G4VJN6_SCHMA Loading...

ATP synthase F(0) complex subunit e, mitochondrial

Subunit e, of the mitochondrial membrane ATP synthase complex (F(1)F(0) ATP synthase or Complex V) that produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. ATP synthase complex consist of a soluble F(1) head domain - the catalytic core - and a membrane F(1) domain - the membrane proton channel. These two domains are linked by a central stalk rotating inside the F(1) region and a stationary peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. In vivo, can only synthesize ATP although its ATP hydrolase activity can be activated artificially in vitro. Part of the complex F(0) domain.

AlphaFold DB , UniProt , Accession G4VJN6, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 89 aa.

						>G4VJN6_SCHMA|G4VJN6
MEDSVYVNKLPAPREVSPLIRTARWGLLAAGIVYGALRLKYLTKREKKITERDRAIIEKRLEEYNELHALQAQKSLEELSKATGVPLNQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.9	Very low	67	Low	239 Å²	239	157.2 Å²	157.2	100%	1.177	81%	0.81	S	S	*	*				0	115.1	0	-69.5	-178	-142.1	0	0	105.7	D3	M1-D3 PolarHBondContact O-N 3.29Å
2	E	54	Low	68.6	Low	190 Å²	190	151.2 Å²	151.2	89%	0.888	80%	0.801	S	S	*	*			trans	-67.1	123.7	-158.2	-65.2	165.1	161.9	0	0	112	S4	E2-S4 PolarHBondContact O-N 3.01Å
3	D	57.5	Low	70.1	Confident	161 Å²	161	149.5 Å²	149.5	86%	0.861	80%	0.804	S	S	*	*			trans	-67.7	88.6	163.9	-71.5	-33.9	0	0	0	107.6	M1 V5	M1-D3 PolarHBondContact O-N 3.29Å; D3-V5 PolarHBondContact O-N 3.42Å; D3-V5 VanDerWaalsContact O-N 3.12Å
4	S	66.6	Low	71.5	Confident	69 Å²	69	155.4 Å²	155.4	48%	0.483	81%	0.809	S	S	.	*			trans	-59.5	119.3	178.6	63.4	0	0	0	0	109.5	E2 Y6 V7	E2-S4 PolarHBondContact O-N 3.01Å; S4-Y6 PolarHBondContact O-N 2.91Å; S4-V7 PolarHBondContact O-N 3.37Å; S4-V7 WeakPolarHBondContact OG-CG2 3.49Å
5	V	62.2	Low	72.7	Confident	140 Å²	140	158.2 Å²	158.2	85%	0.848	82%	0.817	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62	-1.7	-173.8	-173.8	0	0	0	0	113.2	D3	D3-V5 PolarHBondContact O-N 3.42Å; D3-V5 VanDerWaalsContact O-N 3.12Å
6	Y	64.7	Low	73.9	Confident	217 Å²	217	152.8 Å²	152.8	85%	0.851	79%	0.793	S	S	*	*	T	Hydrogen-bonded Turn	trans	-107.2	2.5	-178.5	-59.6	-68.9	0	0	0	115.1	S4 N8	S4-Y6 PolarHBondContact O-N 2.91Å; Y6-N8 PolarHBondContact O-N 3.33Å
7	V	67.7	Low	75	Confident	100 Å²	100	147.5 Å²	147.5	61%	0.606	77%	0.772	S	S	*	*			trans	-87.8	90	174	-178.1	0	0	0	0	108.5	S4 K9	S4-V7 PolarHBondContact O-N 3.37Å; S4-V7 WeakPolarHBondContact OG-CG2 3.49Å; V7-K9 VanDerWaalsContact C-N 3.27Å; V7-K9 PolarHBondContact O-N 3.37Å
8	N	71.3	Confident	76	Confident	152 Å²	152	144.9 Å²	144.9	81%	0.813	77%	0.766	S	S	*	*			trans	-60	95.6	162.6	-94.6	-44.7	0	0	0	108.1	Y6 L10	Y6-N8 PolarHBondContact O-N 3.33Å; N8-L10 VanDerWaalsContact C-N 3.33Å; N8-L10 PolarHBondContact O-N 2.92Å
9	K	77	Confident	77.1	Confident	196 Å²	196	143.8 Å²	143.8	85%	0.852	76%	0.76	S	S	*	*			trans	-71.6	90.9	-179.6	-164.4	174.5	-173.2	178.3	0	108.3	V7	V7-K9 VanDerWaalsContact C-N 3.27Å; V7-K9 PolarHBondContact O-N 3.37Å
10	L	83.7	Confident	77.9	Confident	149 Å²	149	141.3 Å²	141.3	78%	0.78	75%	0.746	S	S	*	*	P	Polyproline II helix	trans	-58.3	143.1	173.8	-66	172.1	0	0	0	109.4	N8	N8-L10 VanDerWaalsContact C-N 3.33Å; N8-L10 PolarHBondContact O-N 2.92Å
11	P	86.4	Confident	78.7	Confident	116 Å²	116	142.1 Å²	142.1	75%	0.753	74%	0.738	S	S	*	*	P	Polyproline II helix	trans	-59.2	149.7	173.6	26.7	-34.1	0	0	0	109.8
12	A	86.3	Confident	81.1	Confident	85 Å²	85	135 Å²	135	70%	0.702	71%	0.709	S	S	*	*	P	Polyproline II helix	trans	-55.2	142.5	177.3	0	0	0	0	0	110.6	R14	A12-R14 PolarHBondContact O-N 3.03Å
13	P	88.5	Confident	83.2	Confident	129 Å²	129	128.2 Å²	128.2	84%	0.838	69%	0.685	S	S	*	*	P	Polyproline II helix	trans	-55.1	129.6	178	-25.1	33.7	0	0	0	111.3
14	R	88.9	Confident	85	Confident	232 Å²	232	128.1 Å²	128.1	88%	0.875	67%	0.673	S	S	*	*	P	Polyproline II helix	trans	-68.6	136.4	173.6	-68.3	-176.4	-179.6	-178.7	-0.1	109.6	A12 V16	A12-R14 PolarHBondContact O-N 3.03Å; R14-V16 PolarHBondContact O-N 3.43Å
15	E	90.6	Very high	86.5	Confident	198 Å²	198	133 Å²	133	93%	0.925	68%	0.681	S	S	*	*	P	Polyproline II helix	trans	-61	125.3	173	-62.9	-168.7	166.2	0	0	109.7
16	V	90.4	Very high	88.2	Confident	71 Å²	71	128.3 Å²	128.3	43%	0.43	66%	0.66	S	S	.	*	P	Polyproline II helix	trans	-92.6	137.6	177.1	-68.6	0	0	0	0	109.4	R14	R14-V16 PolarHBondContact O-N 3.43Å
17	S	92.7	Very high	89.8	Confident	64 Å²	64	124.2 Å²	124.2	45%	0.448	65%	0.652	S	S	.	*	P	Polyproline II helix	trans	-55.5	139.2	173.3	171.9	0	0	0	0	110.7	L19 I20 R21	S17-L19 PolarHBondContact O-N 3.45Å; S17-L19 VanDerWaalsContact O-N 3.09Å; S17-L19 PolarHBondContact OG-N 3.45Å; S17-I20 PolarHBondContact O-N 2.99Å; S17-R21 PolarHBondContact O-N 2.95Å
