G4VKG8_SCHMA Loading...

4F5 domain-containing protein

AlphaFold DB , UniProt , Accession G4VKG8, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 74 aa.

						>G4VKG8_SCHMA|G4VKG8
MARGQQKIQSQQRNAKKQADLKKPAIDSKKAAAKALHHTCPVCKTQVPDVKTYKQHFENKHPKNPLPQELLEVV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.6	Low	80.3	Confident	230 Å²	230	120.7 Å²	120.7	100%	1.133	61%	0.607	S	S	*	*				0	12.7	0	-67.8	179.9	-87.2	0	0	114.7	R3	M1-R3 PolarHBondContact O-N 2.87Å
2	A	67.8	Low	81	Confident	69 Å²	69	121.3 Å²	121.3	57%	0.57	61%	0.606	S	S	*	*	H	α-helix	trans	-71.5	-18.1	-177.7	0	0	0	0	0	115.9	G4 Q6	A2-G4 PolarHBondContact O-N 2.92Å; A2-Q6 PolarHBondContact O-N 2.9Å
3	R	75.2	Confident	81.5	Confident	223 Å²	223	122.6 Å²	122.6	84%	0.842	60%	0.599	S	S	*	*	H	α-helix	trans	-67.7	-31.3	-179.3	-86	-175.3	153.3	105.5	-0.7	113.7	M1 K7	M1-R3 PolarHBondContact O-N 2.87Å; R3-K7 PolarHBondContact O-N 3.31Å
4	G	78.7	Confident	81.9	Confident	42 Å²	42	120.5 Å²	120.5	43%	0.433	59%	0.592	S	S	.	*	H	α-helix	trans	-69.3	-46.9	-179	0	0	0	0	0	112.8	A2 Q6 K7 I8	A2-G4 PolarHBondContact O-N 2.92Å; G4-Q6 PolarHBondContact O-N 3.1Å; G4-K7 PolarHBondContact O-N 2.88Å; G4-I8 WeakPolarHBondContact O-CG1 3.49Å; G4-I8 PolarHBondContact O-N 3.08Å; G4-I8 VanDerWaalsContact O-N 3.11Å
5	Q	83.9	Confident	82.2	Confident	133 Å²	133	116.2 Å²	116.2	62%	0.621	58%	0.583	S	S	*	*	H	α-helix	trans	-64.1	-40.2	179.1	-69.1	179.5	-2.6	0	0	112.1	K7 I8 Q9	Q5-K7 VanDerWaalsContact C-N 3.31Å; Q5-K7 PolarHBondContact O-N 3.04Å; Q5-I8 PolarHBondContact O-N 3.41Å; Q5-Q9 WeakPolarHBondContact O-CB 3.11Å; Q5-Q9 WeakPolarHBondContact O-CG 3.28Å; Q5-Q9 PolarHBondContact O-N 3.15Å
6	Q	82.9	Confident	82.4	Confident	126 Å²	126	119.5 Å²	119.5	59%	0.589	59%	0.593	S	S	*	*	H	α-helix	trans	-60.9	-39.8	175.2	-80.8	-176.6	0.9	0	0	112.4	A2 G4 S10	A2-Q6 PolarHBondContact O-N 2.9Å; G4-Q6 PolarHBondContact O-N 3.1Å; Q6-S10 VanDerWaalsContact O-CB 3.31Å; Q6-S10 WeakPolarHBondContact O-CB 3.43Å; Q6-S10 PolarHBondContact O-N 3.14Å; Q6-S10 PolarHBondContact O-OG 2.75Å
7	K	85.7	Confident	82.5	Confident	144 Å²	144	121.4 Å²	121.4	63%	0.626	60%	0.597	S	S	*	*	H	α-helix	trans	-65	-44.9	177.3	-170.1	178.3	-179.1	-179.9	0	111.3	R3 G4 Q5 S10 Q11	R3-K7 PolarHBondContact O-N 3.31Å; G4-K7 PolarHBondContact O-N 2.88Å; Q5-K7 VanDerWaalsContact C-N 3.31Å; Q5-K7 PolarHBondContact O-N 3.04Å; K7-S10 PolarHBondContact O-N 3.05Å; K7-Q11 WeakPolarHBondContact O-CG 3.43Å; K7-Q11 PolarHBondContact O-N 3.48Å
8	I	86.5	Confident	82.4	Confident	96 Å²	96	120.2 Å²	120.2	49%	0.492	59%	0.589	S	S	.	*	H	α-helix	trans	-64.9	-46.9	179.2	-64.5	164.3	0	0	0	111	G4 Q5 S10 Q11 Q12	G4-I8 WeakPolarHBondContact O-CG1 3.49Å; G4-I8 PolarHBondContact O-N 3.08Å; G4-I8 VanDerWaalsContact O-N 3.11Å; Q5-I8 PolarHBondContact O-N 3.41Å; I8-S10 VanDerWaalsContact C-N 3.27Å; I8-S10 PolarHBondContact O-N 2.85Å; I8-Q11 PolarHBondContact O-N 3.34Å; I8-Q12 PolarHBondContact O-N 3.08Å
9	Q	87.5	Confident	82.4	Confident	95 Å²	95	116.7 Å²	116.7	44%	0.444	58%	0.582	S	S	.	*	H	α-helix	trans	-60.3	-39.2	176.4	-72.5	-179.2	37	0	0	111.9	Q5 Q12 R13	Q5-Q9 WeakPolarHBondContact O-CB 3.11Å; Q5-Q9 WeakPolarHBondContact O-CG 3.28Å; Q5-Q9 PolarHBondContact O-N 3.15Å; Q9-Q12 PolarHBondContact O-N 3.35Å; Q9-R13 WeakPolarHBondContact O-CB 3.42Å; Q9-R13 WeakPolarHBondContact O-CG 3.37Å; Q9-R13 PolarHBondContact O-N 3.32Å
10	S	86.9	Confident	82	Confident	55 Å²	55	116.2 Å²	116.2	39%	0.385	58%	0.581	S	S	.	*	H	α-helix	trans	-67.4	-39.8	178.1	-58.4	0	0	0	0	111.9	Q6 K7 I8 R13 N14	Q6-S10 VanDerWaalsContact O-CB 3.31Å; Q6-S10 WeakPolarHBondContact O-CB 3.43Å; Q6-S10 PolarHBondContact O-N 3.14Å; Q6-S10 PolarHBondContact O-OG 2.75Å; K7-S10 PolarHBondContact O-N 3.05Å; I8-S10 VanDerWaalsContact C-N 3.27Å; I8-S10 PolarHBondContact O-N 2.85Å; S10-R13 PolarHBondContact O-N 2.64Å; S10-R13 PolarHBondContact OG-NH2 2.82Å; S10-N14 WeakPolarHBondContact O-CB 3.22Å; S10-N14 PolarHBondContact O-N 3.49Å
11	Q	86.7	Confident	81.5	Confident	115 Å²	115	118 Å²	118	54%	0.537	59%	0.593	S	S	.	*	H	α-helix	trans	-64.6	-44.1	173.5	-71.8	178.5	35.4	0	0	111.9	K7 I8 N14 A15	K7-Q11 WeakPolarHBondContact O-CG 3.43Å; K7-Q11 PolarHBondContact O-N 3.48Å; I8-Q11 PolarHBondContact O-N 3.34Å; Q11-N14 PolarHBondContact O-N 2.92Å; Q11-A15 VanDerWaalsContact O-CB 3.27Å; Q11-A15 WeakPolarHBondContact O-CB 3.41Å; Q11-A15 PolarHBondContact O-N 3.26Å
