S31	S31-K33 PolarHBondContact O-N 3.37Å
34	G	96.1	Very high	95.9	Very high	84 Å²	84	126.8 Å²	126.8	87%	0.866	62%	0.624	S	S	*	*	T	Hydrogen-bonded Turn	trans	88.7	-0	-179.2	0	0	0	0	0	115.1	L32	L32-G34 PolarHBondContact O-N 3.2Å
35	V	96.7	Very high	95.9	Very high	53 Å²	53	126.1 Å²	126.1	32%	0.321	61%	0.609	S	S	.	*	S	Bend	trans	-73.5	147.2	170.5	-178.6	0	0	0	0	109.9	L32 F39 L40	L32-V35 HydrophobicContact CB-CG2 4.14Å; L32-V35 HydrophobicContact CD2-CG2 4.37Å; L32-V35 WeakPolarHBondContact O-CG2 3.21Å; L32-V35 PolarHBondContact O-N 3.22Å; V35-F39 HydrophobicContact CG1-CD1 3.48Å; V35-F39 VanDerWaalsContact CG1-CD1 3.48Å; V35-F39 HydrophobicContact CG1-CE1 4.01Å; V35-F39 HydrophobicContact CG1-CG 4.41Å; V35-L40 HydrophobicContact CB-CD1 4.13Å; V35-L40 HydrophobicContact CB-CD2 4.01Å; V35-L40 HydrophobicContact CB-CG 4.01Å; V35-L40 HydrophobicContact CG1-CD2 4.01Å; V35-L40 HydrophobicContact CG1-CG 4.04Å; V35-L40 WeakPolarHBondContact O-CD1 3.4Å
36	D	97.3	Very high	95.8	Very high	88 Å²	88	119.3 Å²	119.3	47%	0.471	59%	0.589	S	S	.	*			trans	-46.4	124.2	179.1	167.3	46.5	0	0	0	112.5	K38 F39 L40	D36-K38 VanDerWaalsContact C-N 3.28Å; D36-K38 PolarHBondContact O-N 3.01Å; D36-K38 PolarHBondContact OD1-N 3.35Å; D36-K38 WeakPolarHBondContact OD2-CB 3.47Å; D36-K38 PolarHBondContact OD2-N 3.41Å; D36-F39 HydrophobicContact CB-CB 4.14Å; D36-F39 PolarHBondContact O-N 3.27Å; D36-F39 WeakPolarHBondContact OD2-CB 3.48Å; D36-F39 PolarHBondContact OD2-N 2.96Å; D36-L40 WeakPolarHBondContact O-CG 2.99Å; D36-L40 PolarHBondContact O-N 3.03Å
37	P	97	Very high	95.7	Very high	94 Å²	94	115.7 Å²	115.7	61%	0.61	57%	0.573	S	S	*	*	H	α-helix	trans	-57.3	-35.8	179.3	-27.3	35.3	0	0	0	114	L40 R41	P37-L40 PolarHBondContact O-N 2.93Å; P37-R41 VanDerWaalsContact O-CG 3.22Å; P37-R41 WeakPolarHBondContact O-CG 3.46Å; P37-R41 PolarHBondContact O-N 3.27Å
38	K	97.6	Very high	95.7	Very high	171 Å²	171	115 Å²	115	74%	0.743	57%	0.567	S	S	*	*	H	α-helix	trans	-66	-45.5	179.9	177.4	-179.9	-177.4	179.6	0	110.6	D36 R41 N42	D36-K38 VanDerWaalsContact C-N 3.28Å; D36-K38 PolarHBondContact O-N 3.01Å; D36-K38 PolarHBondContact OD1-N 3.35Å; D36-K38 WeakPolarHBondContact OD2-CB 3.47Å; D36-K38 PolarHBondContact OD2-N 3.41Å; K38-R41 PolarHBondContact O-N 3.2Å; K38-N42 PolarHBondContact O-N 3.43Å