18	P	93.8	Very high	91.2	Very high	100 Å²	100	123.9 Å²	123.9	65%	0.649	65%	0.647	S	S	*	*	H	α-helix	trans	-51.4	-32.8	175.6	-28	35	0	0	0	113.4	I20 R21 T22	P18-I20 VanDerWaalsContact C-N 3.34Å; P18-I20 PolarHBondContact O-N 2.87Å; P18-R21 PolarHBondContact O-N 2.75Å; P18-T22 WeakPolarHBondContact O-CG2 3.4Å; P18-T22 PolarHBondContact O-N 3.46Å; P18-T22 PolarHBondContact O-OG1 2.97Å
19	L	96.1	Very high	92.5	Very high	125 Å²	125	119.2 Å²	119.2	65%	0.654	63%	0.629	S	S	*	*	H	α-helix	trans	-58.5	-43	176.2	-178.5	67	0	0	0	112.5	S17 R21 T22 A23	S17-L19 PolarHBondContact O-N 3.45Å; S17-L19 VanDerWaalsContact O-N 3.09Å; S17-L19 PolarHBondContact OG-N 3.45Å; L19-R21 VanDerWaalsContact C-N 3.31Å; L19-T22 PolarHBondContact O-OG1 3.16Å; L19-A23 WeakPolarHBondContact O-CB 3.32Å; L19-A23 PolarHBondContact O-N 2.89Å
20	I	94.6	Very high	93.5	Very high	93 Å²	93	112.6 Å²	112.6	48%	0.477	61%	0.611	S	S	.	*	H	α-helix	trans	-69.6	-37.1	-179.2	-62.2	173.7	0	0	0	109.8	S17 P18 R24	S17-I20 PolarHBondContact O-N 2.99Å; P18-I20 VanDerWaalsContact C-N 3.34Å; P18-I20 PolarHBondContact O-N 2.87Å; I20-R24 WeakPolarHBondContact O-CB 3.22Å; I20-R24 PolarHBondContact O-N 3.41Å
21	R	93.8	Very high	94.2	Very high	158 Å²	158	107.4 Å²	107.4	60%	0.596	59%	0.594	S	S	*	*	H	α-helix	trans	-66.9	-46	178.3	-171	178.4	-84.7	165.2	-6.2	110.9	S17 P18 L19 R24 W25	S17-R21 PolarHBondContact O-N 2.95Å; P18-R21 PolarHBondContact O-N 2.75Å; L19-R21 VanDerWaalsContact C-N 3.31Å; R21-R24 PolarHBondContact O-N 3.3Å; R21-W25 PolarHBondContact O-N 2.63Å
22	T	96.6	Very high	94.7	Very high	90 Å²	90	107.9 Å²	107.9	55%	0.552	59%	0.589	S	S	*	*	H	α-helix	trans	-68.1	-40.4	177.1	57.2	0	0	0	0	111.9	P18 L19 R24 W25 G26	P18-T22 WeakPolarHBondContact O-CG2 3.4Å; P18-T22 PolarHBondContact O-N 3.46Å; P18-T22 PolarHBondContact O-OG1 2.97Å; L19-T22 PolarHBondContact O-OG1 3.16Å; T22-R24 VanDerWaalsContact C-N 3.34Å; T22-R24 PolarHBondContact O-N 3.26Å; T22-W25 PolarHBondContact O-N 3.12Å; T22-G26 PolarHBondContact O-N 2.94Å
23	A	97.3	Very high	95.3	Very high	47 Å²	47	108 Å²	108	39%	0.388	58%	0.58	S	S	.	*	H	α-helix	trans	-60.5	-42.1	176.2	0	0	0	0	0	112.2	L19 G26 L27	L19-A23 WeakPolarHBondContact O-CB 3.32Å; L19-A23 PolarHBondContact O-N 2.89Å; A23-G26 PolarHBondContact O-N 3.35Å; A23-L27 WeakPolarHBondContact O-CB 3.41Å; A23-L27 WeakPolarHBondContact O-CG 3.45Å; A23-L27 PolarHBondContact O-N 3.4Å
24	R	96.7	Very high	95.8	Very high	159 Å²	159	109 Å²	109	60%	0.6	57%	0.568	S	S	*	*	H	α-helix	trans	-58.7	-53.2	176.5	-177.1	-176	-60.9	-164.7	-0.6	111.5	I20 R21 T22 G26 L27 L28	I20-R24 WeakPolarHBondContact O-CB 3.22Å; I20-R24 PolarHBondContact O-N 3.41Å; R21-R24 PolarHBondContact O-N 3.3Å; T22-R24 VanDerWaalsContact C-N 3.34Å; T22-R24 PolarHBondContact O-N 3.26Å; R24-G26 VanDerWaalsContact C-N 3.33Å; R24-G26 PolarHBondContact O-N 2.73Å; R24-L27 PolarHBondContact O-N 2.86Å; R24-L28 HydrophobicContact CG-CD1 4.37Å; R24-L28 WeakPolarHBondContact O-CG 3.35Å; R24-L28 PolarHBondContact O-N 3.32Å
25	W	96.8	Very high	96.2	Very high	173 Å²	173	99.6 Å²	99.6	66%	0.655	54%	0.544	S	S	*	.	H	α-helix	trans	-66.9	-35.6	179.9	-73.4	111.2	0	0	0	112.3	R21 T22 L28 A29	R21-W25 PolarHBondContact O-N 2.63Å; T22-W25 PolarHBondContact O-N 3.12Å; W25-L28 HydrophobicContact CE3-CD1 4.05Å; W25-L28 HydrophobicContact CZ3-CD1 4.28Å; W25-L28 PolarHBondContact O-N 2.88Å; W25-A29 WeakPolarHBondContact O-CB 3.35Å; W25-A29 PolarHBondContact O-N 3.01Å
26	G	97.8	Very high	96.6	Very high	40 Å²	40	92.5 Å²	92.5	41%	0.412	52%	0.519	S	S	.	.	H	α-helix	trans	-62.2	-46.5	174.6	0	0	0	0	0	112.3	T22 A23 R24 A29 A30	T22-G26 PolarHBondContact O-N 2.94Å; A23-G26 PolarHBondContact O-N 3.35Å; R24-G26 VanDerWaalsContact C-N 3.33Å; R24-G26 PolarHBondContact O-N 2.73Å; G26-A29 PolarHBondContact O-N 3.4Å; G26-A30 VanDerWaalsContact O-CB 3.25Å; G26-A30 WeakPolarHBondContact O-CB 3.39Å; G26-A30 PolarHBondContact O-N 3.03Å
27	L	97.9	Very high	96.9	Very high	132 Å²	132	94.5 Å²	94.5	69%	0.691	53%	0.527	S	S	*	.	H	α-helix	trans	-65.9	-38.8	175.5	-74.3	174.2	0	0	0	112.3	A23 R24 G31	A23-L27 WeakPolarHBondContact O-CB 3.41Å; A23-L27 WeakPolarHBondContact O-CG 3.45Å; A23-L27 PolarHBondContact O-N 3.4Å; R24-L27 PolarHBondContact O-N 2.86Å; L27-G31 PolarHBondContact O-N 3.37Å
28	L	97.9	Very high	97.2	Very high	93 Å²	93	97.1 Å²	97.1	49%	0.487	53%	0.527	S	S	.	.	H	α-helix	trans	-61.7	-47.9	174.2	-73.6	175.7	0	0	0	111.4	R24 W25 G31 I32	R24-L28 HydrophobicContact CG-CD1 4.37Å; R24-L28 WeakPolarHBondContact O-CG 3.35Å; R24-L28 PolarHBondContact O-N 3.32Å; W25-L28 HydrophobicContact CE3-CD1 4.05Å; W25-L28 HydrophobicContact CZ3-CD1 4.28Å; W25-L28 PolarHBondContact O-N 2.88Å; L28-G31 PolarHBondContact O-N 3.36Å; L28-I32 WeakPolarHBondContact O-CG1 3.43Å; L28-I32 PolarHBondContact O-N 3.26Å