12	Q	88.4	Confident	82	Confident	128 Å²	128	114.9 Å²	114.9	60%	0.598	57%	0.573	S	S	*	*	H	α-helix	trans	-62	-43.5	176.1	-75.4	-179.5	1.8	0	0	112	I8 Q9 N14 A15 K16	I8-Q12 PolarHBondContact O-N 3.08Å; Q9-Q12 PolarHBondContact O-N 3.35Å; Q12-N14 PolarHBondContact O-N 3.4Å; Q12-A15 PolarHBondContact O-N 3.23Å; Q12-K16 WeakPolarHBondContact O-CB 3.15Å; Q12-K16 PolarHBondContact O-N 2.88Å
13	R	88.4	Confident	82.1	Confident	138 Å²	138	117.6 Å²	117.6	52%	0.521	57%	0.571	S	S	.	*	H	α-helix	trans	-61.4	-43.6	174.8	-75.3	-171	-65.3	-116	2.1	111.6	Q9 S10 K16 K17	Q9-R13 WeakPolarHBondContact O-CB 3.42Å; Q9-R13 WeakPolarHBondContact O-CG 3.37Å; Q9-R13 PolarHBondContact O-N 3.32Å; S10-R13 PolarHBondContact O-N 2.64Å; S10-R13 PolarHBondContact OG-NH2 2.82Å; R13-K16 PolarHBondContact O-N 3.26Å; R13-K17 WeakPolarHBondContact O-CG 3.21Å; R13-K17 PolarHBondContact O-N 2.84Å
14	N	86.2	Confident	81.5	Confident	93 Å²	93	112.4 Å²	112.4	50%	0.497	57%	0.567	S	S	.	*	H	α-helix	trans	-68.7	-41	179.2	-162.7	46.5	0	0	0	112	S10 Q11 Q12 K17 Q18	S10-N14 WeakPolarHBondContact O-CB 3.22Å; S10-N14 PolarHBondContact O-N 3.49Å; Q11-N14 PolarHBondContact O-N 2.92Å; Q12-N14 PolarHBondContact O-N 3.4Å; N14-K17 PolarHBondContact O-N 3.45Å; N14-Q18 PolarHBondContact ND2-NE2 3.23Å; N14-Q18 WeakPolarHBondContact O-CB 3.23Å; N14-Q18 WeakPolarHBondContact O-CG 3.11Å; N14-Q18 PolarHBondContact O-N 3.48Å
15	A	86.5	Confident	80.8	Confident	56 Å²	56	114.5 Å²	114.5	46%	0.463	58%	0.579	S	S	.	*	H	α-helix	trans	-62.7	-41.3	175.1	0	0	0	0	0	111.5	Q11 Q12 Q18 A19	Q11-A15 VanDerWaalsContact O-CB 3.27Å; Q11-A15 WeakPolarHBondContact O-CB 3.41Å; Q11-A15 PolarHBondContact O-N 3.26Å; Q12-A15 PolarHBondContact O-N 3.23Å; A15-Q18 PolarHBondContact O-N 3.31Å; A15-A19 VanDerWaalsContact O-CB 3.32Å; A15-A19 WeakPolarHBondContact O-CB 3.4Å; A15-A19 PolarHBondContact O-N 3.39Å
16	K	86	Confident	79.8	Confident	169 Å²	169	115 Å²	115	74%	0.735	59%	0.585	S	S	*	*	H	α-helix	trans	-66.2	-42.5	175.9	-168.8	173.1	-180	179.5	0	112.1	Q12 R13 A19 D20	Q12-K16 WeakPolarHBondContact O-CB 3.15Å; Q12-K16 PolarHBondContact O-N 2.88Å; R13-K16 PolarHBondContact O-N 3.26Å; K16-A19 PolarHBondContact O-N 2.9Å; K16-D20 WeakPolarHBondContact O-CB 3.21Å; K16-D20 PolarHBondContact O-N 2.82Å
17	K	84.5	Confident	79	Confident	151 Å²	151	113.4 Å²	113.4	66%	0.657	58%	0.58	S	S	*	*	H	α-helix	trans	-61.6	-44.9	173.8	-74.7	-179.1	179.7	-168.7	0	111.9	R13 N14 D20 L21	R13-K17 WeakPolarHBondContact O-CG 3.21Å; R13-K17 PolarHBondContact O-N 2.84Å; N14-K17 PolarHBondContact O-N 3.45Å; K17-D20 PolarHBondContact O-N 3.49Å; K17-L21 WeakPolarHBondContact O-CB 3.1Å; K17-L21 PolarHBondContact O-N 3.09Å
18	Q	80.6	Confident	77.9	Confident	100 Å²	100	110.6 Å²	110.6	47%	0.467	58%	0.579	S	S	.	*	H	α-helix	trans	-65.8	-37.8	176.5	-74	-167.9	87.2	0	0	112.1	N14 A15 D20 L21 K22	N14-Q18 PolarHBondContact ND2-NE2 3.23Å; N14-Q18 WeakPolarHBondContact O-CB 3.23Å; N14-Q18 WeakPolarHBondContact O-CG 3.11Å; N14-Q18 PolarHBondContact O-N 3.48Å; A15-Q18 PolarHBondContact O-N 3.31Å; Q18-D20 VanDerWaalsContact C-N 3.33Å; Q18-L21 PolarHBondContact O-N 2.78Å; Q18-K22 VanDerWaalsContact O-CB 3.29Å; Q18-K22 WeakPolarHBondContact O-CB 3.49Å; Q18-K22 WeakPolarHBondContact O-CG 3.45Å; Q18-K22 PolarHBondContact O-N 3.12Å
19	A	80.9	Confident	77	Confident	55 Å²	55	114.5 Å²	114.5	46%	0.455	59%	0.593	S	S	.	*	H	α-helix	trans	-65	-37.9	174.8	0	0	0	0	0	111.8	A15 K16 K22 K23	A15-A19 VanDerWaalsContact O-CB 3.32Å; A15-A19 WeakPolarHBondContact O-CB 3.4Å; A15-A19 PolarHBondContact O-N 3.39Å; K16-A19 PolarHBondContact O-N 2.9Å; A19-K22 PolarHBondContact O-N 3.39Å; A19-K23 PolarHBondContact O-N 3.21Å; A19-K23 VanDerWaalsContact O-N 3.09Å
20	D	75.8	Confident	76.1	Confident	105 Å²	105	116.3 Å²	116.3	56%	0.561	60%	0.599	S	S	*	*	H	α-helix	trans	-68.8	-41.2	176.4	-159.1	-111.6	0	0	0	112.3	K16 K17 Q18 K22 K23	K16-D20 WeakPolarHBondContact O-CB 3.21Å; K16-D20 PolarHBondContact O-N 2.82Å; K17-D20 PolarHBondContact O-N 3.49Å; Q18-D20 VanDerWaalsContact C-N 3.33Å; D20-K22 VanDerWaalsContact C-N 3.27Å; D20-K22 PolarHBondContact O-N 3.23Å; D20-K23 WeakPolarHBondContact O-CB 3.46Å; D20-K23 PolarHBondContact O-N 2.84Å; D20-K23 WeakPolarHBondContact OD2-CD 3.49Å; D20-K23 VanDerWaalsContact OD2-CE 3.29Å; D20-K23 WeakPolarHBondContact OD2-CE 3.23Å
