G4VK24_SCHMA Loading...

Photosystem II CP43 chlorophyll apoprotein

AlphaFold DB , UniProt , Accession G4VK24, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 47 aa.

						>G4VK24_SCHMA|G4VK24
MSQKQWLAVESRTRVNFYLGLVSWMYLHLRVDVHYGTRTQYLSIQTP
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	67.9	Low	87.1	Confident	153 Å²	153	108.5 Å²	108.5	75%	0.754	55%	0.553	S	S	*	*				0	116.1	0	-158	80.9	157.8	0	0	107.6	Q5 W6	M1-Q5 HydrophobicContact CE-CB 4.33Å; M1-Q5 HydrophobicContact CG-CB 4.21Å; M1-Q5 HydrophobicContact SD-CB 4.4Å; M1-W6 HydrophobicContact CB-CZ2 4.5Å; M1-W6 HydrophobicContact CG-CD2 4.26Å; M1-W6 HydrophobicContact CG-CG 4.33Å; M1-W6 HydrophobicContact CG-CZ2 4.21Å
2	S	87.7	Confident	87.4	Confident	70 Å²	70	114.5 Å²	114.5	49%	0.49	56%	0.564	S	S	.	*			trans	-74.3	149	-179.4	-168.7	0	0	0	0	110.5	K4 Q5 W6	S2-K4 PolarHBondContact O-N 3.16Å; S2-K4 VanDerWaalsContact O-N 3.1Å; S2-Q5 WeakPolarHBondContact O-CB 3.2Å; S2-Q5 PolarHBondContact O-N 3.13Å; S2-W6 PolarHBondContact O-N 3.32Å
3	Q	85.5	Confident	87.6	Confident	153 Å²	153	112 Å²	112	72%	0.715	56%	0.559	S	S	*	*	H	α-helix	trans	-52.5	-34.5	178.7	-174	-179.2	-7.7	0	0	112.5	Q5 W6 L7	Q3-Q5 VanDerWaalsContact C-N 3.31Å; Q3-Q5 PolarHBondContact O-N 2.99Å; Q3-W6 PolarHBondContact O-N 3.46Å; Q3-L7 PolarHBondContact O-N 3.37Å
4	K	90.1	Very high	88	Confident	177 Å²	177	115.5 Å²	115.5	77%	0.77	56%	0.563	S	S	*	*	H	α-helix	trans	-61.3	-36.8	175.2	-62.5	-174.8	-179.5	179.2	0	112.8	S2 A8	S2-K4 PolarHBondContact O-N 3.16Å; S2-K4 VanDerWaalsContact O-N 3.1Å; K4-A8 WeakPolarHBondContact O-CB 3.38Å; K4-A8 PolarHBondContact O-N 2.97Å; K4-A8 VanDerWaalsContact O-N 3.12Å
5	Q	88.9	Confident	88.2	Confident	106 Å²	106	113.9 Å²	113.9	50%	0.495	56%	0.562	S	S	.	*	H	α-helix	trans	-71.6	-35.4	178.9	-65.3	177.6	-55.1	0	0	111.5	M1 S2 Q3 A8 V9	M1-Q5 HydrophobicContact CE-CB 4.33Å; M1-Q5 HydrophobicContact CG-CB 4.21Å; M1-Q5 HydrophobicContact SD-CB 4.4Å; S2-Q5 WeakPolarHBondContact O-CB 3.2Å; S2-Q5 PolarHBondContact O-N 3.13Å; Q3-Q5 VanDerWaalsContact C-N 3.31Å; Q3-Q5 PolarHBondContact O-N 2.99Å; Q5-A8 PolarHBondContact O-N 3.27Å; Q5-V9 PolarHBondContact O-N 2.81Å
6	W	91.2	Very high	88.5	Confident	144 Å²	144	112.6 Å²	112.6	55%	0.545	56%	0.558	S	S	.	*	H	α-helix	trans	-62.7	-49.5	174.7	-78.6	116	0	0	0	112	M1 S2 Q3 A8 V9 E10	M1-W6 HydrophobicContact CB-CZ2 4.5Å; M1-W6 HydrophobicContact CG-CD2 4.26Å; M1-W6 HydrophobicContact CG-CG 4.33Å; M1-W6 HydrophobicContact CG-CZ2 4.21Å; S2-W6 PolarHBondContact O-N 3.32Å; Q3-W6 PolarHBondContact O-N 3.46Å; W6-A8 VanDerWaalsContact C-N 3.26Å; W6-A8 PolarHBondContact O-N 2.96Å; W6-V9 HydrophobicContact CE3-CG1 3.87Å; W6-V9 HydrophobicContact CZ3-CG1 4.44Å; W6-V9 WeakPolarHBondContact O-CG1 3.24Å; W6-V9 PolarHBondContact O-N 3Å; W6-E10 WeakPolarHBondContact O-CG 3.46Å; W6-E10 PolarHBondContact O-N 3.48Å
