G4VKK3_SCHMA Loading...

Mitochondrial import inner membrane translocase subunit

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.

AlphaFold DB , UniProt , Accession G4VKK3, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 91 aa.

						>G4VKK3_SCHMA|G4VKK3
MDQSLNLNSLTPAQKGQLMEQMRTEVALASARELLEKMSDKCFEKCVTKPGTSLDNSEQKCVGLCMDRYVDAWNLVSKVFASRIKREAEKL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.7	Very low	70.6	Confident	241 Å²	241	117.6 Å²	117.6	100%	1.187	64%	0.644	S	S	*	*				0	80.3	0	-78.4	179	-77.5	0	0	106.8
2	D	48.1	Very low	72.2	Confident	160 Å²	160	117.4 Å²	117.4	86%	0.856	65%	0.653	S	S	*	*			trans	-81.7	107.7	173.7	-86.7	-76.4	0	0	0	108.6
3	Q	57	Low	73.6	Confident	161 Å²	161	114.4 Å²	114.4	75%	0.752	65%	0.652	S	S	*	*			trans	-97.7	92.7	156.4	-78.5	-175.3	-16.5	0	0	107	L5	Q3-L5 HydrophobicContact CB-CG 4.25Å; Q3-L5 PolarHBondContact O-N 2.99Å
4	S	57.9	Low	74.9	Confident	117 Å²	117	112.8 Å²	112.8	82%	0.818	64%	0.636	S	S	*	*			trans	-65.9	76.1	159.1	42.4	0	0	0	0	108.4	N6	S4-N6 PolarHBondContact O-N 3.48Å
5	L	65.5	Low	76.1	Confident	102 Å²	102	110 Å²	110	53%	0.534	61%	0.614	S	S	.	*			trans	-60.9	105.5	171.5	-80.4	156.4	0	0	0	107.6	Q3 L7 L18	Q3-L5 HydrophobicContact CB-CG 4.25Å; Q3-L5 PolarHBondContact O-N 2.99Å; L5-L7 PolarHBondContact O-N 3.26Å; L5-L18 HydrophobicContact CD1-CD1 4.5Å
6	N	76.3	Confident	77	Confident	94 Å²	94	105.8 Å²	105.8	50%	0.503	60%	0.604	S	S	.	*			trans	-71.1	97.1	177.1	-168.9	-55.7	0	0	0	108.7	S4 N8 S9	S4-N6 PolarHBondContact O-N 3.48Å; N6-N8 PolarHBondContact O-N 3.1Å; N6-N8 WeakPolarHBondContact OD1-CA 3.47Å; N6-N8 VanDerWaalsContact OD1-CB 3.26Å; N6-N8 WeakPolarHBondContact OD1-CB 3.27Å; N6-N8 PolarHBondContact OD1-N 3.18Å; N6-S9 PolarHBondContact O-N 2.86Å; N6-S9 VanDerWaalsContact O-N 3.11Å; N6-S9 PolarHBondContact O-OG 3.35Å; N6-S9 PolarHBondContact OD1-N 2.89Å
7	L	80.3	Confident	77.9	Confident	83 Å²	83	106.9 Å²	106.9	44%	0.435	60%	0.602	S	S	.	*	G	3₁₀ helix	trans	-53	-29.9	179.4	-167	72.2	0	0	0	111.7	L5 S9 L10 K15 L18	L5-L7 PolarHBondContact O-N 3.26Å; L7-S9 VanDerWaalsContact C-N 3.34Å; L7-S9 PolarHBondContact O-N 3.09Å; L7-L10 HydrophobicContact CD1-CD1 4.41Å; L7-L10 PolarHBondContact O-N 3.26Å; L7-K15 HydrophobicContact CD1-CG 4.24Å; L7-K15 WeakPolarHBondContact O-CE 3.43Å; L7-L18 HydrophobicContact CD1-CD2 4.18Å