21	L	71.7	Confident	75.1	Confident	156 Å²	156	116.4 Å²	116.4	82%	0.817	60%	0.603	S	S	*	*	H	α-helix	trans	-68	-26.8	175.2	-142	72.4	0	0	0	113.1	K17 Q18	K17-L21 WeakPolarHBondContact O-CB 3.1Å; K17-L21 PolarHBondContact O-N 3.09Å; Q18-L21 PolarHBondContact O-N 2.78Å
22	K	71.3	Confident	74.1	Confident	164 Å²	164	113.5 Å²	113.5	71%	0.713	60%	0.599	S	S	*	*	H	α-helix	trans	-83.4	-17.5	175.5	-76	177.3	-176.5	-165.2	0	113.5	Q18 A19 D20	Q18-K22 VanDerWaalsContact O-CB 3.29Å; Q18-K22 WeakPolarHBondContact O-CB 3.49Å; Q18-K22 WeakPolarHBondContact O-CG 3.45Å; Q18-K22 PolarHBondContact O-N 3.12Å; A19-K22 PolarHBondContact O-N 3.39Å; D20-K22 VanDerWaalsContact C-N 3.27Å; D20-K22 PolarHBondContact O-N 3.23Å
23	K	70.3	Confident	73.1	Confident	126 Å²	126	110.2 Å²	110.2	55%	0.548	59%	0.593	S	S	.	*	S	Bend	trans	-56.2	128.5	163.3	-64.3	165.6	-170.5	-77.9	0	104.3	A19 D20 A25	A19-K23 PolarHBondContact O-N 3.21Å; A19-K23 VanDerWaalsContact O-N 3.09Å; D20-K23 WeakPolarHBondContact O-CB 3.46Å; D20-K23 PolarHBondContact O-N 2.84Å; D20-K23 WeakPolarHBondContact OD2-CD 3.49Å; D20-K23 VanDerWaalsContact OD2-CE 3.29Å; D20-K23 WeakPolarHBondContact OD2-CE 3.23Å; K23-A25 VanDerWaalsContact C-N 3.34Å; K23-A25 PolarHBondContact O-N 3.1Å
24	P	62.5	Low	72.1	Confident	114 Å²	114	110.3 Å²	110.3	74%	0.74	60%	0.597	S	S	*	*			trans	-53.7	111.7	173.9	23.8	-31.7	0	0	0	104.7	I26	P24-I26 PolarHBondContact O-N 2.84Å
25	A	63.2	Low	71.3	Confident	85 Å²	85	107.8 Å²	107.8	70%	0.702	59%	0.59	S	S	*	*			trans	-53.9	107.6	168	0	0	0	0	0	102.3	K23 D27	K23-A25 VanDerWaalsContact C-N 3.34Å; K23-A25 PolarHBondContact O-N 3.1Å; A25-D27 VanDerWaalsContact C-N 3.25Å; A25-D27 WeakPolarHBondContact O-CA 3.22Å; A25-D27 PolarHBondContact O-N 3.16Å
26	I	63.8	Low	70.7	Confident	144 Å²	144	108.1 Å²	108.1	74%	0.738	58%	0.583	S	S	*	*			trans	-50.3	109.5	170.8	-67.1	171.4	0	0	0	101.7	P24 S28	P24-I26 PolarHBondContact O-N 2.84Å; I26-S28 WeakPolarHBondContact O-CA 3.36Å; I26-S28 PolarHBondContact O-N 3.43Å; I26-S28 PolarHBondContact O-OG 3.01Å
27	D	64.8	Low	70.3	Confident	92 Å²	92	106.6 Å²	106.6	49%	0.492	58%	0.579	S	S	.	*			trans	-67.8	85	-160.8	-172.2	-83.3	0	0	0	107.1	A25 K29 K30 A31	A25-D27 VanDerWaalsContact C-N 3.25Å; A25-D27 WeakPolarHBondContact O-CA 3.22Å; A25-D27 PolarHBondContact O-N 3.16Å; D27-K29 PolarHBondContact O-N 3.36Å; D27-K30 HydrophobicContact CB-CB 4.3Å; D27-K30 PolarHBondContact O-N 3.29Å; D27-K30 VanDerWaalsContact O-N 3.13Å; D27-K30 WeakPolarHBondContact OD1-CA 3.38Å; D27-K30 WeakPolarHBondContact OD1-CB 3.47Å; D27-K30 PolarHBondContact OD1-N 3.2Å; D27-A31 PolarHBondContact O-N 2.99Å
28	S	64.2	Low	70	Confident	85 Å²	85	101.1 Å²	101.1	59%	0.594	56%	0.555	S	S	*	*	H	α-helix	trans	-71.3	-20.1	-168.3	-61.3	0	0	0	0	108.2	I26 A32	I26-S28 WeakPolarHBondContact O-CA 3.36Å; I26-S28 PolarHBondContact O-N 3.43Å; I26-S28 PolarHBondContact O-OG 3.01Å; S28-A32 WeakPolarHBondContact O-CB 3.01Å; S28-A32 PolarHBondContact O-N 2.85Å
29	K	67.5	Low	70.1	Confident	179 Å²	179	99.3 Å²	99.3	78%	0.778	55%	0.551	S	S	*	*	H	α-helix	trans	-67.5	-48.9	170.6	-69.4	-172.1	177.7	-173.7	0	111.9	D27 A32 A33	D27-K29 PolarHBondContact O-N 3.36Å; K29-A32 PolarHBondContact O-N 3.46Å; K29-A33 WeakPolarHBondContact O-CB 3.48Å; K29-A33 PolarHBondContact O-N 3.38Å
30	K	67.3	Low	70.3	Confident	133 Å²	133	96.7 Å²	96.7	58%	0.578	53%	0.53	S	S	*	.	H	α-helix	trans	-71.5	-37.1	177.4	-173.9	175.8	-171	177.4	0	111.2	D27 K34	D27-K30 HydrophobicContact CB-CB 4.3Å; D27-K30 PolarHBondContact O-N 3.29Å; D27-K30 VanDerWaalsContact O-N 3.13Å; D27-K30 WeakPolarHBondContact OD1-CA 3.38Å; D27-K30 WeakPolarHBondContact OD1-CB 3.47Å; D27-K30 PolarHBondContact OD1-N 3.2Å; K30-K34 VanDerWaalsContact O-CB 3.3Å; K30-K34 WeakPolarHBondContact O-CB 3.11Å; K30-K34 VanDerWaalsContact O-CG 3.23Å; K30-K34 WeakPolarHBondContact O-CG 3.27Å; K30-K34 PolarHBondContact O-N 3.41Å
31	A	66.8	Low	70.6	Confident	57 Å²	57	95.1 Å²	95.1	47%	0.471	53%	0.525	S	S	.	.	H	α-helix	trans	-63.4	-45.5	172.3	0	0	0	0	0	111.4	D27 K34 A35	D27-A31 PolarHBondContact O-N 2.99Å; A31-K34 PolarHBondContact O-N 3.08Å; A31-A35 PolarHBondContact O-N 3.22Å