7	L	90.5	Very high	88.7	Confident	107 Å²	107	113.9 Å²	113.9	56%	0.56	56%	0.56	S	S	*	*	H	α-helix	trans	-60.7	-36.6	175.6	-68.7	171.8	0	0	0	112.4	Q3 S11	Q3-L7 PolarHBondContact O-N 3.37Å; L7-S11 WeakPolarHBondContact O-CB 3.31Å; L7-S11 PolarHBondContact O-N 3.02Å; L7-S11 PolarHBondContact O-OG 3.45Å
8	A	90.7	Very high	89	Confident	54 Å²	54	115.8 Å²	115.8	45%	0.446	56%	0.561	S	S	.	*	H	α-helix	trans	-68.2	-36.5	177.2	0	0	0	0	0	113.1	K4 Q5 W6 S11 R12	K4-A8 WeakPolarHBondContact O-CB 3.38Å; K4-A8 PolarHBondContact O-N 2.97Å; K4-A8 VanDerWaalsContact O-N 3.12Å; Q5-A8 PolarHBondContact O-N 3.27Å; W6-A8 VanDerWaalsContact C-N 3.26Å; W6-A8 PolarHBondContact O-N 2.96Å; A8-S11 PolarHBondContact O-OG 2.98Å; A8-S11 VanDerWaalsContact O-OG 3.05Å; A8-R12 VanDerWaalsContact O-CB 3.26Å; A8-R12 WeakPolarHBondContact O-CB 3.48Å; A8-R12 PolarHBondContact O-N 3.34Å
9	V	88.8	Confident	89.2	Confident	61 Å²	61	115.5 Å²	115.5	37%	0.37	56%	0.562	S	S	.	*	H	α-helix	trans	-72.2	-40.2	175.5	62.7	0	0	0	0	111.2	Q5 W6 R12 T13	Q5-V9 PolarHBondContact O-N 2.81Å; W6-V9 HydrophobicContact CE3-CG1 3.87Å; W6-V9 HydrophobicContact CZ3-CG1 4.44Å; W6-V9 WeakPolarHBondContact O-CG1 3.24Å; W6-V9 PolarHBondContact O-N 3Å; V9-R12 PolarHBondContact O-N 3.35Å; V9-T13 HydrophobicContact CG2-CG2 4.46Å; V9-T13 WeakPolarHBondContact O-CG2 3.36Å; V9-T13 PolarHBondContact O-N 3.37Å; V9-T13 PolarHBondContact O-OG1 2.69Å
10	E	87.5	Confident	89.5	Confident	103 Å²	103	111.9 Å²	111.9	48%	0.481	56%	0.556	S	S	.	*	H	α-helix	trans	-62.9	-45.5	175.5	-70.9	-172.6	101.8	0	0	111.7	W6 R12 T13 R14	W6-E10 WeakPolarHBondContact O-CG 3.46Å; W6-E10 PolarHBondContact O-N 3.48Å; E10-R12 VanDerWaalsContact C-N 3.32Å; E10-R12 PolarHBondContact O-N 2.94Å; E10-T13 PolarHBondContact O-N 2.91Å; E10-T13 PolarHBondContact O-OG1 3.27Å; E10-R14 WeakPolarHBondContact O-CG 3.25Å; E10-R14 PolarHBondContact O-N 2.92Å
11	S	89.5	Confident	89.8	Confident	66 Å²	66	110 Å²	110	46%	0.462	55%	0.547	S	S	.	.	H	α-helix	trans	-63.5	-40.1	177	68.1	0	0	0	0	111.5	L7 A8 R14 V15	L7-S11 WeakPolarHBondContact O-CB 3.31Å; L7-S11 PolarHBondContact O-N 3.02Å; L7-S11 PolarHBondContact O-OG 3.45Å; A8-S11 PolarHBondContact O-OG 2.98Å; A8-S11 VanDerWaalsContact O-OG 3.05Å; S11-R14 PolarHBondContact O-N 3Å; S11-V15 VanDerWaalsContact O-CG2 3.28Å; S11-V15 WeakPolarHBondContact O-CG2 3.37Å; S11-V15 PolarHBondContact O-N 2.81Å
12	R	91	Very high	91	Very high	180 Å²	180	107 Å²	107	68%	0.679	54%	0.537	S	S	*	.	H	α-helix	trans	-63.7	-42.9	177.7	-171.3	177	-170.8	-152.7	1.9	112.6	A8 V9 E10 R14 V15 N16	A8-R12 VanDerWaalsContact O-CB 3.26Å; A8-R12 WeakPolarHBondContact O-CB 3.48Å; A8-R12 PolarHBondContact O-N 3.34Å; V9-R12 PolarHBondContact O-N 3.35Å; E10-R12 VanDerWaalsContact C-N 3.32Å; E10-R12 PolarHBondContact O-N 2.94Å; R12-R14 VanDerWaalsContact C-N 3.35Å; R12-V15 PolarHBondContact O-N 2.8Å; R12-N16 WeakPolarHBondContact O-CB 3.29Å; R12-N16 VanDerWaalsContact O-CG 3.26Å; R12-N16 PolarHBondContact O-N 2.8Å; R12-N16 PolarHBondContact O-ND2 3.32Å