39	F	97	Very high	95.4	Very high	107 Å²	107	108.2 Å²	108.2	47%	0.469	55%	0.545	S	S	.	.	H	α-helix	trans	-58.9	-47.5	172	174.9	-96	0	0	0	112.5	V35 D36 R41 N42 M43	V35-F39 HydrophobicContact CG1-CD1 3.48Å; V35-F39 VanDerWaalsContact CG1-CD1 3.48Å; V35-F39 HydrophobicContact CG1-CE1 4.01Å; V35-F39 HydrophobicContact CG1-CG 4.41Å; D36-F39 HydrophobicContact CB-CB 4.14Å; D36-F39 PolarHBondContact O-N 3.27Å; D36-F39 WeakPolarHBondContact OD2-CB 3.48Å; D36-F39 PolarHBondContact OD2-N 2.96Å; F39-R41 VanDerWaalsContact C-N 3.3Å; F39-R41 PolarHBondContact O-N 3.07Å; F39-N42 PolarHBondContact O-N 3.28Å; F39-M43 HydrophobicContact CE1-SD 4.32Å; F39-M43 PolarHBondContact O-N 2.9Å
40	L	96.8	Very high	95	Very high	34 Å²	34	105 Å²	105	18%	0.178	54%	0.539	C	S	.	.	H	α-helix	trans	-61.8	-37.7	-179.5	-73.4	-179.6	0	0	0	112.5	L32 V35 D36 P37 M43 R44	L32-L40 HydrophobicContact CB-CD2 4.11Å; L32-L40 HydrophobicContact CD1-CD2 4.23Å; V35-L40 HydrophobicContact CB-CD1 4.13Å; V35-L40 HydrophobicContact CB-CD2 4.01Å; V35-L40 HydrophobicContact CB-CG 4.01Å; V35-L40 HydrophobicContact CG1-CD2 4.01Å; V35-L40 HydrophobicContact CG1-CG 4.04Å; V35-L40 WeakPolarHBondContact O-CD1 3.4Å; D36-L40 WeakPolarHBondContact O-CG 2.99Å; D36-L40 PolarHBondContact O-N 3.03Å; P37-L40 PolarHBondContact O-N 2.93Å; L40-M43 HydrophobicContact CD2-CE 3.74Å; L40-R44 WeakPolarHBondContact O-CB 3.42Å; L40-R44 WeakPolarHBondContact O-CG 2.78Å; L40-R44 PolarHBondContact O-N 3.49Å
41	R	96.8	Very high	94.4	Very high	163 Å²	163	108.8 Å²	108.8	62%	0.615	55%	0.545	S	S	*	.	H	α-helix	trans	-61.2	-49.6	174.8	-72.2	169.7	71.2	88	2	110.9	P37 K38 F39 R44 F45	P37-R41 VanDerWaalsContact O-CG 3.22Å; P37-R41 WeakPolarHBondContact O-CG 3.46Å; P37-R41 PolarHBondContact O-N 3.27Å; K38-R41 PolarHBondContact O-N 3.2Å; F39-R41 VanDerWaalsContact C-N 3.3Å; F39-R41 PolarHBondContact O-N 3.07Å; R41-R44 PolarHBondContact O-N 3.48Å; R41-F45 WeakPolarHBondContact O-CD2 3.1Å; R41-F45 PolarHBondContact O-N 3.3Å; R41-F45 VanDerWaalsContact O-N 3.12Å
42	N	96.3	Very high	93.5	Very high	107 Å²	107	113.4 Å²	113.4	57%	0.572	55%	0.547	S	S	*	.	H	α-helix	trans	-59.6	-50.3	178.1	-179.9	51.1	0	0	0	111.9	K38 F39 R44 F45 A46	K38-N42 PolarHBondContact O-N 3.43Å; F39-N42 PolarHBondContact O-N 3.28Å; N42-R44 VanDerWaalsContact C-N 3.27Å; N42-R44 PolarHBondContact O-N 3.44Å; N42-F45 PolarHBondContact O-N 2.81Å; N42-A46 PolarHBondContact O-N 2.85Å