32	A	66.3	Low	71.2	Confident	54 Å²	54	90.8 Å²	90.8	45%	0.446	51%	0.505	S	S	.	.	H	α-helix	trans	-65.7	-43.4	175.9	0	0	0	0	0	112.2	S28 K29 K34 A35 L36	S28-A32 WeakPolarHBondContact O-CB 3.01Å; S28-A32 PolarHBondContact O-N 2.85Å; K29-A32 PolarHBondContact O-N 3.46Å; A32-K34 VanDerWaalsContact C-N 3.29Å; A32-K34 PolarHBondContact O-N 2.9Å; A32-A35 WeakPolarHBondContact O-CB 3.05Å; A32-A35 PolarHBondContact O-N 2.57Å; A32-A35 VanDerWaalsContact O-N 3.08Å; A32-L36 WeakPolarHBondContact O-CG 3.43Å; A32-L36 PolarHBondContact O-N 3.13Å
33	A	67.3	Low	72.1	Confident	59 Å²	59	85.6 Å²	85.6	49%	0.488	49%	0.488	S	S	.	.	H	α-helix	trans	-63.4	-36.6	176.9	0	0	0	0	0	111.9	K29 A35 L36	K29-A33 WeakPolarHBondContact O-CB 3.48Å; K29-A33 PolarHBondContact O-N 3.38Å; A33-A35 VanDerWaalsContact C-N 3.32Å; A33-L36 PolarHBondContact O-N 2.68Å
34	K	66.6	Low	72.7	Confident	139 Å²	139	87.6 Å²	87.6	60%	0.604	50%	0.497	S	S	*	.	H	α-helix	trans	-67.1	-34	172.4	-78.7	-178.7	176	-156.6	0	112.4	K30 A31 A32 L36 H37	K30-K34 VanDerWaalsContact O-CB 3.3Å; K30-K34 WeakPolarHBondContact O-CB 3.11Å; K30-K34 VanDerWaalsContact O-CG 3.23Å; K30-K34 WeakPolarHBondContact O-CG 3.27Å; K30-K34 PolarHBondContact O-N 3.41Å; A31-K34 PolarHBondContact O-N 3.08Å; A32-K34 VanDerWaalsContact C-N 3.29Å; A32-K34 PolarHBondContact O-N 2.9Å; K34-L36 PolarHBondContact O-N 2.8Å; K34-H37 PolarHBondContact O-CE1 2.75Å; K34-H37 PolarHBondContact O-ND1 2.92Å; K34-H37 PolarHBondContact O-NE2 3.39Å; K34-H37 VanDerWaalsContact O-NE2 3.1Å
35	A	70.3	Confident	73.7	Confident	41 Å²	41	85.3 Å²	85.3	34%	0.339	48%	0.481	S	S	.	.	H	α-helix	trans	-70.2	-20.4	177.6	0	0	0	0	0	112.6	A31 A32 A33 H37 P48	A31-A35 PolarHBondContact O-N 3.22Å; A32-A35 WeakPolarHBondContact O-CB 3.05Å; A32-A35 PolarHBondContact O-N 2.57Å; A32-A35 VanDerWaalsContact O-N 3.08Å; A33-A35 VanDerWaalsContact C-N 3.32Å; A35-H37 VanDerWaalsContact C-N 3.32Å; A35-H37 PolarHBondContact O-CD2 2.75Å; A35-H37 PolarHBondContact O-N 2.8Å; A35-P48 CarbonylContact O-C 3.48Å; A35-P48 WeakPolarHBondContact O-CA 3.3Å
36	L	73.2	Confident	74.6	Confident	62 Å²	62	86.3 Å²	86.3	33%	0.325	47%	0.471	S	S	.	.			trans	-78.8	76.8	175.8	-65.7	178.1	0	0	0	111.1	A32 A33 K34 Q46 P48	A32-L36 WeakPolarHBondContact O-CG 3.43Å; A32-L36 PolarHBondContact O-N 3.13Å; A33-L36 PolarHBondContact O-N 2.68Å; K34-L36 PolarHBondContact O-N 2.8Å; L36-Q46 HydrophobicContact CB-CB 3.99Å; L36-Q46 HydrophobicContact CD1-CB 4.14Å; L36-Q46 HydrophobicContact CG-CB 4.43Å; L36-P48 HydrophobicContact CD2-CB 3.99Å; L36-P48 HydrophobicContact CD2-CG 4.14Å
37	H	76.4	Confident	75.5	Confident	137 Å²	137	79.8 Å²	79.8	63%	0.634	44%	0.438	S	S	*	.			trans	-82.4	-30.9	-174.2	-66.4	-68.6	0	0	0	114.3	K34 A35	K34-H37 PolarHBondContact O-CE1 2.75Å; K34-H37 PolarHBondContact O-ND1 2.92Å; K34-H37 PolarHBondContact O-NE2 3.39Å; K34-H37 VanDerWaalsContact O-NE2 3.1Å; A35-H37 VanDerWaalsContact C-N 3.32Å; A35-H37 PolarHBondContact O-CD2 2.75Å; A35-H37 PolarHBondContact O-N 2.8Å
38	H	79.4	Confident	76.2	Confident	36 Å²	36	78.1 Å²	78.1	17%	0.167	43%	0.432	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.8	131.8	-169.8	-52.6	-76.1	0	0	0	110.4	Q46 V47 V50 Y53	H38-Q46 CarbonylContact O-C 3.51Å; H38-Q46 VanDerWaalsContact O-CA 3.27Å; H38-Q46 WeakPolarHBondContact O-CA 3.23Å; H38-V47 HydrophobicContact CB-CG2 3.75Å; H38-V47 PolarHBondContact N-O 2.96Å; H38-V47 PolarHBondContact O-N 3.09Å; H38-V50 WeakPolarHBondContact NE2-CG2 3.35Å; H38-Y53 HydrophobicContact CB-CD1 3.87Å; H38-Y53 HydrophobicContact CB-CE1 4.29Å; H38-Y53 HydrophobicContact CB-CG 4.22Å
39	T	82.4	Confident	77	Confident	63 Å²	63	77 Å²	77	39%	0.387	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.5	124.3	178	-61.7	0	0	0	0	109.4	P41	T39-P41 WeakPolarHBondContact O-CD 3.46Å
40	C	84.4	Confident	77.6	Confident	0 Å²	0	70.6 Å²	70.6	0%	0	40%	0.395	C	S	.	.			trans	-65.6	124.9	176.3	-178	0	0	0	0	111.1	V42 C43 K44 T45 Y53 H56	C40-V42 PolarHBondContact O-N 2.77Å; C40-C43 PolarHBondContact SG-SG 3.24Å; C40-K44 WeakPolarHBondContact O-CA 3.21Å; C40-K44 PolarHBondContact O-N 3.47Å; C40-T45 PolarHBondContact N-O 3.3Å; C40-Y53 HydrophobicContact CB-CE2 3.87Å; C40-H56 PolarHBondContact SG-NE2 3.28Å; C40-H56 VanDerWaalsContact SG-NE2 3.39Å