13	T	90.3	Very high	91.2	Very high	82 Å²	82	106.9 Å²	106.9	50%	0.503	54%	0.536	S	S	.	.	H	α-helix	trans	-66.1	-39.5	177.3	54.7	0	0	0	0	111.4	V9 E10 N16 F17	V9-T13 HydrophobicContact CG2-CG2 4.46Å; V9-T13 WeakPolarHBondContact O-CG2 3.36Å; V9-T13 PolarHBondContact O-N 3.37Å; V9-T13 PolarHBondContact O-OG1 2.69Å; E10-T13 PolarHBondContact O-N 2.91Å; E10-T13 PolarHBondContact O-OG1 3.27Å; T13-N16 PolarHBondContact O-N 3.37Å; T13-F17 WeakPolarHBondContact O-CB 3.19Å; T13-F17 PolarHBondContact O-N 3.04Å
14	R	92.5	Very high	91.6	Very high	161 Å²	161	107 Å²	107	61%	0.608	53%	0.531	S	S	*	.	H	α-helix	trans	-61.2	-50	174.2	-64.3	-76.4	-172.4	-153.9	-0.4	111.4	E10 S11 R12 N16 F17 Y18	E10-R14 WeakPolarHBondContact O-CG 3.25Å; E10-R14 PolarHBondContact O-N 2.92Å; S11-R14 PolarHBondContact O-N 3Å; R12-R14 VanDerWaalsContact C-N 3.35Å; R14-N16 VanDerWaalsContact C-N 3.32Å; R14-N16 PolarHBondContact O-N 2.88Å; R14-F17 WeakPolarHBondContact O-CB 3.19Å; R14-F17 PolarHBondContact O-N 3.06Å; R14-F17 VanDerWaalsContact O-N 3.16Å; R14-Y18 HydrophobicContact CB-CE2 4.48Å; R14-Y18 WeakPolarHBondContact O-CD2 3.48Å; R14-Y18 PolarHBondContact O-N 3.47Å
15	V	91.8	Very high	91.7	Very high	92 Å²	92	104.7 Å²	104.7	56%	0.558	52%	0.524	S	S	*	.	H	α-helix	trans	-59.2	-44	178.8	170.2	0	0	0	0	111	S11 R12 F17 Y18 L19	S11-V15 VanDerWaalsContact O-CG2 3.28Å; S11-V15 WeakPolarHBondContact O-CG2 3.37Å; S11-V15 PolarHBondContact O-N 2.81Å; R12-V15 PolarHBondContact O-N 2.8Å; V15-F17 PolarHBondContact O-N 2.64Å; V15-Y18 PolarHBondContact O-N 3.43Å; V15-L19 VanDerWaalsContact O-CB 3.31Å; V15-L19 WeakPolarHBondContact O-CB 3.2Å; V15-L19 PolarHBondContact O-N 2.88Å
16	N	92.2	Very high	91.8	Very high	92 Å²	92	107.4 Å²	107.4	49%	0.492	53%	0.531	S	S	.	.	H	α-helix	trans	-62.4	-41.8	176.3	-74.1	-17.7	0	0	0	112.3	R12 T13 R14 L19 G20	R12-N16 WeakPolarHBondContact O-CB 3.29Å; R12-N16 VanDerWaalsContact O-CG 3.26Å; R12-N16 PolarHBondContact O-N 2.8Å; R12-N16 PolarHBondContact O-ND2 3.32Å; T13-N16 PolarHBondContact O-N 3.37Å; R14-N16 VanDerWaalsContact C-N 3.32Å; R14-N16 PolarHBondContact O-N 2.88Å; N16-L19 PolarHBondContact O-N 3.41Å; N16-G20 PolarHBondContact O-N 3.27Å
17	F	92.7	Very high	91.8	Very high	135 Å²	135	104.9 Å²	104.9	59%	0.592	53%	0.528	S	S	*	.	H	α-helix	trans	-61.7	-47.9	176.8	179.7	-100.6	0	0	0	111.6	T13 R14 V15 L19 G20 L21	T13-F17 WeakPolarHBondContact O-CB 3.19Å; T13-F17 PolarHBondContact O-N 3.04Å; R14-F17 WeakPolarHBondContact O-CB 3.19Å; R14-F17 PolarHBondContact O-N 3.06Å; R14-F17 VanDerWaalsContact O-N 3.16Å; V15-F17 PolarHBondContact O-N 2.64Å; F17-L19 PolarHBondContact O-N 2.86Å; F17-G20 PolarHBondContact O-N 2.89Å; F17-L21 HydrophobicContact CD1-CD1 4.1Å; F17-L21 HydrophobicContact CE1-CD1 3.44Å; F17-L21 VanDerWaalsContact CE1-CD1 3.44Å; F17-L21 HydrophobicContact CE1-CG 4.46Å; F17-L21 HydrophobicContact CZ-CD1 3.8Å; F17-L21 PolarHBondContact O-N 2.98Å