43	M	95.8	Very high	92.2	Very high	40 Å²	40	110.8 Å²	110.8	20%	0.197	54%	0.541	C	S	.	.	H	α-helix	trans	-58.4	-38.9	179.1	-179.5	-168.7	67	0	0	112	L32 F39 L40 A46 K47	L32-M43 HydrophobicContact CD1-CE 3.36Å; L32-M43 HydrophobicContact CD1-SD 3.97Å; F39-M43 HydrophobicContact CE1-SD 4.32Å; F39-M43 PolarHBondContact O-N 2.9Å; L40-M43 HydrophobicContact CD2-CE 3.74Å; M43-A46 PolarHBondContact O-N 3.13Å; M43-K47 HydrophobicContact CG-CD 4.46Å; M43-K47 WeakPolarHBondContact O-CG 3.36Å; M43-K47 PolarHBondContact O-N 3.38Å
44	R	96.1	Very high	90.8	Very high	182 Å²	182	105.6 Å²	105.6	69%	0.687	52%	0.522	S	S	*	.	H	α-helix	trans	-62.6	-43.6	175.2	-76.6	172.8	174.5	-138.6	0.2	111.8	L40 R41 N42 K48	L40-R44 WeakPolarHBondContact O-CB 3.42Å; L40-R44 WeakPolarHBondContact O-CG 2.78Å; L40-R44 PolarHBondContact O-N 3.49Å; R41-R44 PolarHBondContact O-N 3.48Å; N42-R44 VanDerWaalsContact C-N 3.27Å; N42-R44 PolarHBondContact O-N 3.44Å; R44-K48 WeakPolarHBondContact O-CB 3.47Å; R44-K48 PolarHBondContact O-N 3.22Å
45	F	95.5	Very high	89.2	Confident	104 Å²	104	110 Å²	110	46%	0.456	52%	0.518	S	S	.	.	H	α-helix	trans	-68.7	-37.9	177.3	-71.8	-60.5	0	0	0	113.1	R41 N42 K48 H49	R41-F45 WeakPolarHBondContact O-CD2 3.1Å; R41-F45 PolarHBondContact O-N 3.3Å; R41-F45 VanDerWaalsContact O-N 3.12Å; N42-F45 PolarHBondContact O-N 2.81Å; F45-K48 HydrophobicContact CD1-CD 4.42Å; F45-K48 WeakPolarHBondContact O-CB 3.36Å; F45-K48 PolarHBondContact O-N 3.04Å; F45-H49 PolarHBondContact O-N 3.48Å; F45-H49 PolarHBondContact O-ND1 3.08Å
46	A	92.5	Very high	87.4	Confident	50 Å²	50	113.7 Å²	113.7	41%	0.413	54%	0.535	S	S	.	.	H	α-helix	trans	-59	-52.5	173.5	0	0	0	0	0	110.6	N42 M43 K48 H49 N50	N42-A46 PolarHBondContact O-N 2.85Å; M43-A46 PolarHBondContact O-N 3.13Å; A46-K48 VanDerWaalsContact C-N 3.28Å; A46-K48 PolarHBondContact O-N 3.37Å; A46-H49 PolarHBondContact O-N 3.4Å; A46-N50 PolarHBondContact O-N 3.31Å; A46-N50 PolarHBondContact O-OD1 2.98Å; A46-N50 VanDerWaalsContact O-OD1 3.13Å
47	K	92.9	Very high	85.7	Confident	135 Å²	135	113.2 Å²	113.2	59%	0.587	54%	0.535	S	S	*	.	H	α-helix	trans	-59.8	-35.9	176.5	-70.1	-176.1	-176.8	-174.1	0	112.9	M43 H49	M43-K47 HydrophobicContact CG-CD 4.46Å; M43-K47 WeakPolarHBondContact O-CG 3.36Å; M43-K47 PolarHBondContact O-N 3.38Å; K47-H49 VanDerWaalsContact C-N 3.34Å; K47-H49 PolarHBondContact O-N 3.42Å