8	N	83.3	Confident	78.6	Confident	136 Å²	136	102.5 Å²	102.5	73%	0.727	58%	0.577	S	S	*	*	G	3₁₀ helix	trans	-72.3	-22.8	-176.3	-59.1	-36.1	0	0	0	113.7	N6 L10	N6-N8 PolarHBondContact O-N 3.1Å; N6-N8 WeakPolarHBondContact OD1-CA 3.47Å; N6-N8 VanDerWaalsContact OD1-CB 3.26Å; N6-N8 WeakPolarHBondContact OD1-CB 3.27Å; N6-N8 PolarHBondContact OD1-N 3.18Å; N8-L10 VanDerWaalsContact C-N 3.32Å
9	S	86.3	Confident	79.4	Confident	92 Å²	92	101.6 Å²	101.6	64%	0.643	57%	0.569	S	S	*	*	G	3₁₀ helix	trans	-83.4	-6.8	177.5	64.4	0	0	0	0	113.9	N6 L7	N6-S9 PolarHBondContact O-N 2.86Å; N6-S9 VanDerWaalsContact O-N 3.11Å; N6-S9 PolarHBondContact O-OG 3.35Å; N6-S9 PolarHBondContact OD1-N 2.89Å; L7-S9 VanDerWaalsContact C-N 3.34Å; L7-S9 PolarHBondContact O-N 3.09Å
10	L	87.7	Confident	80	Confident	36 Å²	36	102.1 Å²	102.1	19%	0.188	57%	0.566	C	S	.	*	S	Bend	trans	-86.5	139.9	-178	-61.6	179	0	0	0	112.2	L7 N8 Q14 K15 L18	L7-L10 HydrophobicContact CD1-CD1 4.41Å; L7-L10 PolarHBondContact O-N 3.26Å; N8-L10 VanDerWaalsContact C-N 3.32Å; L10-Q14 HydrophobicContact CB-CB 3.96Å; L10-Q14 HydrophobicContact CD2-CB 4.1Å; L10-Q14 HydrophobicContact CG-CB 4.45Å; L10-K15 HydrophobicContact CB-CG 3.68Å; L10-K15 HydrophobicContact CD1-CG 4.5Å; L10-K15 WeakPolarHBondContact O-CE 3.43Å; L10-L18 HydrophobicContact CD1-CD2 3.65Å
11	T	91.3	Very high	80.6	Confident	72 Å²	72	101.9 Å²	101.9	44%	0.442	56%	0.561	S	S	.	*			trans	-62.5	158.3	168.3	61.3	0	0	0	0	111	A13 Q14 K15	T11-A13 PolarHBondContact O-N 3Å; T11-Q14 PolarHBondContact O-N 3.37Å; T11-Q14 VanDerWaalsContact O-N 3.1Å; T11-Q14 WeakPolarHBondContact OG1-CB 3.43Å; T11-Q14 VanDerWaalsContact OG1-CG 3.27Å; T11-Q14 WeakPolarHBondContact OG1-CG 3.23Å; T11-Q14 PolarHBondContact OG1-N 2.92Å; T11-Q14 PolarHBondContact OG1-OE1 2.9Å; T11-K15 WeakPolarHBondContact O-CG 3.17Å; T11-K15 PolarHBondContact O-N 3.36Å
12	P	89.6	Confident	83	Confident	115 Å²	115	94.6 Å²	94.6	75%	0.747	53%	0.525	S	S	*	.	H	α-helix	trans	-53.5	-37.3	176	-27.5	35.6	0	0	0	113.7	G16	P12-G16 PolarHBondContact O-N 3.46Å
13	A	91	Very high	85.1	Confident	78 Å²	78	94.8 Å²	94.8	65%	0.645	51%	0.514	S	S	*	.	H	α-helix	trans	-66.2	-46.2	176.1	0	0	0	0	0	112.3	T11 K15 G16 Q17	T11-A13 PolarHBondContact O-N 3Å; A13-K15 VanDerWaalsContact C-N 3.34Å; A13-K15 PolarHBondContact O-N 3.26Å; A13-G16 PolarHBondContact O-N 3.42Å; A13-Q17 PolarHBondContact O-N 3.42Å