18	Y	93.6	Very high	91.7	Very high	149 Å²	149	104.7 Å²	104.7	58%	0.584	52%	0.523	S	S	*	.	H	α-helix	trans	-63.2	-41.7	176.8	-76.8	-66.3	0	0	0	112.4	R14 V15 G20 L21 V22	R14-Y18 HydrophobicContact CB-CE2 4.48Å; R14-Y18 WeakPolarHBondContact O-CD2 3.48Å; R14-Y18 PolarHBondContact O-N 3.47Å; V15-Y18 PolarHBondContact O-N 3.43Å; Y18-G20 VanDerWaalsContact C-N 3.32Å; Y18-G20 PolarHBondContact O-N 3.38Å; Y18-L21 WeakPolarHBondContact O-CB 3.5Å; Y18-L21 PolarHBondContact O-N 3.25Å; Y18-V22 VanDerWaalsContact O-CG2 3.32Å; Y18-V22 WeakPolarHBondContact O-CG2 3.34Å; Y18-V22 PolarHBondContact O-N 3.47Å
19	L	93.2	Very high	91.5	Very high	110 Å²	110	107.4 Å²	107.4	58%	0.576	53%	0.53	S	S	*	.	H	α-helix	trans	-62.8	-40.6	177.5	-175	63.6	0	0	0	111.7	V15 N16 F17 S23	V15-L19 VanDerWaalsContact O-CB 3.31Å; V15-L19 WeakPolarHBondContact O-CB 3.2Å; V15-L19 PolarHBondContact O-N 2.88Å; N16-L19 PolarHBondContact O-N 3.41Å; F17-L19 PolarHBondContact O-N 2.86Å; L19-S23 WeakPolarHBondContact O-CB 3.38Å; L19-S23 PolarHBondContact O-N 3.4Å; L19-S23 PolarHBondContact O-OG 2.9Å
20	G	95.6	Very high	91.5	Very high	42 Å²	42	112.6 Å²	112.6	43%	0.433	54%	0.543	S	S	.	.	H	α-helix	trans	-62.8	-43.8	172.8	0	0	0	0	0	112.4	N16 F17 Y18 S23 W24	N16-G20 PolarHBondContact O-N 3.27Å; F17-G20 PolarHBondContact O-N 2.89Å; Y18-G20 VanDerWaalsContact C-N 3.32Å; Y18-G20 PolarHBondContact O-N 3.38Å; G20-S23 PolarHBondContact O-N 3.28Å; G20-W24 WeakPolarHBondContact O-CB 3.25Å; G20-W24 PolarHBondContact O-N 3.43Å
21	L	95.1	Very high	91.3	Very high	73 Å²	73	110.4 Å²	110.4	38%	0.382	54%	0.536	S	S	.	.	H	α-helix	trans	-61.3	-46.7	176.5	-112.6	171.1	0	0	0	112.6	F17 Y18 S23 W24 M25	F17-L21 HydrophobicContact CD1-CD1 4.1Å; F17-L21 HydrophobicContact CE1-CD1 3.44Å; F17-L21 VanDerWaalsContact CE1-CD1 3.44Å; F17-L21 HydrophobicContact CE1-CG 4.46Å; F17-L21 HydrophobicContact CZ-CD1 3.8Å; F17-L21 PolarHBondContact O-N 2.98Å; Y18-L21 WeakPolarHBondContact O-CB 3.5Å; Y18-L21 PolarHBondContact O-N 3.25Å; L21-S23 VanDerWaalsContact C-N 3.33Å; L21-S23 PolarHBondContact O-N 2.89Å; L21-W24 WeakPolarHBondContact O-CB 3.44Å; L21-W24 PolarHBondContact O-N 3.35Å; L21-M25 WeakPolarHBondContact O-CG 3.34Å; L21-M25 PolarHBondContact O-N 2.93Å
22	V	93	Very high	90.9	Very high	90 Å²	90	112.1 Å²	112.1	55%	0.545	54%	0.54	S	S	.	.	H	α-helix	trans	-64.4	-40.6	177.9	172.3	0	0	0	0	110.5	Y18 W24 M25 Y26	Y18-V22 VanDerWaalsContact O-CG2 3.32Å; Y18-V22 WeakPolarHBondContact O-CG2 3.34Å; Y18-V22 PolarHBondContact O-N 3.47Å; V22-W24 VanDerWaalsContact C-N 3.33Å; V22-W24 PolarHBondContact O-N 2.92Å; V22-M25 PolarHBondContact O-N 2.87Å; V22-Y26 WeakPolarHBondContact O-CB 3.28Å; V22-Y26 PolarHBondContact O-N 3.49Å
23	S	91.9	Very high	90.4	Very high	67 Å²	67	107.5 Å²	107.5	47%	0.469	53%	0.532	S	S	.	.	H	α-helix	trans	-63	-40.5	175.4	-58.9	0	0	0	0	111.7	L19 G20 L21 Y26 L27	L19-S23 WeakPolarHBondContact O-CB 3.38Å; L19-S23 PolarHBondContact O-N 3.4Å; L19-S23 PolarHBondContact O-OG 2.9Å; G20-S23 PolarHBondContact O-N 3.28Å; L21-S23 VanDerWaalsContact C-N 3.33Å; L21-S23 PolarHBondContact O-N 2.89Å; S23-Y26 PolarHBondContact O-N 3.22Å; S23-L27 WeakPolarHBondContact O-CB 3.37Å; S23-L27 PolarHBondContact O-N 3.34Å