29	A	98.1	Very high	97.4	Very high	54 Å²	54	97.7 Å²	97.7	45%	0.446	52%	0.524	S	S	.	.	H	α-helix	trans	-62.9	-46.1	177.5	0	0	0	0	0	111.7	W25 G26 G31 I32 V33	W25-A29 WeakPolarHBondContact O-CB 3.35Å; W25-A29 PolarHBondContact O-N 3.01Å; G26-A29 PolarHBondContact O-N 3.4Å; A29-G31 VanDerWaalsContact C-N 3.32Å; A29-G31 PolarHBondContact O-N 2.98Å; A29-I32 PolarHBondContact O-N 2.89Å; A29-V33 WeakPolarHBondContact O-CG2 3.47Å; A29-V33 PolarHBondContact O-N 3.42Å
30	A	98.3	Very high	97.4	Very high	56 Å²	56	99 Å²	99	46%	0.463	53%	0.525	S	S	.	.	H	α-helix	trans	-60.5	-41.3	176.7	0	0	0	0	0	111.9	G26 V33 Y34	G26-A30 VanDerWaalsContact O-CB 3.25Å; G26-A30 WeakPolarHBondContact O-CB 3.39Å; G26-A30 PolarHBondContact O-N 3.03Å; A30-V33 PolarHBondContact O-N 3.42Å; A30-Y34 VanDerWaalsContact O-CB 3.23Å; A30-Y34 WeakPolarHBondContact O-CB 3.47Å; A30-Y34 PolarHBondContact O-N 3.4Å
31	G	98.2	Very high	97.5	Very high	41 Å²	41	100.8 Å²	100.8	42%	0.423	53%	0.526	S	S	.	.	H	α-helix	trans	-62	-43.3	176.1	0	0	0	0	0	112.8	L27 L28 A29 G35	L27-G31 PolarHBondContact O-N 3.37Å; L28-G31 PolarHBondContact O-N 3.36Å; A29-G31 VanDerWaalsContact C-N 3.32Å; A29-G31 PolarHBondContact O-N 2.98Å; G31-G35 PolarHBondContact O-N 3.04Å
32	I	98.2	Very high	97.6	Very high	126 Å²	126	95.9 Å²	95.9	65%	0.646	51%	0.511	S	S	*	.	H	α-helix	trans	-63.4	-47.4	176.1	-67.6	166.4	0	0	0	110.8	L28 A29 G35 A36	L28-I32 WeakPolarHBondContact O-CG1 3.43Å; L28-I32 PolarHBondContact O-N 3.26Å; A29-I32 PolarHBondContact O-N 2.89Å; I32-G35 PolarHBondContact O-N 2.92Å; I32-A36 WeakPolarHBondContact O-CB 3.49Å; I32-A36 PolarHBondContact O-N 3.34Å
33	V	98.3	Very high	97.6	Very high	86 Å²	86	94.2 Å²	94.2	52%	0.521	50%	0.501	S	S	.	.	H	α-helix	trans	-62.1	-47.5	178.7	172.7	0	0	0	0	110.8	A29 A30 G35 A36 L37	A29-V33 WeakPolarHBondContact O-CG2 3.47Å; A29-V33 PolarHBondContact O-N 3.42Å; A30-V33 PolarHBondContact O-N 3.42Å; V33-G35 VanDerWaalsContact C-N 3.35Å; V33-G35 PolarHBondContact O-N 3.14Å; V33-A36 PolarHBondContact O-N 2.91Å; V33-L37 HydrophobicContact CG1-CD1 4.03Å; V33-L37 HydrophobicContact CG1-CG 4.5Å; V33-L37 WeakPolarHBondContact O-CG 3.39Å; V33-L37 PolarHBondContact O-N 3.15Å
34	Y	98.4	Very high	97.5	Very high	150 Å²	150	100 Å²	100	59%	0.588	52%	0.518	S	S	*	.	H	α-helix	trans	-59.3	-46	176.4	175.3	-103.5	0	0	0	111.5	A30 A36 L37 R38	A30-Y34 VanDerWaalsContact O-CB 3.23Å; A30-Y34 WeakPolarHBondContact O-CB 3.47Å; A30-Y34 PolarHBondContact O-N 3.4Å; Y34-A36 PolarHBondContact O-N 2.89Å; Y34-L37 PolarHBondContact O-N 3.44Å; Y34-R38 WeakPolarHBondContact O-CB 3.34Å; Y34-R38 PolarHBondContact O-N 2.98Å
35	G	98.1	Very high	97.4	Very high	36 Å²	36	99 Å²	99	37%	0.371	51%	0.514	S	S	.	.	H	α-helix	trans	-58.1	-46.3	176.7	0	0	0	0	0	112.4	G31 I32 V33 R38 L39	G31-G35 PolarHBondContact O-N 3.04Å; I32-G35 PolarHBondContact O-N 2.92Å; V33-G35 VanDerWaalsContact C-N 3.35Å; V33-G35 PolarHBondContact O-N 3.14Å; G35-R38 PolarHBondContact O-N 3.44Å; G35-L39 VanDerWaalsContact O-CB 3.27Å; G35-L39 WeakPolarHBondContact O-CB 3.36Å; G35-L39 PolarHBondContact O-N 3.45Å
36	A	98	Very high	97.3	Very high	49 Å²	49	96.3 Å²	96.3	41%	0.405	51%	0.509	S	S	.	.	H	α-helix	trans	-63.7	-43.1	178	0	0	0	0	0	112.6	I32 V33 Y34 K40	I32-A36 WeakPolarHBondContact O-CB 3.49Å; I32-A36 PolarHBondContact O-N 3.34Å; V33-A36 PolarHBondContact O-N 2.91Å; Y34-A36 PolarHBondContact O-N 2.89Å; A36-K40 WeakPolarHBondContact O-CG 3.41Å; A36-K40 PolarHBondContact O-N 3.4Å; A36-K40 VanDerWaalsContact O-N 3.13Å
37	L	98	Very high	97.2	Very high	113 Å²	113	100.6 Å²	100.6	59%	0.592	52%	0.516	S	S	*	.	H	α-helix	trans	-66.4	-43.5	177	-68.9	175.1	0	0	0	111.5	V33 Y34 K40 Y41	V33-L37 HydrophobicContact CG1-CD1 4.03Å; V33-L37 HydrophobicContact CG1-CG 4.5Å; V33-L37 WeakPolarHBondContact O-CG 3.39Å; V33-L37 PolarHBondContact O-N 3.15Å; Y34-L37 PolarHBondContact O-N 3.44Å; L37-K40 PolarHBondContact O-N 3.28Å; L37-Y41 PolarHBondContact O-N 3.02Å
38	R	97.7	Very high	97	Very high	118 Å²	118	99.8 Å²	99.8	45%	0.445	51%	0.507	S	S	.	.	H	α-helix	trans	-65.4	-43	179.4	-175.9	62.8	176.3	-154.5	-0.8	111.6	Y34 G35 Y41 L42	Y34-R38 WeakPolarHBondContact O-CB 3.34Å; Y34-R38 PolarHBondContact O-N 2.98Å; G35-R38 PolarHBondContact O-N 3.44Å; R38-Y41 PolarHBondContact O-N 3.07Å; R38-L42 HydrophobicContact CG-CD1 4.13Å; R38-L42 HydrophobicContact CG-CG 4.49Å; R38-L42 WeakPolarHBondContact O-CG 3.4Å; R38-L42 PolarHBondContact O-N 2.96Å
39	L	97.5	Very high	96.8	Very high	112 Å²	112	98.8 Å²	98.8	59%	0.586	50%	0.501	S	S	*	.	H	α-helix	trans	-60.3	-49	176.3	-178.3	62.5	0	0	0	110.8	G35 Y41 L42 T43	G35-L39 VanDerWaalsContact O-CB 3.27Å; G35-L39 WeakPolarHBondContact O-CB 3.36Å; G35-L39 PolarHBondContact O-N 3.45Å; L39-Y41 VanDerWaalsContact C-N 3.3Å; L39-Y41 PolarHBondContact O-N 3.44Å; L39-L42 PolarHBondContact O-N 3.14Å; L39-T43 PolarHBondContact O-N 3.15Å; L39-T43 PolarHBondContact O-OG1 2.84Å