41	P	83	Confident	78.3	Confident	72 Å²	72	72.3 Å²	72.3	47%	0.468	40%	0.403	S	S	.	.	T	Hydrogen-bonded Turn	trans	-71	-21.2	179.3	27.7	-34.1	0	0	0	112.5	T39 Y53 P67	T39-P41 WeakPolarHBondContact O-CD 3.46Å; P41-Y53 WeakPolarHBondContact CD-OH 3.29Å; P41-P67 HydrophobicContact CG-CB 3.93Å; P41-P67 HydrophobicContact CG-CG 4.08Å
42	V	85	Confident	79.1	Confident	65 Å²	65	72.2 Å²	72.2	39%	0.394	40%	0.397	S	S	.	.	T	Hydrogen-bonded Turn	trans	-84.1	-46.4	-177.5	-172.2	0	0	0	0	111.6	C40 F57 H61	C40-V42 PolarHBondContact O-N 2.77Å; V42-F57 HydrophobicContact CG2-CE2 3.89Å; V42-F57 HydrophobicContact CG2-CZ 4.41Å; V42-H61 WeakPolarHBondContact CG1-CE1 3.38Å; V42-H61 WeakPolarHBondContact CG1-ND1 3.45Å
43	C	89.1	Confident	79.9	Confident	54 Å²	54	69.6 Å²	69.6	37%	0.365	38%	0.375	S	S	.	.	T	Hydrogen-bonded Turn	trans	-119.1	0.7	-175.2	67.4	0	0	0	0	114.7	C40 T45 H56 H61	C40-C43 PolarHBondContact SG-SG 3.24Å; C43-T45 PolarHBondContact O-N 2.94Å; C43-T45 VanDerWaalsContact O-N 3.09Å; C43-T45 PolarHBondContact SG-OG1 2.94Å; C43-H56 PolarHBondContact SG-CE1 3.32Å; C43-H56 PolarHBondContact SG-NE2 2.72Å; C43-H61 PolarHBondContact SG-NE2 3.11Å
44	K	83.3	Confident	80.6	Confident	169 Å²	169	71.8 Å²	71.8	74%	0.735	37%	0.374	S	S	*	.			trans	58.8	16.5	-178.7	-55.9	-178.8	-179.8	-179.9	0	114.9	C40 Q46	C40-K44 WeakPolarHBondContact O-CA 3.21Å; C40-K44 PolarHBondContact O-N 3.47Å; K44-Q46 PolarHBondContact O-N 3.42Å
45	T	83.6	Confident	81.4	Confident	65 Å²	65	71 Å²	71	40%	0.399	37%	0.372	S	S	.	.			trans	-69.1	130.7	173.1	-61.7	0	0	0	0	109.3	C40 C43 V47	C40-T45 PolarHBondContact N-O 3.3Å; C43-T45 PolarHBondContact O-N 2.94Å; C43-T45 VanDerWaalsContact O-N 3.09Å; C43-T45 PolarHBondContact SG-OG1 2.94Å; T45-V47 HydrophobicContact CG2-CG1 4.22Å
46	Q	81.6	Confident	82.3	Confident	106 Å²	106	70.5 Å²	70.5	50%	0.495	36%	0.363	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.1	131	173.6	-58.3	177.7	-2.9	0	0	109.4	L36 H38 K44	L36-Q46 HydrophobicContact CB-CB 3.99Å; L36-Q46 HydrophobicContact CD1-CB 4.14Å; L36-Q46 HydrophobicContact CG-CB 4.43Å; H38-Q46 CarbonylContact O-C 3.51Å; H38-Q46 VanDerWaalsContact O-CA 3.27Å; H38-Q46 WeakPolarHBondContact O-CA 3.23Å; K44-Q46 PolarHBondContact O-N 3.42Å
47	V	82.2	Confident	82.8	Confident	7 Å²	7	67.8 Å²	67.8	4%	0.042	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.6	143.4	-179.9	-65.1	0	0	0	0	110.3	H38 T45 T52 Y53	H38-V47 HydrophobicContact CB-CG2 3.75Å; H38-V47 PolarHBondContact N-O 2.96Å; H38-V47 PolarHBondContact O-N 3.09Å; T45-V47 HydrophobicContact CG2-CG1 4.22Å; V47-T52 HydrophobicContact CB-CG2 4.48Å; V47-T52 HydrophobicContact CG1-CG2 4.43Å; V47-Y53 HydrophobicContact CG2-CD1 4.46Å; V47-Y53 HydrophobicContact CG2-CD2 3.56Å; V47-Y53 HydrophobicContact CG2-CG 3.55Å
48	P	81.3	Confident	83.2	Confident	57 Å²	57	66.5 Å²	66.5	37%	0.37	34%	0.343	S	S	.	.	S	Bend	trans	-76.3	-28.7	-171.2	21.5	-24.2	0	0	0	114.5	A35 L36	A35-P48 CarbonylContact O-C 3.48Å; A35-P48 WeakPolarHBondContact O-CA 3.3Å; L36-P48 HydrophobicContact CD2-CB 3.99Å; L36-P48 HydrophobicContact CD2-CG 4.14Å
49	D	79.1	Confident	83.6	Confident	62 Å²	62	70.2 Å²	70.2	33%	0.332	36%	0.364	S	S	.	.	S	Bend	trans	-140.3	149	-171.2	54.4	-88.4	0	0	0	112.1	K51 T52 Y53	D49-K51 PolarHBondContact O-N 3.43Å; D49-T52 VanDerWaalsContact CG-OG1 3.23Å; D49-T52 PolarHBondContact O-N 2.84Å; D49-T52 PolarHBondContact OD1-OG1 2.88Å; D49-T52 VanDerWaalsContact OD1-OG1 3.12Å; D49-T52 WeakPolarHBondContact OD2-CA 3.37Å; D49-T52 WeakPolarHBondContact OD2-CB 3.45Å; D49-T52 PolarHBondContact OD2-N 3.43Å; D49-T52 PolarHBondContact OD2-OG1 3.34Å; D49-Y53 WeakPolarHBondContact O-CB 3.01Å; D49-Y53 PolarHBondContact O-N 2.91Å
50	V	80.1	Confident	83.8	Confident	44 Å²	44	73.8 Å²	73.8	27%	0.267	37%	0.374	S	S	.	.	H	α-helix	trans	-57.2	-34.2	-179.5	-176.2	0	0	0	0	111.7	H38 Y53 K54 L70 V73	H38-V50 WeakPolarHBondContact NE2-CG2 3.35Å; V50-Y53 WeakPolarHBondContact O-CB 2.87Å; V50-Y53 PolarHBondContact O-N 2.88Å; V50-K54 PolarHBondContact O-N 3.49Å; V50-L70 HydrophobicContact CG1-CD2 3.79Å; V50-V73 HydrophobicContact CG2-CB 4.36Å; V50-V73 HydrophobicContact CG2-CG1 3.82Å
51	K	82.8	Confident	83.9	Confident	169 Å²	169	75 Å²	75	74%	0.735	38%	0.38	S	S	*	.	H	α-helix	trans	-66.3	-50.7	178.8	-175.5	-178.7	178.5	-178.2	0	111.7	D49 Y53 K54 Q55	D49-K51 PolarHBondContact O-N 3.43Å; K51-Y53 PolarHBondContact O-N 2.97Å; K51-K54 PolarHBondContact O-N 3.38Å; K51-Q55 PolarHBondContact O-N 3.46Å; K51-Q55 VanDerWaalsContact O-N 3.08Å