24	W	93.7	Very high	89.9	Confident	157 Å²	157	109.7 Å²	109.7	60%	0.595	54%	0.536	S	S	*	.	H	α-helix	trans	-62.2	-49	174.7	-179.2	-100.6	0	0	0	111.7	G20 L21 V22 Y26 L27 H28	G20-W24 WeakPolarHBondContact O-CB 3.25Å; G20-W24 PolarHBondContact O-N 3.43Å; L21-W24 WeakPolarHBondContact O-CB 3.44Å; L21-W24 PolarHBondContact O-N 3.35Å; V22-W24 VanDerWaalsContact C-N 3.33Å; V22-W24 PolarHBondContact O-N 2.92Å; W24-Y26 VanDerWaalsContact C-N 3.32Å; W24-Y26 PolarHBondContact O-N 2.94Å; W24-L27 PolarHBondContact O-N 3.3Å; W24-H28 AromaticContact CZ2-CD2 3.9Å; W24-H28 WeakPolarHBondContact O-CB 3.37Å; W24-H28 PolarHBondContact O-N 2.97Å
25	M	92.4	Very high	89.2	Confident	127 Å²	127	108.3 Å²	108.3	63%	0.626	53%	0.532	S	S	*	.	H	α-helix	trans	-59.2	-43.2	176.9	-73.9	177.1	67.6	0	0	111.9	L21 V22 H28 L29	L21-M25 WeakPolarHBondContact O-CG 3.34Å; L21-M25 PolarHBondContact O-N 2.93Å; V22-M25 PolarHBondContact O-N 2.87Å; M25-H28 PolarHBondContact O-N 2.94Å; M25-L29 WeakPolarHBondContact O-CB 3.43Å; M25-L29 PolarHBondContact O-N 3.47Å
26	Y	91.9	Very high	88.4	Confident	163 Å²	163	105.2 Å²	105.2	64%	0.639	52%	0.519	S	S	*	.	H	α-helix	trans	-64.9	-43.8	178.8	-172.4	-97.4	0	0	0	112	V22 S23 W24 H28 L29 R30	V22-Y26 WeakPolarHBondContact O-CB 3.28Å; V22-Y26 PolarHBondContact O-N 3.49Å; S23-Y26 PolarHBondContact O-N 3.22Å; W24-Y26 VanDerWaalsContact C-N 3.32Å; W24-Y26 PolarHBondContact O-N 2.94Å; Y26-H28 VanDerWaalsContact C-N 3.35Å; Y26-L29 PolarHBondContact O-N 2.96Å; Y26-R30 WeakPolarHBondContact O-CB 3.47Å; Y26-R30 PolarHBondContact O-N 3.42Å
27	L	90.9	Very high	87.6	Confident	92 Å²	92	104.8 Å²	104.8	48%	0.482	52%	0.519	S	S	.	.	H	α-helix	trans	-61.9	-45.5	176	-175	66.2	0	0	0	110.8	S23 W24 R30 V31	S23-L27 WeakPolarHBondContact O-CB 3.37Å; S23-L27 PolarHBondContact O-N 3.34Å; W24-L27 PolarHBondContact O-N 3.3Å; L27-R30 PolarHBondContact O-N 2.77Å; L27-V31 HydrophobicContact CG-CG2 4.45Å; L27-V31 VanDerWaalsContact O-CB 3.28Å; L27-V31 WeakPolarHBondContact O-CB 3.46Å; L27-V31 WeakPolarHBondContact O-CG2 3.37Å; L27-V31 PolarHBondContact O-N 3.5Å
28	H	87.6	Confident	86.7	Confident	102 Å²	102	105.4 Å²	105.4	47%	0.472	52%	0.518	S	S	.	.	H	α-helix	trans	-66	-39.9	-179	-141.8	-74.5	0	0	0	112.1	W24 M25 Y26 V31 D32	W24-H28 AromaticContact CZ2-CD2 3.9Å; W24-H28 WeakPolarHBondContact O-CB 3.37Å; W24-H28 PolarHBondContact O-N 2.97Å; M25-H28 PolarHBondContact O-N 2.94Å; Y26-H28 VanDerWaalsContact C-N 3.35Å; H28-V31 PolarHBondContact O-N 3.16Å; H28-D32 VanDerWaalsContact O-CB 3.29Å; H28-D32 WeakPolarHBondContact O-CB 3.42Å; H28-D32 PolarHBondContact O-N 3.45Å