40	K	96.8	Very high	96.6	Very high	154 Å²	154	99 Å²	99	67%	0.67	50%	0.497	S	S	*	.	H	α-helix	trans	-56.8	-42.8	176.2	-74.9	178.8	179.7	-176.7	0	112.4	A36 L37 K44	A36-K40 WeakPolarHBondContact O-CG 3.41Å; A36-K40 PolarHBondContact O-N 3.4Å; A36-K40 VanDerWaalsContact O-N 3.13Å; L37-K40 PolarHBondContact O-N 3.28Å; K40-K44 WeakPolarHBondContact O-CB 3.29Å; K40-K44 PolarHBondContact O-N 3.26Å; K40-K44 VanDerWaalsContact O-N 3.15Å
41	Y	96.8	Very high	96.5	Very high	130 Å²	130	102.1 Å²	102.1	51%	0.51	50%	0.502	S	S	.	.	H	α-helix	trans	-62	-49.5	176.7	171.5	-94.9	0	0	0	111.9	L37 R38 L39 K44 R45	L37-Y41 PolarHBondContact O-N 3.02Å; R38-Y41 PolarHBondContact O-N 3.07Å; L39-Y41 VanDerWaalsContact C-N 3.3Å; L39-Y41 PolarHBondContact O-N 3.44Å; Y41-K44 PolarHBondContact O-N 3.36Å; Y41-R45 WeakPolarHBondContact O-CB 3.38Å; Y41-R45 PolarHBondContact O-N 2.84Å
42	L	97.1	Very high	96.3	Very high	54 Å²	54	106.4 Å²	106.4	28%	0.283	51%	0.505	S	S	.	.	H	α-helix	trans	-63.8	-46.6	-179.1	-69.8	175.2	0	0	0	111.5	R38 L39 K44 R45 E46	R38-L42 HydrophobicContact CG-CD1 4.13Å; R38-L42 HydrophobicContact CG-CG 4.49Å; R38-L42 WeakPolarHBondContact O-CG 3.4Å; R38-L42 PolarHBondContact O-N 2.96Å; L39-L42 PolarHBondContact O-N 3.14Å; L42-K44 VanDerWaalsContact C-N 3.32Å; L42-K44 PolarHBondContact O-N 2.89Å; L42-R45 WeakPolarHBondContact O-CB 3.45Å; L42-R45 PolarHBondContact O-N 3.24Å; L42-R45 VanDerWaalsContact O-N 3.08Å; L42-E46 WeakPolarHBondContact O-CB 3.28Å; L42-E46 WeakPolarHBondContact O-CG 3.2Å; L42-E46 PolarHBondContact O-N 3.08Å
43	T	96	Very high	96.1	Very high	55 Å²	55	104.2 Å²	104.2	34%	0.337	50%	0.495	S	S	.	.	H	α-helix	trans	-59.7	-40.6	178.1	-55.6	0	0	0	0	112.3	L39 R45 K47	L39-T43 PolarHBondContact O-N 3.15Å; L39-T43 PolarHBondContact O-OG1 2.84Å; T43-R45 VanDerWaalsContact C-N 3.35Å; T43-K47 HydrophobicContact CG2-CD 4.39Å; T43-K47 WeakPolarHBondContact O-CB 3.35Å; T43-K47 VanDerWaalsContact O-CG 3.29Å; T43-K47 WeakPolarHBondContact O-CG 3.4Å; T43-K47 PolarHBondContact O-N 3.3Å
44	K	95.4	Very high	96.1	Very high	170 Å²	170	107.5 Å²	107.5	74%	0.739	50%	0.498	S	S	*	.	H	α-helix	trans	-65.7	-39.9	176.2	-173.2	176.1	-177.7	177.9	0	111.5	K40 Y41 L42 K48	K40-K44 WeakPolarHBondContact O-CB 3.29Å; K40-K44 PolarHBondContact O-N 3.26Å; K40-K44 VanDerWaalsContact O-N 3.15Å; Y41-K44 PolarHBondContact O-N 3.36Å; L42-K44 VanDerWaalsContact C-N 3.32Å; L42-K44 PolarHBondContact O-N 2.89Å; K44-K48 PolarHBondContact O-N 3.22Å
45	R	94.1	Very high	95.9	Very high	138 Å²	138	102.5 Å²	102.5	52%	0.521	49%	0.488	S	S	.	.	H	α-helix	trans	-67	-46.8	178.2	-179.4	179.5	165.7	-173	-6.4	111.5	Y41 L42 T43 K48 I49	Y41-R45 WeakPolarHBondContact O-CB 3.38Å; Y41-R45 PolarHBondContact O-N 2.84Å; L42-R45 WeakPolarHBondContact O-CB 3.45Å; L42-R45 PolarHBondContact O-N 3.24Å; L42-R45 VanDerWaalsContact O-N 3.08Å; T43-R45 VanDerWaalsContact C-N 3.35Å; R45-K48 PolarHBondContact O-N 3.39Å; R45-I49 HydrophobicContact CG-CD1 4.05Å; R45-I49 WeakPolarHBondContact O-CG1 3.45Å; R45-I49 PolarHBondContact O-N 2.92Å; R45-I49 VanDerWaalsContact O-N 3.14Å
46	E	95.2	Very high	95.8	Very high	116 Å²	116	105 Å²	105	54%	0.542	49%	0.491	S	S	.	.	H	α-helix	trans	-62.5	-46.2	179.2	-75.5	172.9	-174.5	0	0	111.5	L42 K48 I49 T50	L42-E46 WeakPolarHBondContact O-CB 3.28Å; L42-E46 WeakPolarHBondContact O-CG 3.2Å; L42-E46 PolarHBondContact O-N 3.08Å; E46-K48 VanDerWaalsContact C-N 3.27Å; E46-K48 PolarHBondContact O-N 2.9Å; E46-I49 PolarHBondContact O-N 3.41Å; E46-T50 PolarHBondContact O-N 3.45Å; E46-T50 PolarHBondContact O-OG1 2.87Å; E46-T50 VanDerWaalsContact O-OG1 3.04Å
47	K	94.6	Very high	95.7	Very high	129 Å²	129	107.8 Å²	107.8	56%	0.561	50%	0.498	S	S	*	.	H	α-helix	trans	-52.7	-46.2	174.3	-76.9	-179.5	177.5	-170.9	0	112.2	T43 I49 T50 E51	T43-K47 HydrophobicContact CG2-CD 4.39Å; T43-K47 WeakPolarHBondContact O-CB 3.35Å; T43-K47 VanDerWaalsContact O-CG 3.29Å; T43-K47 WeakPolarHBondContact O-CG 3.4Å; T43-K47 PolarHBondContact O-N 3.3Å; K47-I49 VanDerWaalsContact C-N 3.27Å; K47-I49 PolarHBondContact O-N 2.99Å; K47-T50 PolarHBondContact O-N 3.27Å; K47-E51 WeakPolarHBondContact O-CB 3.46Å; K47-E51 VanDerWaalsContact O-CG 3.23Å; K47-E51 WeakPolarHBondContact O-CG 3.34Å; K47-E51 PolarHBondContact O-N 3.38Å
48	K	93.7	Very high	95.6	Very high	116 Å²	116	107.8 Å²	107.8	50%	0.504	50%	0.495	S	S	.	.	H	α-helix	trans	-66.8	-25.3	179.3	-156.5	-163.7	-178.2	-180	0	113.7	K44 R45 E46 R52	K44-K48 PolarHBondContact O-N 3.22Å; R45-K48 PolarHBondContact O-N 3.39Å; E46-K48 VanDerWaalsContact C-N 3.27Å; E46-K48 PolarHBondContact O-N 2.9Å; K48-R52 WeakPolarHBondContact O-CG 3.35Å; K48-R52 PolarHBondContact O-NH1 3.48Å; K48-R52 VanDerWaalsContact O-NH1 3.08Å