48	K	93.6	Very high	83.9	Confident	141 Å²	141	115.1 Å²	115.1	61%	0.613	54%	0.536	S	S	*	.	H	α-helix	trans	-61.9	-38.4	178.2	-176.6	179.5	178.6	-179.3	0	112.5	R44 F45 A46	R44-K48 WeakPolarHBondContact O-CB 3.47Å; R44-K48 PolarHBondContact O-N 3.22Å; F45-K48 HydrophobicContact CD1-CD 4.42Å; F45-K48 WeakPolarHBondContact O-CB 3.36Å; F45-K48 PolarHBondContact O-N 3.04Å; A46-K48 VanDerWaalsContact C-N 3.28Å; A46-K48 PolarHBondContact O-N 3.37Å
49	H	91.2	Very high	81.9	Confident	69 Å²	69	110.8 Å²	110.8	32%	0.319	53%	0.525	S	S	.	.	H	α-helix	trans	-102	-1.1	-171.5	-58.3	123.2	0	0	0	115.1	F45 A46 K47 K51 R52	F45-H49 PolarHBondContact O-N 3.48Å; F45-H49 PolarHBondContact O-ND1 3.08Å; A46-H49 PolarHBondContact O-N 3.4Å; K47-H49 VanDerWaalsContact C-N 3.34Å; K47-H49 PolarHBondContact O-N 3.42Å; H49-K51 PolarHBondContact O-N 3.34Å; H49-K51 VanDerWaalsContact O-N 3.09Å; H49-R52 WeakPolarHBondContact O-CB 3.37Å; H49-R52 PolarHBondContact O-N 2.95Å
50	N	86.5	Confident	79.9	Confident	102 Å²	102	113.4 Å²	113.4	55%	0.545	54%	0.539	S	S	.	.	G	3₁₀ helix	trans	-49.8	-38.1	177.7	-78.8	-15.7	0	0	0	113.5	A46 R52 G53 N54	A46-N50 PolarHBondContact O-N 3.31Å; A46-N50 PolarHBondContact O-OD1 2.98Å; A46-N50 VanDerWaalsContact O-OD1 3.13Å; N50-R52 PolarHBondContact O-N 3.32Å; N50-R52 VanDerWaalsContact O-N 3.15Å; N50-G53 PolarHBondContact O-N 3.14Å; N50-N54 PolarHBondContact O-OD1 3.48Å; N50-N54 VanDerWaalsContact O-OD1 3.06Å
51	K	81.6	Confident	78	Confident	182 Å²	182	116.5 Å²	116.5	79%	0.791	56%	0.559	S	S	*	*	G	3₁₀ helix	trans	-60.7	-25.7	-180	-63.2	-173.5	178.7	-173.2	0	114.1	H49 G53	H49-K51 PolarHBondContact O-N 3.34Å; H49-K51 VanDerWaalsContact O-N 3.09Å; K51-G53 VanDerWaalsContact C-N 3.34Å
52	R	76	Confident	76	Confident	198 Å²	198	113.7 Å²	113.7	75%	0.747	56%	0.56	S	S	*	*	G	3₁₀ helix	trans	-71.7	-31	-178.3	-64	-178.1	176.7	179.4	-2.3	112	H49 N50	H49-R52 WeakPolarHBondContact O-CB 3.37Å; H49-R52 PolarHBondContact O-N 2.95Å; N50-R52 PolarHBondContact O-N 3.32Å; N50-R52 VanDerWaalsContact O-N 3.15Å
53	G	68.2	Low	74.3	Confident	31 Å²	31	113 Å²	113	32%	0.32	56%	0.562	S	S	.	*	S	Bend	trans	-86	-7.1	-178.6	0	0	0	0	0	114.7	N50 K51 K55 N56 V57	N50-G53 PolarHBondContact O-N 3.14Å; K51-G53 VanDerWaalsContact C-N 3.34Å; G53-K55 PolarHBondContact O-N 3.43Å; G53-N56 PolarHBondContact O-N 3.34Å; G53-V57 PolarHBondContact O-N 2.98Å