14	Q	92.2	Very high	86.9	Confident	92 Å²	92	91.2 Å²	91.2	43%	0.43	50%	0.503	S	S	.	.	H	α-helix	trans	-64	-39.1	176.4	-73.5	167.1	-47.6	0	0	112.1	L10 T11 Q17 L18	L10-Q14 HydrophobicContact CB-CB 3.96Å; L10-Q14 HydrophobicContact CD2-CB 4.1Å; L10-Q14 HydrophobicContact CG-CB 4.45Å; T11-Q14 PolarHBondContact O-N 3.37Å; T11-Q14 VanDerWaalsContact O-N 3.1Å; T11-Q14 WeakPolarHBondContact OG1-CB 3.43Å; T11-Q14 VanDerWaalsContact OG1-CG 3.27Å; T11-Q14 WeakPolarHBondContact OG1-CG 3.23Å; T11-Q14 PolarHBondContact OG1-N 2.92Å; T11-Q14 PolarHBondContact OG1-OE1 2.9Å; Q14-Q17 PolarHBondContact O-N 3.11Å; Q14-L18 WeakPolarHBondContact O-CB 3.32Å; Q14-L18 PolarHBondContact O-N 3.05Å
15	K	92	Very high	88.6	Confident	71 Å²	71	92 Å²	92	31%	0.309	49%	0.494	S	S	.	.	H	α-helix	trans	-60.4	-46.6	173.6	-71.7	174.5	173.6	167.8	0	111.1	L7 L10 T11 A13 L18 M19	L7-K15 HydrophobicContact CD1-CG 4.24Å; L7-K15 WeakPolarHBondContact O-CE 3.43Å; L10-K15 HydrophobicContact CB-CG 3.68Å; L10-K15 HydrophobicContact CD1-CG 4.5Å; L10-K15 WeakPolarHBondContact O-CE 3.43Å; T11-K15 WeakPolarHBondContact O-CG 3.17Å; T11-K15 PolarHBondContact O-N 3.36Å; A13-K15 VanDerWaalsContact C-N 3.34Å; A13-K15 PolarHBondContact O-N 3.26Å; K15-L18 PolarHBondContact O-N 3.37Å; K15-M19 WeakPolarHBondContact O-CB 2.77Å; K15-M19 VanDerWaalsContact O-CG 3.23Å; K15-M19 WeakPolarHBondContact O-CG 3.47Å; K15-M19 PolarHBondContact O-N 3.03Å
16	G	91.2	Very high	90	Very high	43 Å²	43	91.8 Å²	91.8	44%	0.443	50%	0.497	S	S	.	.	H	α-helix	trans	-59.3	-47.7	177.7	0	0	0	0	0	112.6	P12 A13 M19 E20	P12-G16 PolarHBondContact O-N 3.46Å; A13-G16 PolarHBondContact O-N 3.42Å; G16-M19 PolarHBondContact O-N 2.97Å; G16-E20 PolarHBondContact O-N 3.12Å; G16-E20 VanDerWaalsContact O-N 3.09Å
17	Q	91.5	Very high	90.8	Very high	124 Å²	124	90 Å²	90	58%	0.579	50%	0.495	S	S	*	.	H	α-helix	trans	-62.1	-44.7	177.1	-176.9	-180	-13.7	0	0	112.1	A13 Q14 E20 Q21	A13-Q17 PolarHBondContact O-N 3.42Å; Q14-Q17 PolarHBondContact O-N 3.11Å; Q17-E20 PolarHBondContact O-N 3.13Å; Q17-Q21 WeakPolarHBondContact O-CG 3.26Å; Q17-Q21 PolarHBondContact O-N 3.44Å