49	I	93.7	Very high	95.5	Very high	72 Å²	72	108.7 Å²	108.7	37%	0.369	50%	0.503	S	S	.	.	H	α-helix	trans	-80.2	-52	175.4	-68.2	167.3	0	0	0	108.3	R45 E46 K47 E51 R52 D53	R45-I49 HydrophobicContact CG-CD1 4.05Å; R45-I49 WeakPolarHBondContact O-CG1 3.45Å; R45-I49 PolarHBondContact O-N 2.92Å; R45-I49 VanDerWaalsContact O-N 3.14Å; E46-I49 PolarHBondContact O-N 3.41Å; K47-I49 VanDerWaalsContact C-N 3.27Å; K47-I49 PolarHBondContact O-N 2.99Å; I49-E51 VanDerWaalsContact C-N 3.31Å; I49-E51 PolarHBondContact O-N 2.85Å; I49-R52 WeakPolarHBondContact O-CB 3.3Å; I49-R52 PolarHBondContact O-N 3.33Å; I49-D53 WeakPolarHBondContact CG2-OD2 3.21Å; I49-D53 PolarHBondContact O-N 3.14Å
50	T	94.9	Very high	95.5	Very high	59 Å²	59	111.2 Å²	111.2	36%	0.362	50%	0.504	S	S	.	.	H	α-helix	trans	-56	-40.9	177.9	-55.4	0	0	0	0	112.9	E46 K47 R52 D53 R54	E46-T50 PolarHBondContact O-N 3.45Å; E46-T50 PolarHBondContact O-OG1 2.87Å; E46-T50 VanDerWaalsContact O-OG1 3.04Å; K47-T50 PolarHBondContact O-N 3.27Å; T50-R52 VanDerWaalsContact C-N 3.32Å; T50-R52 PolarHBondContact O-N 2.99Å; T50-D53 PolarHBondContact O-N 3.08Å; T50-R54 HydrophobicContact CG2-CG 4.37Å; T50-R54 WeakPolarHBondContact O-CB 3.41Å; T50-R54 VanDerWaalsContact O-CG 3.22Å; T50-R54 WeakPolarHBondContact O-CG 3.44Å; T50-R54 PolarHBondContact O-N 2.81Å
51	E	95.2	Very high	95.5	Very high	121 Å²	121	108.5 Å²	108.5	57%	0.565	50%	0.496	S	S	*	.	H	α-helix	trans	-61.5	-39.1	176	-77.2	165.6	-165.2	0	0	112.2	K47 I49 A55	K47-E51 WeakPolarHBondContact O-CB 3.46Å; K47-E51 VanDerWaalsContact O-CG 3.23Å; K47-E51 WeakPolarHBondContact O-CG 3.34Å; K47-E51 PolarHBondContact O-N 3.38Å; I49-E51 VanDerWaalsContact C-N 3.31Å; I49-E51 PolarHBondContact O-N 2.85Å; E51-A55 PolarHBondContact O-N 3.33Å
52	R	94.2	Very high	95.5	Very high	131 Å²	131	108 Å²	108	49%	0.494	50%	0.499	S	S	.	.	H	α-helix	trans	-71.9	-43.5	176.8	-71.2	-172.3	-178.3	110.3	-21.5	112	K48 I49 T50 R54 A55 I56	K48-R52 WeakPolarHBondContact O-CG 3.35Å; K48-R52 PolarHBondContact O-NH1 3.48Å; K48-R52 VanDerWaalsContact O-NH1 3.08Å; I49-R52 WeakPolarHBondContact O-CB 3.3Å; I49-R52 PolarHBondContact O-N 3.33Å; T50-R52 VanDerWaalsContact C-N 3.32Å; T50-R52 PolarHBondContact O-N 2.99Å; R52-R54 VanDerWaalsContact C-N 3.32Å; R52-R54 PolarHBondContact O-N 3.29Å; R52-A55 PolarHBondContact O-N 3.26Å; R52-I56 WeakPolarHBondContact O-CG1 3.46Å; R52-I56 PolarHBondContact O-N 3.32Å; R52-I56 VanDerWaalsContact O-N 3.08Å
53	D	95.5	Very high	95.4	Very high	79 Å²	79	110.9 Å²	110.9	42%	0.422	51%	0.511	S	S	.	.	H	α-helix	trans	-63.9	-41.4	-179.8	-65.8	-16.1	0	0	0	110.5	I49 T50 I56 I57	I49-D53 WeakPolarHBondContact CG2-OD2 3.21Å; I49-D53 PolarHBondContact O-N 3.14Å; T50-D53 PolarHBondContact O-N 3.08Å; D53-I56 PolarHBondContact O-N 3.04Å; D53-I57 WeakPolarHBondContact O-CB 3.36Å; D53-I57 WeakPolarHBondContact O-CD1 3.22Å; D53-I57 WeakPolarHBondContact O-CG1 3.41Å; D53-I57 PolarHBondContact O-N 3.2Å
54	R	96.3	Very high	95.5	Very high	156 Å²	156	115.2 Å²	115.2	59%	0.589	52%	0.522	S	S	*	.	H	α-helix	trans	-58.2	-49.3	173.4	-76.4	176.2	-176.6	-177.8	1.3	112.2	T50 R52 I56 I57 E58	T50-R54 HydrophobicContact CG2-CG 4.37Å; T50-R54 WeakPolarHBondContact O-CB 3.41Å; T50-R54 VanDerWaalsContact O-CG 3.22Å; T50-R54 WeakPolarHBondContact O-CG 3.44Å; T50-R54 PolarHBondContact O-N 2.81Å; R52-R54 VanDerWaalsContact C-N 3.32Å; R52-R54 PolarHBondContact O-N 3.29Å; R54-I56 PolarHBondContact O-N 3.08Å; R54-I57 PolarHBondContact O-N 2.93Å; R54-I57 VanDerWaalsContact O-N 3.14Å; R54-E58 WeakPolarHBondContact O-CB 3.46Å; R54-E58 VanDerWaalsContact O-CG 3.3Å; R54-E58 WeakPolarHBondContact O-CG 3.32Å; R54-E58 PolarHBondContact O-N 3.06Å
55	A	95.4	Very high	95.5	Very high	45 Å²	45	111.2 Å²	111.2	37%	0.372	51%	0.509	S	S	.	.	H	α-helix	trans	-61.2	-32.8	178.9	0	0	0	0	0	113	E51 R52 K59	E51-A55 PolarHBondContact O-N 3.33Å; R52-A55 PolarHBondContact O-N 3.26Å; A55-K59 WeakPolarHBondContact O-CG 3.43Å; A55-K59 PolarHBondContact O-N 3.4Å
56	I	95.5	Very high	95.6	Very high	87 Å²	87	110.9 Å²	110.9	45%	0.446	51%	0.513	S	S	.	.	H	α-helix	trans	-73.3	-43.6	175.2	-66.1	165.2	0	0	0	110.8	R52 D53 R54 R60	R52-I56 WeakPolarHBondContact O-CG1 3.46Å; R52-I56 PolarHBondContact O-N 3.32Å; R52-I56 VanDerWaalsContact O-N 3.08Å; D53-I56 PolarHBondContact O-N 3.04Å; R54-I56 PolarHBondContact O-N 3.08Å; I56-R60 WeakPolarHBondContact O-CG 3.34Å; I56-R60 PolarHBondContact O-N 3.03Å; I56-R60 VanDerWaalsContact O-N 3.07Å