52	T	83.5	Confident	83.7	Confident	55 Å²	55	76.2 Å²	76.2	34%	0.337	39%	0.387	S	S	.	.	H	α-helix	trans	-62.3	-34.6	174.2	-61	0	0	0	0	110.3	V47 D49 Q55 H56	V47-T52 HydrophobicContact CB-CG2 4.48Å; V47-T52 HydrophobicContact CG1-CG2 4.43Å; D49-T52 VanDerWaalsContact CG-OG1 3.23Å; D49-T52 PolarHBondContact O-N 2.84Å; D49-T52 PolarHBondContact OD1-OG1 2.88Å; D49-T52 VanDerWaalsContact OD1-OG1 3.12Å; D49-T52 WeakPolarHBondContact OD2-CA 3.37Å; D49-T52 WeakPolarHBondContact OD2-CB 3.45Å; D49-T52 PolarHBondContact OD2-N 3.43Å; D49-T52 PolarHBondContact OD2-OG1 3.34Å; T52-Q55 PolarHBondContact O-N 3.27Å; T52-H56 WeakPolarHBondContact O-CB 3.32Å; T52-H56 PolarHBondContact O-N 3.41Å
53	Y	82.8	Confident	83.3	Confident	0 Å²	0	82.8 Å²	82.8	0%	0	41%	0.411	C	S	.	.	H	α-helix	trans	-65.5	-45.5	176.6	-167.6	-152.9	0	0	0	113.1	H38 C40 P41 V47 D49 V50 K51 H56 F57 P67 E69 L70	H38-Y53 HydrophobicContact CB-CD1 3.87Å; H38-Y53 HydrophobicContact CB-CE1 4.29Å; H38-Y53 HydrophobicContact CB-CG 4.22Å; C40-Y53 HydrophobicContact CB-CE2 3.87Å; P41-Y53 WeakPolarHBondContact CD-OH 3.29Å; V47-Y53 HydrophobicContact CG2-CD1 4.46Å; V47-Y53 HydrophobicContact CG2-CD2 3.56Å; V47-Y53 HydrophobicContact CG2-CG 3.55Å; D49-Y53 WeakPolarHBondContact O-CB 3.01Å; D49-Y53 PolarHBondContact O-N 2.91Å; V50-Y53 WeakPolarHBondContact O-CB 2.87Å; V50-Y53 PolarHBondContact O-N 2.88Å; K51-Y53 PolarHBondContact O-N 2.97Å; Y53-H56 WeakPolarHBondContact O-CB 3.48Å; Y53-H56 PolarHBondContact O-N 2.93Å; Y53-F57 WeakPolarHBondContact O-CB 3.5Å; Y53-F57 PolarHBondContact O-N 3.47Å; Y53-P67 HydrophobicContact CE1-CG 4.39Å; Y53-P67 WeakPolarHBondContact OH-CG 3.27Å; Y53-E69 HydrophobicContact CE1-CG 4.26Å; Y53-L70 HydrophobicContact CD1-CD1 3.29Å; Y53-L70 HydrophobicContact CD1-CD2 3.55Å; Y53-L70 HydrophobicContact CD1-CG 3.24Å; Y53-L70 HydrophobicContact CD2-CD1 4.23Å; Y53-L70 HydrophobicContact CE1-CD1 3.13Å; Y53-L70 HydrophobicContact CE1-CD2 4.16Å; Y53-L70 HydrophobicContact CE1-CG 3.32Å; Y53-L70 HydrophobicContact CE2-CD1 4.11Å; Y53-L70 HydrophobicContact CG-CD1 3.83Å; Y53-L70 HydrophobicContact CG-CD2 4.09Å; Y53-L70 HydrophobicContact CG-CG 4.11Å
54	K	82.6	Confident	82.6	Confident	104 Å²	104	84 Å²	84	45%	0.452	41%	0.413	S	S	.	.	H	α-helix	trans	-59.3	-48.4	174.3	-176.5	177.4	176.8	177.7	0	111.3	V50 K51 H56 F57 E58 L70	V50-K54 PolarHBondContact O-N 3.49Å; K51-K54 PolarHBondContact O-N 3.38Å; K54-H56 VanDerWaalsContact C-N 3.32Å; K54-H56 PolarHBondContact O-N 3.43Å; K54-F57 PolarHBondContact O-N 2.9Å; K54-F57 VanDerWaalsContact O-N 3.15Å; K54-E58 WeakPolarHBondContact CE-OE1 3.34Å; K54-E58 HydrophobicContact CG-CG 4.43Å; K54-E58 WeakPolarHBondContact O-CG 3.44Å; K54-E58 PolarHBondContact O-N 2.94Å; K54-L70 HydrophobicContact CB-CD2 4.14Å
55	Q	84.3	Confident	82	Confident	122 Å²	122	81.2 Å²	81.2	57%	0.57	41%	0.413	S	S	*	.	H	α-helix	trans	-61.7	-40.4	177	-175	-176.4	-6.6	0	0	112.1	K51 T52 F57 N59	K51-Q55 PolarHBondContact O-N 3.46Å; K51-Q55 VanDerWaalsContact O-N 3.08Å; T52-Q55 PolarHBondContact O-N 3.27Å; Q55-F57 VanDerWaalsContact C-N 3.31Å; Q55-F57 PolarHBondContact O-N 2.79Å; Q55-N59 VanDerWaalsContact O-CB 3.23Å; Q55-N59 WeakPolarHBondContact O-CB 3.35Å; Q55-N59 PolarHBondContact O-N 3.48Å; Q55-N59 VanDerWaalsContact O-N 3.08Å
56	H	87.3	Confident	81.3	Confident	31 Å²	31	81.1 Å²	81.1	14%	0.144	41%	0.41	C	S	.	.	H	α-helix	trans	-58.8	-45.5	174.5	166.6	87.8	0	0	0	110.7	C40 C43 T52 Y53 K54 K60 H61	C40-H56 PolarHBondContact SG-NE2 3.28Å; C40-H56 VanDerWaalsContact SG-NE2 3.39Å; C43-H56 PolarHBondContact SG-CE1 3.32Å; C43-H56 PolarHBondContact SG-NE2 2.72Å; T52-H56 WeakPolarHBondContact O-CB 3.32Å; T52-H56 PolarHBondContact O-N 3.41Å; Y53-H56 WeakPolarHBondContact O-CB 3.48Å; Y53-H56 PolarHBondContact O-N 2.93Å; K54-H56 VanDerWaalsContact C-N 3.32Å; K54-H56 PolarHBondContact O-N 3.43Å; H56-K60 VanDerWaalsContact O-CB 3.22Å; H56-K60 WeakPolarHBondContact O-CB 3.15Å; H56-K60 WeakPolarHBondContact O-CG 3.29Å; H56-K60 PolarHBondContact O-N 3.35Å; H56-H61 AromaticContact NE2-CD2 3.74Å; H56-H61 AromaticContact NE2-NE2 3.58Å