18	L	91.7	Very high	91.5	Very high	28 Å²	28	90.2 Å²	90.2	15%	0.147	50%	0.496	C	S	.	.	H	α-helix	trans	-62.5	-43.7	177.7	179.1	62.1	0	0	0	111.4	L5 L7 L10 Q14 K15 E20 Q21 M22	L5-L18 HydrophobicContact CD1-CD1 4.5Å; L7-L18 HydrophobicContact CD1-CD2 4.18Å; L10-L18 HydrophobicContact CD1-CD2 3.65Å; Q14-L18 WeakPolarHBondContact O-CB 3.32Å; Q14-L18 PolarHBondContact O-N 3.05Å; K15-L18 PolarHBondContact O-N 3.37Å; L18-E20 VanDerWaalsContact C-N 3.26Å; L18-E20 PolarHBondContact O-N 3.1Å; L18-Q21 PolarHBondContact O-N 3.36Å; L18-M22 HydrophobicContact CD1-CG 4.28Å; L18-M22 HydrophobicContact CG-CG 4.41Å; L18-M22 HydrophobicContact CG-SD 4.18Å; L18-M22 WeakPolarHBondContact O-CB 3.12Å; L18-M22 VanDerWaalsContact O-CG 3.3Å; L18-M22 WeakPolarHBondContact O-CG 3.41Å; L18-M22 PolarHBondContact O-N 2.97Å
19	M	92.4	Very high	92.1	Very high	86 Å²	86	86.3 Å²	86.3	42%	0.424	48%	0.483	S	S	.	.	H	α-helix	trans	-60.4	-37.6	177.1	-73.7	-59.5	-59.3	0	0	112	K15 G16 R23	K15-M19 WeakPolarHBondContact O-CB 2.77Å; K15-M19 VanDerWaalsContact O-CG 3.23Å; K15-M19 WeakPolarHBondContact O-CG 3.47Å; K15-M19 PolarHBondContact O-N 3.03Å; G16-M19 PolarHBondContact O-N 2.97Å; M19-R23 WeakPolarHBondContact O-CG 3.21Å; M19-R23 PolarHBondContact O-N 2.86Å
20	E	92.8	Very high	92.5	Very high	110 Å²	110	84.7 Å²	84.7	51%	0.514	47%	0.471	S	S	.	.	H	α-helix	trans	-69.2	-41.1	176.9	-172.2	57.7	-158.6	0	0	112.5	G16 Q17 L18 R23 T24	G16-E20 PolarHBondContact O-N 3.12Å; G16-E20 VanDerWaalsContact O-N 3.09Å; Q17-E20 PolarHBondContact O-N 3.13Å; L18-E20 VanDerWaalsContact C-N 3.26Å; L18-E20 PolarHBondContact O-N 3.1Å; E20-R23 PolarHBondContact O-N 2.94Å; E20-T24 PolarHBondContact O-N 3.25Å; E20-T24 VanDerWaalsContact O-N 3.1Å; E20-T24 PolarHBondContact O-OG1 3.32Å; E20-T24 VanDerWaalsContact O-OG1 3.12Å
21	Q	91.2	Very high	92.8	Very high	98 Å²	98	85 Å²	85	46%	0.458	48%	0.48	S	S	.	.	H	α-helix	trans	-60.7	-48.1	172.9	-71.8	176.6	-31.1	0	0	111.1	Q17 L18 R23 T24 E25	Q17-Q21 WeakPolarHBondContact O-CG 3.26Å; Q17-Q21 PolarHBondContact O-N 3.44Å; L18-Q21 PolarHBondContact O-N 3.36Å; Q21-R23 VanDerWaalsContact C-N 3.31Å; Q21-R23 PolarHBondContact O-N 3.02Å; Q21-T24 WeakPolarHBondContact O-CB 3.46Å; Q21-T24 PolarHBondContact O-N 2.95Å; Q21-T24 VanDerWaalsContact O-N 3.13Å; Q21-E25 PolarHBondContact O-N 3.33Å