54	N	65	Low	72.6	Confident	83 Å²	83	115.6 Å²	115.6	44%	0.444	59%	0.589	S	S	.	*	H	α-helix	trans	-57.1	-26.3	-174.8	-78.2	21.4	0	0	0	113.5	N50 N56 V57 Q58	N50-N54 PolarHBondContact O-OD1 3.48Å; N50-N54 VanDerWaalsContact O-OD1 3.06Å; N54-N56 VanDerWaalsContact C-N 3.29Å; N54-N56 PolarHBondContact O-N 3.37Å; N54-V57 PolarHBondContact O-N 3.46Å; N54-Q58 VanDerWaalsContact O-CG 3.25Å; N54-Q58 WeakPolarHBondContact O-CG 3.37Å; N54-Q58 PolarHBondContact O-N 3.46Å; N54-Q58 VanDerWaalsContact O-N 3.12Å
55	K	62	Low	71.1	Confident	177 Å²	177	113.1 Å²	113.1	77%	0.77	59%	0.594	S	S	*	*	H	α-helix	trans	-65.6	-31.1	176.4	-62.2	-172.6	180	-174.2	0	113.3	G53 P59	G53-K55 PolarHBondContact O-N 3.43Å; K55-P59 VanDerWaalsContact O-CD 3.28Å; K55-P59 WeakPolarHBondContact O-CD 3.42Å
56	N	60.8	Low	69.6	Low	129 Å²	129	113.5 Å²	113.5	69%	0.69	61%	0.607	S	S	*	*	H	α-helix	trans	-92.8	-19.2	179.6	-60.4	-11.9	0	0	0	112.3	G53 N54	G53-N56 PolarHBondContact O-N 3.34Å; N54-N56 VanDerWaalsContact C-N 3.29Å; N54-N56 PolarHBondContact O-N 3.37Å
57	V	61.5	Low	68	Low	78 Å²	78	119.4 Å²	119.4	47%	0.473	63%	0.626	S	S	.	*	H	α-helix	trans	-81.5	-41.3	177.8	176.6	0	0	0	0	110.7	G53 N54 P59 E60 V61	G53-V57 PolarHBondContact O-N 2.98Å; N54-V57 PolarHBondContact O-N 3.46Å; V57-P59 VanDerWaalsContact C-CD 3.49Å; V57-E60 PolarHBondContact O-N 3.03Å; V57-E60 VanDerWaalsContact O-N 3.07Å; V57-V61 HydrophobicContact CG1-CG2 3.41Å; V57-V61 VanDerWaalsContact CG1-CG2 3.41Å; V57-V61 WeakPolarHBondContact O-CG2 3.09Å; V57-V61 PolarHBondContact O-N 3.29Å
58	Q	57.7	Low	66.7	Low	135 Å²	135	119.3 Å²	119.3	63%	0.631	64%	0.641	S	S	*	*	T	Hydrogen-bonded Turn	trans	-54.8	-38.5	-178	-73.8	-172.7	132.7	0	0	116.3	N54 E60	N54-Q58 VanDerWaalsContact O-CG 3.25Å; N54-Q58 WeakPolarHBondContact O-CG 3.37Å; N54-Q58 PolarHBondContact O-N 3.46Å; N54-Q58 VanDerWaalsContact O-N 3.12Å; Q58-E60 VanDerWaalsContact C-N 3.32Å; Q58-E60 PolarHBondContact O-N 3.05Å
59	P	56.9	Low	65.4	Low	79 Å²	79	124.8 Å²	124.8	51%	0.513	67%	0.665	S	S	.	*	T	Hydrogen-bonded Turn	trans	-73.1	-20.6	177.1	26.7	-33.5	0	0	0	114.1	K55 V57 T62	K55-P59 VanDerWaalsContact O-CD 3.28Å; K55-P59 WeakPolarHBondContact O-CD 3.42Å; V57-P59 VanDerWaalsContact C-CD 3.49Å; P59-T62 PolarHBondContact O-OG1 3.17Å