57	I	96.5	Very high	95.7	Very high	108 Å²	108	110.9 Å²	110.9	55%	0.554	52%	0.516	S	S	*	.	H	α-helix	trans	-64.6	-43.6	180	-69.4	163.8	0	0	0	110.6	D53 R54 R60 L61	D53-I57 WeakPolarHBondContact O-CB 3.36Å; D53-I57 WeakPolarHBondContact O-CD1 3.22Å; D53-I57 WeakPolarHBondContact O-CG1 3.41Å; D53-I57 PolarHBondContact O-N 3.2Å; R54-I57 PolarHBondContact O-N 2.93Å; R54-I57 VanDerWaalsContact O-N 3.14Å; I57-R60 PolarHBondContact O-N 2.89Å; I57-L61 VanDerWaalsContact O-CB 3.32Å; I57-L61 WeakPolarHBondContact O-CB 3.37Å; I57-L61 PolarHBondContact O-N 3.15Å
58	E	96.6	Very high	95.8	Very high	114 Å²	114	109.7 Å²	109.7	53%	0.533	51%	0.512	S	S	.	.	H	α-helix	trans	-58.8	-49.6	178	-75	166.6	-171.7	0	0	111.1	R54 R60 L61 E62	R54-E58 WeakPolarHBondContact O-CB 3.46Å; R54-E58 VanDerWaalsContact O-CG 3.3Å; R54-E58 WeakPolarHBondContact O-CG 3.32Å; R54-E58 PolarHBondContact O-N 3.06Å; E58-R60 PolarHBondContact O-N 3.29Å; E58-L61 WeakPolarHBondContact O-CB 3.45Å; E58-L61 PolarHBondContact O-N 3.01Å; E58-L61 VanDerWaalsContact O-N 3.15Å; E58-E62 WeakPolarHBondContact O-CG 3.41Å; E58-E62 PolarHBondContact O-N 2.86Å
59	K	95.7	Very high	95.9	Very high	137 Å²	137	106.4 Å²	106.4	60%	0.596	51%	0.507	S	S	*	.	H	α-helix	trans	-58.6	-44.7	175.4	-72.9	-179	178.4	-169	0	113	A55 L61 E62 E63	A55-K59 WeakPolarHBondContact O-CG 3.43Å; A55-K59 PolarHBondContact O-N 3.4Å; K59-L61 VanDerWaalsContact C-N 3.29Å; K59-L61 PolarHBondContact O-N 3.4Å; K59-E62 PolarHBondContact O-N 3.32Å; K59-E63 WeakPolarHBondContact O-CG 3.49Å; K59-E63 PolarHBondContact O-N 3.02Å
60	R	96.2	Very high	96	Very high	165 Å²	165	107.3 Å²	107.3	62%	0.623	51%	0.512	S	S	*	.	H	α-helix	trans	-65.8	-34.2	178	-73	179.1	-175.1	-86	1.8	112.2	I56 I57 E58 Y64	I56-R60 WeakPolarHBondContact O-CG 3.34Å; I56-R60 PolarHBondContact O-N 3.03Å; I56-R60 VanDerWaalsContact O-N 3.07Å; I57-R60 PolarHBondContact O-N 2.89Å; E58-R60 PolarHBondContact O-N 3.29Å; R60-Y64 WeakPolarHBondContact O-CB 3.48Å; R60-Y64 PolarHBondContact O-N 3.33Å
61	L	97.3	Very high	96.1	Very high	96 Å²	96	110.9 Å²	110.9	50%	0.503	53%	0.525	S	S	.	.	H	α-helix	trans	-69	-41.2	177.4	-178.4	62.6	0	0	0	110.9	I57 E58 K59 Y64 N65	I57-L61 VanDerWaalsContact O-CB 3.32Å; I57-L61 WeakPolarHBondContact O-CB 3.37Å; I57-L61 PolarHBondContact O-N 3.15Å; E58-L61 WeakPolarHBondContact O-CB 3.45Å; E58-L61 PolarHBondContact O-N 3.01Å; E58-L61 VanDerWaalsContact O-N 3.15Å; K59-L61 VanDerWaalsContact C-N 3.29Å; K59-L61 PolarHBondContact O-N 3.4Å; L61-Y64 PolarHBondContact O-N 3.46Å; L61-N65 WeakPolarHBondContact O-CB 3.5Å; L61-N65 PolarHBondContact O-N 3.46Å; L61-N65 PolarHBondContact O-ND2 2.83Å; L61-N65 VanDerWaalsContact O-ND2 3.15Å
62	E	96.6	Very high	96.1	Very high	121 Å²	121	106.9 Å²	106.9	57%	0.565	51%	0.512	S	S	*	.	H	α-helix	trans	-59.1	-53.8	172.6	-70.6	171.3	177.9	0	0	111	E58 K59 Y64 N65 E66	E58-E62 WeakPolarHBondContact O-CG 3.41Å; E58-E62 PolarHBondContact O-N 2.86Å; K59-E62 PolarHBondContact O-N 3.32Å; E62-Y64 VanDerWaalsContact C-N 3.32Å; E62-Y64 PolarHBondContact O-N 2.84Å; E62-N65 PolarHBondContact O-N 3.33Å; E62-N65 VanDerWaalsContact O-N 3.14Å; E62-E66 WeakPolarHBondContact O-CG 3.23Å; E62-E66 PolarHBondContact O-N 3.13Å
63	E	96	Very high	96	Very high	114 Å²	114	106 Å²	106	53%	0.533	51%	0.514	S	S	.	.	H	α-helix	trans	-56.3	-44.3	176.7	-71	171	-172.4	0	0	112.1	K59 E66 L67	K59-E63 WeakPolarHBondContact O-CG 3.49Å; K59-E63 PolarHBondContact O-N 3.02Å; E63-E66 PolarHBondContact O-N 3.43Å; E63-L67 VanDerWaalsContact O-CG 3.29Å; E63-L67 WeakPolarHBondContact O-CG 3.44Å; E63-L67 PolarHBondContact O-N 3Å
64	Y	96.2	Very high	96	Very high	145 Å²	145	108.5 Å²	108.5	57%	0.569	52%	0.521	S	S	*	.	H	α-helix	trans	-63	-42.7	177.9	178.1	-95.2	0	0	0	112	R60 L61 E62 L67 H68	R60-Y64 WeakPolarHBondContact O-CB 3.48Å; R60-Y64 PolarHBondContact O-N 3.33Å; L61-Y64 PolarHBondContact O-N 3.46Å; E62-Y64 VanDerWaalsContact C-N 3.32Å; E62-Y64 PolarHBondContact O-N 2.84Å; Y64-L67 PolarHBondContact O-N 2.84Å; Y64-H68 VanDerWaalsContact O-CB 3.28Å; Y64-H68 WeakPolarHBondContact O-CB 3.36Å; Y64-H68 PolarHBondContact O-N 2.83Å
65	N	96.9	Very high	95.8	Very high	86 Å²	86	103.4 Å²	103.4	46%	0.46	51%	0.509	S	S	.	.	H	α-helix	trans	-66.2	-40.2	179.2	-71.8	-23.1	0	0	0	111.8	L61 E62 H68 A69	L61-N65 WeakPolarHBondContact O-CB 3.5Å; L61-N65 PolarHBondContact O-N 3.46Å; L61-N65 PolarHBondContact O-ND2 2.83Å; L61-N65 VanDerWaalsContact O-ND2 3.15Å; E62-N65 PolarHBondContact O-N 3.33Å; E62-N65 VanDerWaalsContact O-N 3.14Å; N65-H68 PolarHBondContact O-N 3.27Å; N65-A69 WeakPolarHBondContact O-CB 3.5Å; N65-A69 PolarHBondContact O-N 3.42Å
66	E	96.3	Very high	95.6	Very high	132 Å²	132	105.9 Å²	105.9	62%	0.617	52%	0.516	S	S	*	.	H	α-helix	trans	-61.7	-48.6	174.7	-71.3	179.5	177.3	0	0	111.4	E62 E63 H68 A69 L70	E62-E66 WeakPolarHBondContact O-CG 3.23Å; E62-E66 PolarHBondContact O-N 3.13Å; E63-E66 PolarHBondContact O-N 3.43Å; E66-H68 VanDerWaalsContact C-N 3.32Å; E66-H68 PolarHBondContact O-N 3.04Å; E66-A69 PolarHBondContact O-N 3.35Å; E66-L70 WeakPolarHBondContact O-CG 3.23Å; E66-L70 PolarHBondContact O-N 3.41Å