22	M	93.1	Very high	93.1	Very high	89 Å²	89	88.4 Å²	88.4	44%	0.438	48%	0.484	S	S	.	.	H	α-helix	trans	-59.6	-40.6	177.1	-72	-178.2	73.4	0	0	112.1	L18 T24 E25 V26	L18-M22 HydrophobicContact CD1-CG 4.28Å; L18-M22 HydrophobicContact CG-CG 4.41Å; L18-M22 HydrophobicContact CG-SD 4.18Å; L18-M22 WeakPolarHBondContact O-CB 3.12Å; L18-M22 VanDerWaalsContact O-CG 3.3Å; L18-M22 WeakPolarHBondContact O-CG 3.41Å; L18-M22 PolarHBondContact O-N 2.97Å; M22-T24 VanDerWaalsContact C-N 3.32Å; M22-T24 PolarHBondContact O-N 3Å; M22-E25 PolarHBondContact O-N 2.75Å; M22-V26 WeakPolarHBondContact O-CB 3.47Å; M22-V26 VanDerWaalsContact O-CG2 3.24Å; M22-V26 WeakPolarHBondContact O-CG2 3.41Å; M22-V26 PolarHBondContact O-N 3.03Å
23	R	93.5	Very high	93.5	Very high	163 Å²	163	87.5 Å²	87.5	62%	0.615	47%	0.47	S	S	*	.	H	α-helix	trans	-59.6	-43.7	175.6	-76.6	167.6	-177.7	-138.4	-0.2	111.8	M19 E20 Q21 V26 A27	M19-R23 WeakPolarHBondContact O-CG 3.21Å; M19-R23 PolarHBondContact O-N 2.86Å; E20-R23 PolarHBondContact O-N 2.94Å; Q21-R23 VanDerWaalsContact C-N 3.31Å; Q21-R23 PolarHBondContact O-N 3.02Å; R23-V26 PolarHBondContact O-N 3.39Å; R23-A27 WeakPolarHBondContact O-CB 3.39Å; R23-A27 PolarHBondContact O-N 3.38Å
24	T	94.3	Very high	93.7	Very high	86 Å²	86	85.4 Å²	85.4	53%	0.528	45%	0.448	S	S	.	.	H	α-helix	trans	-64.8	-43.5	178.1	-58.1	0	0	0	0	111.3	E20 Q21 M22 A27 L28	E20-T24 PolarHBondContact O-N 3.25Å; E20-T24 VanDerWaalsContact O-N 3.1Å; E20-T24 PolarHBondContact O-OG1 3.32Å; E20-T24 VanDerWaalsContact O-OG1 3.12Å; Q21-T24 WeakPolarHBondContact O-CB 3.46Å; Q21-T24 PolarHBondContact O-N 2.95Å; Q21-T24 VanDerWaalsContact O-N 3.13Å; M22-T24 VanDerWaalsContact C-N 3.32Å; M22-T24 PolarHBondContact O-N 3Å; T24-A27 PolarHBondContact O-N 3.3Å; T24-L28 WeakPolarHBondContact O-CB 3.39Å; T24-L28 PolarHBondContact O-N 3.42Å
25	E	94	Very high	94	Very high	133 Å²	133	85.7 Å²	85.7	62%	0.621	45%	0.451	S	S	*	.	H	α-helix	trans	-64.6	-43.2	177.2	-72.6	-179.5	-178.7	0	0	112.4	Q21 M22 A27 L28 A29	Q21-E25 PolarHBondContact O-N 3.33Å; M22-E25 PolarHBondContact O-N 2.75Å; E25-A27 VanDerWaalsContact C-N 3.34Å; E25-A27 PolarHBondContact O-N 3.45Å; E25-L28 PolarHBondContact O-N 3.16Å; E25-A29 WeakPolarHBondContact O-CB 3.3Å; E25-A29 PolarHBondContact O-N 3.35Å