60	E	54.8	Low	64.1	Low	163 Å²	163	127.6 Å²	127.6	76%	0.762	68%	0.682	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.5	-23.7	-179.3	-55.5	-63.4	154.3	0	0	112.5	V57 Q58	V57-E60 PolarHBondContact O-N 3.03Å; V57-E60 VanDerWaalsContact O-N 3.07Å; Q58-E60 VanDerWaalsContact C-N 3.32Å; Q58-E60 PolarHBondContact O-N 3.05Å
61	V	56.9	Low	62.9	Low	98 Å²	98	128.9 Å²	128.9	59%	0.594	69%	0.689	S	S	*	*			trans	-103.5	24.9	179.1	-122.4	0	0	0	0	113.4	V57 P63	V57-V61 HydrophobicContact CG1-CG2 3.41Å; V57-V61 VanDerWaalsContact CG1-CG2 3.41Å; V57-V61 WeakPolarHBondContact O-CG2 3.09Å; V57-V61 PolarHBondContact O-N 3.29Å; V61-P63 WeakPolarHBondContact O-CD 3.37Å
62	T	54.9	Low	61.9	Low	105 Å²	105	126 Å²	126	64%	0.644	68%	0.684	S	S	*	*			trans	-80.4	87.4	150.6	52.4	0	0	0	0	107.6	P59 A64	P59-T62 PolarHBondContact O-OG1 3.17Å; T62-A64 PolarHBondContact O-N 2.78Å
63	P	59.7	Low	61	Low	93 Å²	93	121.8 Å²	121.8	60%	0.604	68%	0.68	S	S	*	*			trans	-61.1	133.2	163.4	30.9	-35.5	0	0	0	106.2	V61 V65	V61-P63 WeakPolarHBondContact O-CD 3.37Å; P63-V65 VanDerWaalsContact C-N 3.34Å; P63-V65 PolarHBondContact O-N 3.2Å
64	A	59.5	Low	60.6	Low	93 Å²	93	127.4 Å²	127.4	77%	0.769	70%	0.702	S	S	*	*			trans	-32.3	101	154	0	0	0	0	0	109.9	T62 P66	T62-A64 PolarHBondContact O-N 2.78Å; A64-P66 WeakPolarHBondContact O-CD 3.39Å
65	V	64.5	Low	60.3	Low	131 Å²	131	130.4 Å²	130.4	79%	0.794	72%	0.719	S	S	*	*			trans	-82.4	101	156	-121.3	0	0	0	0	102.3	P63 E67	P63-V65 VanDerWaalsContact C-N 3.34Å; P63-V65 PolarHBondContact O-N 3.2Å; V65-E67 PolarHBondContact O-N 2.71Å; V65-E67 VanDerWaalsContact O-N 3.13Å
66	P	64.3	Low	60.2	Low	111 Å²	111	127.1 Å²	127.1	72%	0.721	72%	0.716	S	S	*	*			trans	-60.7	121.5	164.9	27.7	-30.7	0	0	0	105.3	A64 C68	A64-P66 WeakPolarHBondContact O-CD 3.39Å; P66-C68 PolarHBondContact O-N 2.96Å
67	E	60.5	Low	60.1	Low	175 Å²	175	126.9 Å²	126.9	82%	0.818	72%	0.718	S	S	*	*			trans	-51.2	114.2	168.9	-73	178.9	162.6	0	0	107.6	V65 K69	V65-E67 PolarHBondContact O-N 2.71Å; V65-E67 VanDerWaalsContact O-N 3.13Å; E67-K69 PolarHBondContact O-N 3.1Å
68	C	64.5	Low	60	Low	133 Å²	133	131 Å²	131	90%	0.899	74%	0.738	S	S	*	*			trans	-71.5	97.9	169.1	-161.3	0	0	0	0	106	P66	P66-C68 PolarHBondContact O-N 2.96Å
69	K	65.8	Low	60.2	Low	256 Å²	256	130.6 Å²	130.6	100%	1.113	75%	0.748	S	S	*	*			trans	-67.3	0	164.3	-77.2	-177	177.7	176.1	0	110.5	E67	E67-K69 PolarHBondContact O-N 3.1Å

Retrieved 69 of 69 residues in 69.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).