67	L	96.3	Very high	95.4	Very high	115 Å²	115	106 Å²	106	60%	0.602	52%	0.515	S	S	*	.	H	α-helix	trans	-61.2	-41.2	176.8	-70	174.4	0	0	0	112	E63 Y64 L70 Q71	E63-L67 VanDerWaalsContact O-CG 3.29Å; E63-L67 WeakPolarHBondContact O-CG 3.44Å; E63-L67 PolarHBondContact O-N 3Å; Y64-L67 PolarHBondContact O-N 2.84Å; L67-L70 PolarHBondContact O-N 2.86Å; L67-Q71 WeakPolarHBondContact O-CB 3.21Å; L67-Q71 PolarHBondContact O-N 2.93Å
68	H	96.5	Very high	95.2	Very high	104 Å²	104	107.2 Å²	107.2	48%	0.481	52%	0.518	S	S	.	.	H	α-helix	trans	-65.2	-40.8	177.1	-174.2	-86.9	0	0	0	111.8	Y64 N65 E66 Q71 A72	Y64-H68 VanDerWaalsContact O-CB 3.28Å; Y64-H68 WeakPolarHBondContact O-CB 3.36Å; Y64-H68 PolarHBondContact O-N 2.83Å; N65-H68 PolarHBondContact O-N 3.27Å; E66-H68 VanDerWaalsContact C-N 3.32Å; E66-H68 PolarHBondContact O-N 3.04Å; H68-Q71 PolarHBondContact O-N 3.31Å; H68-A72 WeakPolarHBondContact O-CB 3.29Å; H68-A72 PolarHBondContact O-N 3.49Å
69	A	96.2	Very high	94.9	Very high	48 Å²	48	106.9 Å²	106.9	40%	0.397	52%	0.519	S	S	.	.	H	α-helix	trans	-62.8	-42.4	174.9	0	0	0	0	0	111.8	N65 E66 A72 Q73	N65-A69 WeakPolarHBondContact O-CB 3.5Å; N65-A69 PolarHBondContact O-N 3.42Å; E66-A69 PolarHBondContact O-N 3.35Å; A69-A72 PolarHBondContact O-N 2.87Å; A69-Q73 WeakPolarHBondContact O-CG 3.39Å; A69-Q73 PolarHBondContact O-N 3.38Å
70	L	96.2	Very high	94.7	Very high	90 Å²	90	101.4 Å²	101.4	47%	0.471	50%	0.498	S	S	.	.	H	α-helix	trans	-64.5	-40.8	174.7	-68.9	174.4	0	0	0	112	E66 L67 Q73 K74	E66-L70 WeakPolarHBondContact O-CG 3.23Å; E66-L70 PolarHBondContact O-N 3.41Å; L67-L70 PolarHBondContact O-N 2.86Å; L70-Q73 PolarHBondContact O-N 2.89Å; L70-K74 WeakPolarHBondContact O-CG 3.25Å; L70-K74 PolarHBondContact O-N 2.98Å
71	Q	96.1	Very high	94.4	Very high	134 Å²	134	101.2 Å²	101.2	63%	0.626	50%	0.502	S	S	*	.	H	α-helix	trans	-65.3	-41.1	176.3	-174.9	175	-2.3	0	0	111.4	L67 H68 K74 S75	L67-Q71 WeakPolarHBondContact O-CB 3.21Å; L67-Q71 PolarHBondContact O-N 2.93Å; H68-Q71 PolarHBondContact O-N 3.31Å; Q71-K74 PolarHBondContact O-N 3Å; Q71-S75 WeakPolarHBondContact O-CB 3.41Å; Q71-S75 PolarHBondContact O-N 3.43Å; Q71-S75 PolarHBondContact O-OG 2.9Å
72	A	95.1	Very high	94.1	Very high	37 Å²	37	100.7 Å²	100.7	31%	0.306	51%	0.512	S	S	.	.	H	α-helix	trans	-59.3	-47.2	175	0	0	0	0	0	111.1	H68 A69 S75 L76	H68-A72 WeakPolarHBondContact O-CB 3.29Å; H68-A72 PolarHBondContact O-N 3.49Å; A69-A72 PolarHBondContact O-N 2.87Å; A72-S75 PolarHBondContact O-N 3.41Å; A72-S75 PolarHBondContact O-OG 3.01Å; A72-L76 WeakPolarHBondContact O-CG 3.27Å; A72-L76 PolarHBondContact O-N 3.44Å
73	Q	93.6	Very high	93.9	Very high	112 Å²	112	99.3 Å²	99.3	52%	0.523	51%	0.511	S	S	.	.	H	α-helix	trans	-59.3	-48.3	175.7	-71.5	175.4	7.4	0	0	112.3	A69 L70 S75 L76 E77	A69-Q73 WeakPolarHBondContact O-CG 3.39Å; A69-Q73 PolarHBondContact O-N 3.38Å; L70-Q73 PolarHBondContact O-N 2.89Å; Q73-S75 VanDerWaalsContact C-N 3.33Å; Q73-S75 PolarHBondContact O-N 3.5Å; Q73-L76 WeakPolarHBondContact O-CB 3.34Å; Q73-L76 PolarHBondContact O-N 3.42Å; Q73-L76 VanDerWaalsContact O-N 3.16Å; Q73-E77 WeakPolarHBondContact O-CG 3.34Å; Q73-E77 PolarHBondContact O-N 3.38Å
74	K	94.8	Very high	93.2	Very high	132 Å²	132	97.1 Å²	97.1	57%	0.574	52%	0.519	S	S	*	.	H	α-helix	trans	-59.5	-42.7	176.9	-72.6	177.1	-179.1	179.6	0	112.4	L70 Q71 L76 E77 E78	L70-K74 WeakPolarHBondContact O-CG 3.25Å; L70-K74 PolarHBondContact O-N 2.98Å; Q71-K74 PolarHBondContact O-N 3Å; K74-L76 VanDerWaalsContact C-N 3.32Å; K74-L76 PolarHBondContact O-N 2.98Å; K74-E77 PolarHBondContact O-N 3.42Å; K74-E78 WeakPolarHBondContact O-CG 3.15Å; K74-E78 PolarHBondContact O-N 3.09Å
75	S	92.6	Very high	92.6	Very high	50 Å²	50	94.2 Å²	94.2	35%	0.35	52%	0.516	S	S	.	.	H	α-helix	trans	-64.1	-37.8	177.5	73.1	0	0	0	0	112	Q71 A72 Q73 E78 L79	Q71-S75 WeakPolarHBondContact O-CB 3.41Å; Q71-S75 PolarHBondContact O-N 3.43Å; Q71-S75 PolarHBondContact O-OG 2.9Å; A72-S75 PolarHBondContact O-N 3.41Å; A72-S75 PolarHBondContact O-OG 3.01Å; Q73-S75 VanDerWaalsContact C-N 3.33Å; Q73-S75 PolarHBondContact O-N 3.5Å; S75-E78 PolarHBondContact O-N 3.24Å; S75-L79 WeakPolarHBondContact O-CB 3.48Å; S75-L79 WeakPolarHBondContact O-CG 3.35Å; S75-L79 PolarHBondContact O-N 2.8Å
76	L	91.2	Very high	91.6	Very high	97 Å²	97	94.3 Å²	94.3	51%	0.508	52%	0.522	S	S	.	.	H	α-helix	trans	-66.1	-40.9	174.8	-72.4	171.9	0	0	0	111.5	A72 Q73 K74 L79 S80 L87	A72-L76 WeakPolarHBondContact O-CG 3.27Å; A72-L76 PolarHBondContact O-N 3.44Å; Q73-L76 WeakPolarHBondContact O-CB 3.34Å; Q73-L76 PolarHBondContact O-N 3.42Å; Q73-L76 VanDerWaalsContact O-N 3.16Å; K74-L76 VanDerWaalsContact C-N 3.32Å; K74-L76 PolarHBondContact O-N 2.98Å; L76-L79 PolarHBondContact O-N 2.93Å; L76-S80 WeakPolarHBondContact O-CB 3.33Å; L76-S80 PolarHBondContact O-N 3.38Å; L76-L87 HydrophobicContact CB-CD2 4.33Å