26	V	94.9	Very high	94.3	Very high	99 Å²	99	88.2 Å²	88.2	60%	0.6	47%	0.465	S	S	*	.	H	α-helix	trans	-63.3	-41.3	175.5	170.1	0	0	0	0	110.8	M22 R23 L28 A29 S30	M22-V26 WeakPolarHBondContact O-CB 3.47Å; M22-V26 VanDerWaalsContact O-CG2 3.24Å; M22-V26 WeakPolarHBondContact O-CG2 3.41Å; M22-V26 PolarHBondContact O-N 3.03Å; R23-V26 PolarHBondContact O-N 3.39Å; V26-L28 VanDerWaalsContact C-N 3.34Å; V26-L28 PolarHBondContact O-N 3.03Å; V26-A29 PolarHBondContact O-N 3.35Å; V26-S30 WeakPolarHBondContact O-CB 3.37Å; V26-S30 PolarHBondContact O-N 3.17Å; V26-S30 PolarHBondContact O-OG 2.99Å
27	A	92.5	Very high	94.6	Very high	56 Å²	56	91.1 Å²	91.1	46%	0.463	47%	0.465	S	S	.	.	H	α-helix	trans	-61.2	-44.2	175.1	0	0	0	0	0	111.3	R23 T24 E25 S30 A31	R23-A27 WeakPolarHBondContact O-CB 3.39Å; R23-A27 PolarHBondContact O-N 3.38Å; T24-A27 PolarHBondContact O-N 3.3Å; E25-A27 VanDerWaalsContact C-N 3.34Å; E25-A27 PolarHBondContact O-N 3.45Å; A27-S30 PolarHBondContact O-N 3.14Å; A27-S30 PolarHBondContact O-OG 3.28Å; A27-A31 WeakPolarHBondContact O-CB 3.32Å; A27-A31 PolarHBondContact O-N 2.92Å
28	L	95.6	Very high	94.9	Very high	88 Å²	88	86 Å²	86	46%	0.461	44%	0.441	S	S	.	.	H	α-helix	trans	-65.5	-42.6	177.4	-178.2	61.1	0	0	0	112.4	T24 E25 V26 A31 R32	T24-L28 WeakPolarHBondContact O-CB 3.39Å; T24-L28 PolarHBondContact O-N 3.42Å; E25-L28 PolarHBondContact O-N 3.16Å; V26-L28 VanDerWaalsContact C-N 3.34Å; V26-L28 PolarHBondContact O-N 3.03Å; L28-A31 PolarHBondContact O-N 2.91Å; L28-R32 WeakPolarHBondContact O-CG 3.37Å; L28-R32 PolarHBondContact O-N 3.35Å
29	A	96.3	Very high	95.2	Very high	53 Å²	53	87.2 Å²	87.2	44%	0.438	45%	0.452	S	S	.	.	H	α-helix	trans	-64.4	-45.1	177.5	0	0	0	0	0	111.7	E25 V26 A31 R32 E33	E25-A29 WeakPolarHBondContact O-CB 3.3Å; E25-A29 PolarHBondContact O-N 3.35Å; V26-A29 PolarHBondContact O-N 3.35Å; A29-A31 VanDerWaalsContact C-N 3.34Å; A29-A31 PolarHBondContact O-N 3.5Å; A29-R32 PolarHBondContact O-N 3.5Å; A29-E33 PolarHBondContact O-N 3.46Å
30	S	93.7	Very high	95.5	Very high	58 Å²	58	87.8 Å²	87.8	41%	0.406	46%	0.457	S	S	.	.	H	α-helix	trans	-64.8	-37	177.3	62.3	0	0	0	0	112.5	V26 A27 E33 L34	V26-S30 WeakPolarHBondContact O-CB 3.37Å; V26-S30 PolarHBondContact O-N 3.17Å; V26-S30 PolarHBondContact O-OG 2.99Å; A27-S30 PolarHBondContact O-N 3.14Å; A27-S30 PolarHBondContact O-OG 3.28Å; S30-E33 PolarHBondContact O-N 3.29Å; S30-L34 WeakPolarHBondContact O-CB 3.5Å; S30-L34 PolarHBondContact O-N 3.37Å