29	L	86.8	Confident	85.9	Confident	111 Å²	111	102.3 Å²	102.3	58%	0.581	51%	0.514	S	S	*	.	H	α-helix	trans	-63.8	-43	174.2	-179.2	64.1	0	0	0	111.3	M25 Y26 V31 D32 V33	M25-L29 WeakPolarHBondContact O-CB 3.43Å; M25-L29 PolarHBondContact O-N 3.47Å; Y26-L29 PolarHBondContact O-N 2.96Å; L29-V31 VanDerWaalsContact C-N 3.33Å; L29-D32 PolarHBondContact O-N 3.38Å; L29-V33 HydrophobicContact CD1-CG2 4.37Å; L29-V33 WeakPolarHBondContact O-CB 3.47Å; L29-V33 VanDerWaalsContact O-CG2 3.25Å; L29-V33 WeakPolarHBondContact O-CG2 3.47Å; L29-V33 PolarHBondContact O-N 3.27Å
30	R	87.9	Confident	85.1	Confident	171 Å²	171	103.2 Å²	103.2	65%	0.645	52%	0.516	S	S	*	.	H	α-helix	trans	-66.9	-38.3	179	-171.3	170.1	179.6	-113.4	0.1	111.8	Y26 L27 H34	Y26-R30 WeakPolarHBondContact O-CB 3.47Å; Y26-R30 PolarHBondContact O-N 3.42Å; L27-R30 PolarHBondContact O-N 2.77Å; R30-H34 WeakPolarHBondContact O-CB 3.31Å; R30-H34 PolarHBondContact O-N 2.99Å
31	V	83.1	Confident	84	Confident	56 Å²	56	108.4 Å²	108.4	34%	0.339	52%	0.524	S	S	.	.	H	α-helix	trans	-62.1	-53.4	172.1	159.9	0	0	0	0	109.5	L27 H28 L29 V33 H34 Y35	L27-V31 HydrophobicContact CG-CG2 4.45Å; L27-V31 VanDerWaalsContact O-CB 3.28Å; L27-V31 WeakPolarHBondContact O-CB 3.46Å; L27-V31 WeakPolarHBondContact O-CG2 3.37Å; L27-V31 PolarHBondContact O-N 3.5Å; H28-V31 PolarHBondContact O-N 3.16Å; L29-V31 VanDerWaalsContact C-N 3.33Å; V31-V33 PolarHBondContact O-N 2.89Å; V31-H34 CarbonylContact O-C 3.59Å; V31-H34 WeakPolarHBondContact O-CA 3.32Å; V31-H34 WeakPolarHBondContact O-CB 3.41Å; V31-H34 PolarHBondContact O-N 2.87Å; V31-Y35 HydrophobicContact CB-CD2 4.38Å; V31-Y35 HydrophobicContact CG1-CD2 3.5Å; V31-Y35 HydrophobicContact CG1-CE2 3.64Å; V31-Y35 WeakPolarHBondContact O-CD2 3.44Å; V31-Y35 PolarHBondContact O-N 3.41Å
32	D	81.8	Confident	83	Confident	102 Å²	102	109.2 Å²	109.2	55%	0.545	53%	0.528	S	S	.	.	H	α-helix	trans	-57	-48	179.3	-168.6	-59.9	0	0	0	111.6	H28 L29 H34 Y35 G36	H28-D32 VanDerWaalsContact O-CB 3.29Å; H28-D32 WeakPolarHBondContact O-CB 3.42Å; H28-D32 PolarHBondContact O-N 3.45Å; L29-D32 PolarHBondContact O-N 3.38Å; D32-H34 VanDerWaalsContact C-N 3.27Å; D32-H34 PolarHBondContact O-N 2.94Å; D32-Y35 PolarHBondContact O-N 3.33Å; D32-G36 WeakPolarHBondContact O-CA 3.11Å; D32-G36 PolarHBondContact O-N 3.06Å
33	V	80.2	Confident	82.1	Confident	84 Å²	84	108.5 Å²	108.5	51%	0.509	53%	0.527	S	S	.	.	H	α-helix	trans	-58.8	-40.6	175.7	170.6	0	0	0	0	111.2	L29 V31 T37	L29-V33 HydrophobicContact CD1-CG2 4.37Å; L29-V33 WeakPolarHBondContact O-CB 3.47Å; L29-V33 VanDerWaalsContact O-CG2 3.25Å; L29-V33 WeakPolarHBondContact O-CG2 3.47Å; L29-V33 PolarHBondContact O-N 3.27Å; V31-V33 PolarHBondContact O-N 2.89Å; V33-T37 WeakPolarHBondContact O-CB 3.1Å; V33-T37 PolarHBondContact O-N 3.4Å; V33-T37 PolarHBondContact O-OG1 3.43Å