57	F	84.9	Confident	80.7	Confident	5 Å²	5	76.7 Å²	76.7	2%	0.022	39%	0.39	C	S	.	.	H	α-helix	trans	-70.1	-45.6	-177.5	-155	-93.4	0	0	0	112.5	V42 Y53 K54 Q55 N59 H61 N64 P65 L66 P67	V42-F57 HydrophobicContact CG2-CE2 3.89Å; V42-F57 HydrophobicContact CG2-CZ 4.41Å; Y53-F57 WeakPolarHBondContact O-CB 3.5Å; Y53-F57 PolarHBondContact O-N 3.47Å; K54-F57 PolarHBondContact O-N 2.9Å; K54-F57 VanDerWaalsContact O-N 3.15Å; Q55-F57 VanDerWaalsContact C-N 3.31Å; Q55-F57 PolarHBondContact O-N 2.79Å; F57-N59 VanDerWaalsContact C-N 3.29Å; F57-N59 PolarHBondContact O-N 3.22Å; F57-H61 HydrophobicContact CD1-CB 4.38Å; F57-H61 HydrophobicContact CD2-CB 4.08Å; F57-H61 HydrophobicContact CE1-CB 4.31Å; F57-H61 HydrophobicContact CE2-CB 3.99Å; F57-H61 HydrophobicContact CG-CB 4.28Å; F57-H61 HydrophobicContact CZ-CB 4.12Å; F57-H61 CarbonylContact O-C 3.07Å; F57-H61 VanDerWaalsContact O-CA 3.23Å; F57-H61 WeakPolarHBondContact O-CA 3.46Å; F57-H61 PolarHBondContact O-N 2.99Å; F57-N64 HydrophobicContact CE1-CB 3.98Å; F57-N64 VanDerWaalsContact CE1-O 3.22Å; F57-N64 WeakPolarHBondContact CE1-O 3.35Å; F57-N64 HydrophobicContact CE2-CB 4.46Å; F57-N64 HydrophobicContact CZ-CB 3.52Å; F57-P65 VanDerWaalsContact CE1-C 3.47Å; F57-P65 VanDerWaalsContact CE1-O 3.28Å; F57-P65 WeakPolarHBondContact CE1-O 3.33Å; F57-P65 WeakPolarHBondContact CZ-O 3.36Å; F57-L66 HydrophobicContact CB-CD2 4.1Å; F57-L66 HydrophobicContact CD1-CD2 3.57Å; F57-L66 HydrophobicContact CD1-CG 4.11Å; F57-L66 HydrophobicContact CE1-CD2 4.29Å; F57-L66 HydrophobicContact CE1-CG 4.42Å; F57-L66 HydrophobicContact CG-CD2 4.06Å; F57-P67 HydrophobicContact CD2-CG 4.48Å; F57-P67 HydrophobicContact CE2-CG 4.17Å
58	E	84.9	Confident	80	Confident	110 Å²	110	82.9 Å²	82.9	51%	0.514	42%	0.418	S	S	.	.	H	α-helix	trans	-61.2	-35.8	176.6	-70.8	174.2	153.5	0	0	112.3	K54	K54-E58 WeakPolarHBondContact CE-OE1 3.34Å; K54-E58 HydrophobicContact CG-CG 4.43Å; K54-E58 WeakPolarHBondContact O-CG 3.44Å; K54-E58 PolarHBondContact O-N 2.94Å
59	N	87.3	Confident	79.2	Confident	115 Å²	115	84 Å²	84	62%	0.615	42%	0.419	S	S	*	.	H	α-helix	trans	-87.6	-39.9	-177.8	-168.3	11.9	0	0	0	113.6	Q55 F57	Q55-N59 VanDerWaalsContact O-CB 3.23Å; Q55-N59 WeakPolarHBondContact O-CB 3.35Å; Q55-N59 PolarHBondContact O-N 3.48Å; Q55-N59 VanDerWaalsContact O-N 3.08Å; F57-N59 VanDerWaalsContact C-N 3.29Å; F57-N59 PolarHBondContact O-N 3.22Å
60	K	86.9	Confident	78.5	Confident	137 Å²	137	82 Å²	82	60%	0.596	41%	0.408	S	S	*	.	H	α-helix	trans	-95.9	-26.9	-175.1	-60.2	-58.6	-174.7	-175.8	0	113.5	H56	H56-K60 VanDerWaalsContact O-CB 3.22Å; H56-K60 WeakPolarHBondContact O-CB 3.15Å; H56-K60 WeakPolarHBondContact O-CG 3.29Å; H56-K60 PolarHBondContact O-N 3.35Å
61	H	85.8	Confident	77.5	Confident	26 Å²	26	85.3 Å²	85.3	12%	0.12	42%	0.424	C	S	.	.			trans	-131.3	50.5	-175.3	-54	-54.9	0	0	0	112.2	V42 C43 H56 F57 K63 N64	V42-H61 WeakPolarHBondContact CG1-CE1 3.38Å; V42-H61 WeakPolarHBondContact CG1-ND1 3.45Å; C43-H61 PolarHBondContact SG-NE2 3.11Å; H56-H61 AromaticContact NE2-CD2 3.74Å; H56-H61 AromaticContact NE2-NE2 3.58Å; F57-H61 HydrophobicContact CD1-CB 4.38Å; F57-H61 HydrophobicContact CD2-CB 4.08Å; F57-H61 HydrophobicContact CE1-CB 4.31Å; F57-H61 HydrophobicContact CE2-CB 3.99Å; F57-H61 HydrophobicContact CG-CB 4.28Å; F57-H61 HydrophobicContact CZ-CB 4.12Å; F57-H61 CarbonylContact O-C 3.07Å; F57-H61 VanDerWaalsContact O-CA 3.23Å; F57-H61 WeakPolarHBondContact O-CA 3.46Å; F57-H61 PolarHBondContact O-N 2.99Å; H61-K63 PolarHBondContact O-N 2.97Å; H61-N64 HydrophobicContact CB-CB 4.24Å; H61-N64 PolarHBondContact O-N 3.33Å; H61-N64 VanDerWaalsContact O-N 3.1Å
62	P	79.1	Confident	76.3	Confident	97 Å²	97	84.7 Å²	84.7	63%	0.63	42%	0.423	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63	-18.6	-174.9	26.5	-36.1	0	0	0	114.1
63	K	76.9	Confident	75	Confident	204 Å²	204	85.8 Å²	85.8	89%	0.887	43%	0.43	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94.3	-15.7	-179.1	-61.3	-173.3	-179.1	-174.5	0	113.5	H61	H61-K63 PolarHBondContact O-N 2.97Å
64	N	73.6	Confident	73.2	Confident	78 Å²	78	95.2 Å²	95.2	42%	0.417	49%	0.487	S	S	.	.	S	Bend	trans	-87.3	146	179.1	-72.2	68.1	0	0	0	108.8	F57 H61	F57-N64 HydrophobicContact CE1-CB 3.98Å; F57-N64 VanDerWaalsContact CE1-O 3.22Å; F57-N64 WeakPolarHBondContact CE1-O 3.35Å; F57-N64 HydrophobicContact CE2-CB 4.46Å; F57-N64 HydrophobicContact CZ-CB 3.52Å; H61-N64 HydrophobicContact CB-CB 4.24Å; H61-N64 PolarHBondContact O-N 3.33Å; H61-N64 VanDerWaalsContact O-N 3.1Å