77	E	91.2	Very high	90.2	Very high	90 Å²	90	92.9 Å²	92.9	42%	0.421	52%	0.518	S	S	.	.	H	α-helix	trans	-62.1	-42.6	174.2	-71.9	179.2	-164.5	0	0	113	Q73 K74 S80 K81 L87	Q73-E77 WeakPolarHBondContact O-CG 3.34Å; Q73-E77 PolarHBondContact O-N 3.38Å; K74-E77 PolarHBondContact O-N 3.42Å; E77-S80 PolarHBondContact O-N 3.03Å; E77-K81 VanDerWaalsContact O-CG 3.32Å; E77-K81 WeakPolarHBondContact O-CG 3.42Å; E77-K81 PolarHBondContact O-N 3.37Å; E77-L87 HydrophobicContact CB-CD1 4.41Å; E77-L87 HydrophobicContact CG-CD1 3.81Å
78	E	92.4	Very high	88.4	Confident	133 Å²	133	94.6 Å²	94.6	62%	0.621	53%	0.528	S	S	*	.	H	α-helix	trans	-64.2	-43.8	176.2	-72.8	172.7	-176	0	0	111.6	K74 S75 K81 A82	K74-E78 WeakPolarHBondContact O-CG 3.15Å; K74-E78 PolarHBondContact O-N 3.09Å; S75-E78 PolarHBondContact O-N 3.24Å; E78-K81 PolarHBondContact O-N 3.3Å; E78-A82 WeakPolarHBondContact O-CB 3.45Å; E78-A82 PolarHBondContact O-N 3.26Å
79	L	90.2	Very high	86.1	Confident	106 Å²	106	101.5 Å²	101.5	56%	0.555	56%	0.56	S	S	*	*	H	α-helix	trans	-65.3	-39.5	176.1	-70.2	172.4	0	0	0	112.4	S75 L76 A82 T83	S75-L79 WeakPolarHBondContact O-CB 3.48Å; S75-L79 WeakPolarHBondContact O-CG 3.35Å; S75-L79 PolarHBondContact O-N 2.8Å; L76-L79 PolarHBondContact O-N 2.93Å; L79-A82 PolarHBondContact O-N 3.21Å; L79-T83 WeakPolarHBondContact O-CB 3.4Å; L79-T83 WeakPolarHBondContact O-CG2 3.37Å; L79-T83 PolarHBondContact O-N 2.9Å; L79-T83 PolarHBondContact O-OG1 3.22Å
80	S	90.8	Very high	85.6	Confident	23 Å²	23	104.2 Å²	104.2	16%	0.161	57%	0.568	C	S	.	*	H	α-helix	trans	-61.4	-44.9	174.7	168.7	0	0	0	0	111.5	L76 E77 A82 T83 G84 V85	L76-S80 WeakPolarHBondContact O-CB 3.33Å; L76-S80 PolarHBondContact O-N 3.38Å; E77-S80 PolarHBondContact O-N 3.03Å; S80-A82 VanDerWaalsContact C-N 3.32Å; S80-A82 PolarHBondContact O-N 2.82Å; S80-T83 PolarHBondContact O-N 3.29Å; S80-T83 PolarHBondContact O-OG1 3.18Å; S80-G84 PolarHBondContact O-N 2.86Å; S80-V85 WeakPolarHBondContact CB-O 3.2Å; S80-V85 PolarHBondContact OG-O 3.5Å
81	K	90.1	Very high	85.1	Confident	161 Å²	161	104.9 Å²	104.9	70%	0.7	57%	0.573	S	S	*	*	H	α-helix	trans	-62.3	-38.1	175.5	-72.2	169.9	-173.3	166.8	0	112.3	E77 E78	E77-K81 VanDerWaalsContact O-CG 3.32Å; E77-K81 WeakPolarHBondContact O-CG 3.42Å; E77-K81 PolarHBondContact O-N 3.37Å; E78-K81 PolarHBondContact O-N 3.3Å
82	A	92	Very high	84.5	Confident	85 Å²	85	103.3 Å²	103.3	70%	0.702	57%	0.57	S	S	*	*	H	α-helix	trans	-73.6	-34	179	0	0	0	0	0	113.5	E78 L79 S80	E78-A82 WeakPolarHBondContact O-CB 3.45Å; E78-A82 PolarHBondContact O-N 3.26Å; L79-A82 PolarHBondContact O-N 3.21Å; S80-A82 VanDerWaalsContact C-N 3.32Å; S80-A82 PolarHBondContact O-N 2.82Å
83	T	90.7	Very high	83.9	Confident	91 Å²	91	107.2 Å²	107.2	56%	0.558	59%	0.586	S	S	*	*	H	α-helix	trans	-94.1	-14.2	-176.2	56	0	0	0	0	113.9	L79 S80 V85	L79-T83 WeakPolarHBondContact O-CB 3.4Å; L79-T83 WeakPolarHBondContact O-CG2 3.37Å; L79-T83 PolarHBondContact O-N 2.9Å; L79-T83 PolarHBondContact O-OG1 3.22Å; S80-T83 PolarHBondContact O-N 3.29Å; S80-T83 PolarHBondContact O-OG1 3.18Å; T83-V85 PolarHBondContact O-N 3.12Å
84	G	81.4	Confident	83.2	Confident	68 Å²	68	106.9 Å²	106.9	70%	0.701	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	71.2	10.4	-176.1	0	0	0	0	0	114	S80	S80-G84 PolarHBondContact O-N 2.86Å
85	V	83.9	Confident	82.5	Confident	84 Å²	84	105.2 Å²	105.2	51%	0.509	59%	0.591	S	S	.	*			trans	-89.4	123.9	178.4	-178.2	0	0	0	0	109.2	S80 T83	S80-V85 WeakPolarHBondContact CB-O 3.2Å; S80-V85 PolarHBondContact OG-O 3.5Å; T83-V85 PolarHBondContact O-N 3.12Å
86	P	76.9	Confident	81.8	Confident	88 Å²	88	109.1 Å²	109.1	57%	0.571	61%	0.608	S	S	*	*			trans	-68.3	140.3	178.5	28.2	-34	0	0	0	111.5	N88	P86-N88 PolarHBondContact O-N 2.9Å; P86-N88 VanDerWaalsContact O-N 3.12Å
87	L	66.6	Low	81	Confident	102 Å²	102	110.1 Å²	110.1	53%	0.534	62%	0.616	S	S	.	*	S	Bend	trans	-71.1	2.4	-180	-75.2	168.5	0	0	0	115.1	L76 E77	L76-L87 HydrophobicContact CB-CD2 4.33Å; E77-L87 HydrophobicContact CB-CD1 4.41Å; E77-L87 HydrophobicContact CG-CD1 3.81Å
88	N	59.2	Low	80.2	Confident	152 Å²	152	111.8 Å²	111.8	81%	0.813	63%	0.632	S	S	*	*			trans	-112.7	97.9	176.7	-79.4	-4.5	0	0	0	109.9	P86	P86-N88 PolarHBondContact O-N 2.9Å; P86-N88 VanDerWaalsContact O-N 3.12Å
89	Q	48.1	Very low	79.1	Confident	248 Å²	248	109.8 Å²	109.8	100%	1.159	63%	0.633	S	S	*	*			trans	-131.7	0	154	-75.8	-167.8	-3.1	0	0	109

Retrieved 89 of 89 residues in 16.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).