34	H	80.9	Confident	81.2	Confident	127 Å²	127	112 Å²	112	59%	0.588	54%	0.538	S	S	*	.	H	α-helix	trans	-70.1	-46.9	179.4	-165.3	70.4	0	0	0	112.5	R30 V31 D32 R38	R30-H34 WeakPolarHBondContact O-CB 3.31Å; R30-H34 PolarHBondContact O-N 2.99Å; V31-H34 CarbonylContact O-C 3.59Å; V31-H34 WeakPolarHBondContact O-CA 3.32Å; V31-H34 WeakPolarHBondContact O-CB 3.41Å; V31-H34 PolarHBondContact O-N 2.87Å; D32-H34 VanDerWaalsContact C-N 3.27Å; D32-H34 PolarHBondContact O-N 2.94Å; H34-R38 VanDerWaalsContact O-CB 3.25Å; H34-R38 WeakPolarHBondContact O-CB 3.4Å; H34-R38 PolarHBondContact O-N 2.95Å
35	Y	77	Confident	80.2	Confident	133 Å²	133	110.3 Å²	110.3	52%	0.522	54%	0.537	S	S	.	.	H	α-helix	trans	-71	-40.6	179.1	-77.8	-77.5	0	0	0	111.9	V31 D32 R38 T39	V31-Y35 HydrophobicContact CB-CD2 4.38Å; V31-Y35 HydrophobicContact CG1-CD2 3.5Å; V31-Y35 HydrophobicContact CG1-CE2 3.64Å; V31-Y35 WeakPolarHBondContact O-CD2 3.44Å; V31-Y35 PolarHBondContact O-N 3.41Å; D32-Y35 PolarHBondContact O-N 3.33Å; Y35-R38 PolarHBondContact O-N 3.34Å; Y35-T39 WeakPolarHBondContact O-CB 3.28Å; Y35-T39 PolarHBondContact O-N 3.41Å; Y35-T39 PolarHBondContact O-OG1 3.43Å
36	G	75.7	Confident	78.9	Confident	27 Å²	27	108.9 Å²	108.9	28%	0.278	54%	0.536	S	S	.	.	H	α-helix	trans	-60.6	-45.9	174.2	0	0	0	0	0	111.8	D32 T39 Q40	D32-G36 WeakPolarHBondContact O-CA 3.11Å; D32-G36 PolarHBondContact O-N 3.06Å; G36-T39 PolarHBondContact O-N 3Å; G36-Q40 WeakPolarHBondContact O-CG 3.04Å; G36-Q40 PolarHBondContact O-N 3.07Å
37	T	74.2	Confident	77.4	Confident	82 Å²	82	110.4 Å²	110.4	50%	0.503	57%	0.566	S	S	.	*	H	α-helix	trans	-65.5	-40.8	174.6	-54.7	0	0	0	0	111.3	V33 Q40 Y41	V33-T37 WeakPolarHBondContact O-CB 3.1Å; V33-T37 PolarHBondContact O-N 3.4Å; V33-T37 PolarHBondContact O-OG1 3.43Å; T37-Q40 PolarHBondContact O-N 3.05Å; T37-Y41 PolarHBondContact O-N 3.23Å
38	R	74.5	Confident	76.7	Confident	148 Å²	148	111.4 Å²	111.4	56%	0.558	57%	0.57	S	S	*	*	H	α-helix	trans	-63.3	-43.6	177.5	-174	-179.8	-179.4	-173.3	0.1	111.9	H34 Y35 Y41 L42	H34-R38 VanDerWaalsContact O-CB 3.25Å; H34-R38 WeakPolarHBondContact O-CB 3.4Å; H34-R38 PolarHBondContact O-N 2.95Å; Y35-R38 PolarHBondContact O-N 3.34Å; R38-Y41 PolarHBondContact O-N 2.89Å; R38-L42 HydrophobicContact CG-CD1 4.04Å; R38-L42 WeakPolarHBondContact O-CB 3.41Å; R38-L42 WeakPolarHBondContact O-CG 3.26Å; R38-L42 PolarHBondContact O-N 3.46Å
39	T	77.1	Confident	76.2	Confident	84 Å²	84	111.8 Å²	111.8	52%	0.515	58%	0.575	S	S	.	*	H	α-helix	trans	-64.6	-42.3	176.5	-59.1	0	0	0	0	110.8	Y35 G36 Y41 L42 S43	Y35-T39 WeakPolarHBondContact O-CB 3.28Å; Y35-T39 PolarHBondContact O-N 3.41Å; Y35-T39 PolarHBondContact O-OG1 3.43Å; G36-T39 PolarHBondContact O-N 3Å; T39-Y41 PolarHBondContact O-N 3.33Å; T39-L42 PolarHBondContact O-N 3.18Å; T39-S43 PolarHBondContact O-N 2.93Å; T39-S43 PolarHBondContact O-OG 2.99Å
40	Q	76.1	Confident	75.6	Confident	130 Å²	130	111.9 Å²	111.9	61%	0.607	58%	0.575	S	S	*	*	H	α-helix	trans	-61	-43.9	174.7	-74.2	178.5	30.1	0	0	112.3	G36 T37 S43 I44	G36-Q40 WeakPolarHBondContact O-CG 3.04Å; G36-Q40 PolarHBondContact O-N 3.07Å; T37-Q40 PolarHBondContact O-N 3.05Å; Q40-S43 PolarHBondContact O-N 3.18Å; Q40-I44 VanDerWaalsContact O-CG1 3.31Å; Q40-I44 WeakPolarHBondContact O-CG1 3.47Å; Q40-I44 PolarHBondContact O-N 3.27Å