65	P	71.4	Confident	72.7	Confident	111 Å²	111	94.8 Å²	94.8	72%	0.721	49%	0.488	S	S	*	.	P	Polyproline II helix	trans	-66.9	138.9	169.8	27.8	-32.6	0	0	0	109.6	F57	F57-P65 VanDerWaalsContact CE1-C 3.47Å; F57-P65 VanDerWaalsContact CE1-O 3.28Å; F57-P65 WeakPolarHBondContact CE1-O 3.33Å; F57-P65 WeakPolarHBondContact CZ-O 3.36Å
66	L	68.5	Low	72.1	Confident	64 Å²	64	93.3 Å²	93.3	34%	0.335	48%	0.484	S	S	.	.	P	Polyproline II helix	trans	-50.5	126.5	173.3	-76.4	161.1	0	0	0	108.5	F57 L70	F57-L66 HydrophobicContact CB-CD2 4.1Å; F57-L66 HydrophobicContact CD1-CD2 3.57Å; F57-L66 HydrophobicContact CD1-CG 4.11Å; F57-L66 HydrophobicContact CE1-CD2 4.29Å; F57-L66 HydrophobicContact CE1-CG 4.42Å; F57-L66 HydrophobicContact CG-CD2 4.06Å; L66-L70 HydrophobicContact CD2-CD1 4.09Å
67	P	69.6	Low	71.2	Confident	13 Å²	13	96.8 Å²	96.8	8%	0.084	50%	0.503	C	S	.	.	P	Polyproline II helix	trans	-67.2	144.7	-176.7	27.4	-31.9	0	0	0	109.5	P41 Y53 F57 E69 L70	P41-P67 HydrophobicContact CG-CB 3.93Å; P41-P67 HydrophobicContact CG-CG 4.08Å; Y53-P67 HydrophobicContact CE1-CG 4.39Å; Y53-P67 WeakPolarHBondContact OH-CG 3.27Å; F57-P67 HydrophobicContact CD2-CG 4.48Å; F57-P67 HydrophobicContact CE2-CG 4.17Å; P67-E69 HydrophobicContact CB-CG 3.93Å; P67-E69 HydrophobicContact CG-CG 4.03Å; P67-E69 PolarHBondContact O-N 3.44Å; P67-L70 HydrophobicContact CG-CD1 3.84Å; P67-L70 WeakPolarHBondContact O-CB 3.36Å; P67-L70 PolarHBondContact O-N 3.47Å
68	Q	66.6	Low	70.4	Confident	136 Å²	136	102.2 Å²	102.2	64%	0.636	53%	0.531	S	S	*	.	H	α-helix	trans	-53.8	-31	-175	-81.8	85.4	-8.8	0	0	113.2	L70 L71 E72	Q68-L70 PolarHBondContact O-N 3.47Å; Q68-L70 VanDerWaalsContact O-N 3.14Å; Q68-L71 WeakPolarHBondContact O-CA 3.49Å; Q68-L71 WeakPolarHBondContact O-CB 3.31Å; Q68-L71 PolarHBondContact O-N 3.29Å; Q68-E72 WeakPolarHBondContact O-CG 3.44Å; Q68-E72 PolarHBondContact O-N 3.22Å
69	E	65.6	Low	69.5	Low	82 Å²	82	101.7 Å²	101.7	38%	0.383	53%	0.532	S	S	.	.	H	α-helix	trans	-59.4	-21.7	174.5	63.1	-158.8	97	0	0	114.6	Y53 P67 V73	Y53-E69 HydrophobicContact CE1-CG 4.26Å; P67-E69 HydrophobicContact CB-CG 3.93Å; P67-E69 HydrophobicContact CG-CG 4.03Å; P67-E69 PolarHBondContact O-N 3.44Å; E69-V73 WeakPolarHBondContact O-CG2 3.37Å
70	L	64.1	Low	68.4	Low	20 Å²	20	100.8 Å²	100.8	11%	0.105	53%	0.527	C	S	.	.	H	α-helix	trans	-85.4	-26.1	169.9	-95.1	151.3	0	0	0	113.1	V50 Y53 K54 L66 P67 Q68	V50-L70 HydrophobicContact CG1-CD2 3.79Å; Y53-L70 HydrophobicContact CD1-CD1 3.29Å; Y53-L70 HydrophobicContact CD1-CD2 3.55Å; Y53-L70 HydrophobicContact CD1-CG 3.24Å; Y53-L70 HydrophobicContact CD2-CD1 4.23Å; Y53-L70 HydrophobicContact CE1-CD1 3.13Å; Y53-L70 HydrophobicContact CE1-CD2 4.16Å; Y53-L70 HydrophobicContact CE1-CG 3.32Å; Y53-L70 HydrophobicContact CE2-CD1 4.11Å; Y53-L70 HydrophobicContact CG-CD1 3.83Å; Y53-L70 HydrophobicContact CG-CD2 4.09Å; Y53-L70 HydrophobicContact CG-CG 4.11Å; K54-L70 HydrophobicContact CB-CD2 4.14Å; L66-L70 HydrophobicContact CD2-CD1 4.09Å; P67-L70 HydrophobicContact CG-CD1 3.84Å; P67-L70 WeakPolarHBondContact O-CB 3.36Å; P67-L70 PolarHBondContact O-N 3.47Å; Q68-L70 PolarHBondContact O-N 3.47Å; Q68-L70 VanDerWaalsContact O-N 3.14Å
71	L	59.3	Low	67	Low	113 Å²	113	98.2 Å²	98.2	59%	0.592	52%	0.522	S	S	*	.	H	α-helix	trans	-82	-32.2	179.7	-76.4	164.3	0	0	0	112	Q68	Q68-L71 WeakPolarHBondContact O-CA 3.49Å; Q68-L71 WeakPolarHBondContact O-CB 3.31Å; Q68-L71 PolarHBondContact O-N 3.29Å
72	E	57.4	Low	65.6	Low	156 Å²	156	103.8 Å²	103.8	73%	0.729	55%	0.553	S	S	*	*	S	Bend	trans	-82.4	-12.8	-177.7	-67.8	-178	110	0	0	114	Q68 V74	Q68-E72 WeakPolarHBondContact O-CG 3.44Å; Q68-E72 PolarHBondContact O-N 3.22Å; E72-V74 VanDerWaalsContact C-N 3.32Å; E72-V74 PolarHBondContact O-N 3.34Å
73	V	55.3	Low	64.5	Low	78 Å²	78	104.3 Å²	104.3	47%	0.473	55%	0.546	S	S	.	.			trans	-96.4	56.2	179.4	-169.4	0	0	0	0	110.6	V50 E69	V50-V73 HydrophobicContact CG2-CB 4.36Å; V50-V73 HydrophobicContact CG2-CG1 3.82Å; E69-V73 WeakPolarHBondContact O-CG2 3.37Å
74	V	45.3	Very low	63.3	Low	197 Å²	197	95.3 Å²	95.3	100%	1.194	52%	0.515	S	S	*	.			trans	-99.3	0	161	177	0	0	0	0	108.7	E72	E72-V74 VanDerWaalsContact C-N 3.32Å; E72-V74 PolarHBondContact O-N 3.34Å

Retrieved 74 of 74 residues in 14.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).