41	Y	72.9	Confident	74.9	Confident	151 Å²	151	108.4 Å²	108.4	59%	0.592	57%	0.571	S	S	*	*	H	α-helix	trans	-63.7	-42.8	177.4	-175	-101.2	0	0	0	112.1	T37 R38 T39 S43 I44 Q45	T37-Y41 PolarHBondContact O-N 3.23Å; R38-Y41 PolarHBondContact O-N 2.89Å; T39-Y41 PolarHBondContact O-N 3.33Å; Y41-S43 VanDerWaalsContact C-N 3.33Å; Y41-S43 PolarHBondContact O-N 3.3Å; Y41-I44 PolarHBondContact O-N 3.35Å; Y41-Q45 HydrophobicContact CE1-CB 4.5Å; Y41-Q45 VanDerWaalsContact O-CB 3.24Å; Y41-Q45 WeakPolarHBondContact O-CB 3.41Å; Y41-Q45 PolarHBondContact O-N 3.37Å
42	L	73	Confident	74.3	Confident	90 Å²	90	111.7 Å²	111.7	47%	0.471	59%	0.585	S	S	.	*	H	α-helix	trans	-60.3	-42.8	175.1	-77.8	160.7	0	0	0	111.7	R38 T39 Q45 T46	R38-L42 HydrophobicContact CG-CD1 4.04Å; R38-L42 WeakPolarHBondContact O-CB 3.41Å; R38-L42 WeakPolarHBondContact O-CG 3.26Å; R38-L42 PolarHBondContact O-N 3.46Å; T39-L42 PolarHBondContact O-N 3.18Å; L42-Q45 PolarHBondContact O-N 3.12Å; L42-T46 PolarHBondContact O-N 3.39Å; L42-T46 VanDerWaalsContact O-N 3.16Å; L42-T46 PolarHBondContact O-OG1 2.86Å; L42-T46 VanDerWaalsContact O-OG1 3.13Å
43	S	73.9	Confident	73.8	Confident	75 Å²	75	112.3 Å²	112.3	52%	0.524	59%	0.588	S	S	.	*	H	α-helix	trans	-65	-36.5	176.7	-59.5	0	0	0	0	113	T39 Q40 Y41 T46	T39-S43 PolarHBondContact O-N 2.93Å; T39-S43 PolarHBondContact O-OG 2.99Å; Q40-S43 PolarHBondContact O-N 3.18Å; Y41-S43 VanDerWaalsContact C-N 3.33Å; Y41-S43 PolarHBondContact O-N 3.3Å; S43-T46 PolarHBondContact O-OG1 3.1Å
44	I	73.7	Confident	73.4	Confident	139 Å²	139	114.4 Å²	114.4	71%	0.713	59%	0.594	S	S	*	*	H	α-helix	trans	-77.2	-32	177.5	-66.8	165.3	0	0	0	111.3	Q40 Y41	Q40-I44 VanDerWaalsContact O-CG1 3.31Å; Q40-I44 WeakPolarHBondContact O-CG1 3.47Å; Q40-I44 PolarHBondContact O-N 3.27Å; Y41-I44 PolarHBondContact O-N 3.35Å
45	Q	73.4	Confident	72.8	Confident	122 Å²	122	113.4 Å²	113.4	57%	0.57	59%	0.594	S	S	*	*	H	α-helix	trans	-74.6	-26.6	-179.4	-174	179.9	-17.1	0	0	112.2	Y41 L42 P47	Y41-Q45 HydrophobicContact CE1-CB 4.5Å; Y41-Q45 VanDerWaalsContact O-CB 3.24Å; Y41-Q45 WeakPolarHBondContact O-CB 3.41Å; Y41-Q45 PolarHBondContact O-N 3.37Å; L42-Q45 PolarHBondContact O-N 3.12Å; Q45-P47 WeakPolarHBondContact O-CD 3.37Å
46	T	64.1	Low	72.5	Confident	97 Å²	97	111.8 Å²	111.8	60%	0.595	60%	0.6	S	S	*	*			trans	-70.8	112.6	168.1	34	0	0	0	0	109.9	L42 S43	L42-T46 PolarHBondContact O-N 3.39Å; L42-T46 VanDerWaalsContact O-N 3.16Å; L42-T46 PolarHBondContact O-OG1 2.86Å; L42-T46 VanDerWaalsContact O-OG1 3.13Å; S43-T46 PolarHBondContact O-OG1 3.1Å
47	P	61.1	Low	72.2	Confident	196 Å²	196	119.5 Å²	119.5	100%	1.273	63%	0.629	S	S	*	*			trans	-68.7	0	178.1	31.2	-35.5	0	0	0	112.9	Q45	Q45-P47 WeakPolarHBondContact O-CD 3.37Å

Retrieved 47 of 47 residues in 12.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).