31	A	95.2	Very high	95.8	Very high	44 Å²	44	86.9 Å²	86.9	36%	0.364	45%	0.451	S	S	.	.	H	α-helix	trans	-64.3	-41	174.1	0	0	0	0	0	112.1	A27 L28 A29 L34 L35	A27-A31 WeakPolarHBondContact O-CB 3.32Å; A27-A31 PolarHBondContact O-N 2.92Å; L28-A31 PolarHBondContact O-N 2.91Å; A29-A31 VanDerWaalsContact C-N 3.34Å; A29-A31 PolarHBondContact O-N 3.5Å; A31-L34 PolarHBondContact O-N 2.95Å; A31-L35 WeakPolarHBondContact O-CG 3.24Å; A31-L35 PolarHBondContact O-N 3.26Å
32	R	97.1	Very high	96.1	Very high	143 Å²	143	82.3 Å²	82.3	54%	0.54	43%	0.43	S	S	.	.	H	α-helix	trans	-62.7	-47.8	174.7	-73	172.6	-180	154.4	-1.4	111.7	L28 A29 L34 L35 E36	L28-R32 WeakPolarHBondContact O-CG 3.37Å; L28-R32 PolarHBondContact O-N 3.35Å; A29-R32 PolarHBondContact O-N 3.5Å; R32-L34 VanDerWaalsContact C-N 3.27Å; R32-L34 PolarHBondContact O-N 2.87Å; R32-L35 PolarHBondContact O-N 3.32Å; R32-L35 VanDerWaalsContact O-N 3.14Å; R32-E36 WeakPolarHBondContact O-CG 3.4Å; R32-E36 PolarHBondContact O-N 2.78Å
33	E	96.9	Very high	96.3	Very high	96 Å²	96	83.3 Å²	83.3	45%	0.449	43%	0.432	S	S	.	.	H	α-helix	trans	-59.7	-39.7	177.8	-174.7	-175.7	176.2	0	0	111.8	A29 S30 K37	A29-E33 PolarHBondContact O-N 3.46Å; S30-E33 PolarHBondContact O-N 3.29Å; E33-K37 HydrophobicContact CG-CD 4.14Å; E33-K37 WeakPolarHBondContact O-CB 3.35Å; E33-K37 WeakPolarHBondContact O-CG 3.36Å; E33-K37 PolarHBondContact O-N 2.93Å; E33-K37 WeakPolarHBondContact OE1-CE 3.34Å; E33-K37 IonicContact OE1-NZ 3.32Å; E33-K37 PolarHBondContact OE1-NZ 3.48Å
34	L	96.6	Very high	96.6	Very high	33 Å²	33	81.3 Å²	81.3	17%	0.173	43%	0.43	C	S	.	.	H	α-helix	trans	-61.2	-48.1	175	-179.2	68.3	0	0	0	111.4	S30 A31 R32 M38 Y69 W73	S30-L34 WeakPolarHBondContact O-CB 3.5Å; S30-L34 PolarHBondContact O-N 3.37Å; A31-L34 PolarHBondContact O-N 2.95Å; R32-L34 VanDerWaalsContact C-N 3.27Å; R32-L34 PolarHBondContact O-N 2.87Å; L34-M38 WeakPolarHBondContact O-CB 3.19Å; L34-M38 PolarHBondContact O-N 2.84Å; L34-Y69 HydrophobicContact CD1-CD1 4.36Å; L34-Y69 HydrophobicContact CD1-CE1 3.68Å; L34-W73 HydrophobicContact CD1-CB 4.26Å; L34-W73 HydrophobicContact CD1-CD2 3.8Å; L34-W73 HydrophobicContact CD1-CG 3.62Å; L34-W73 HydrophobicContact CD2-CD2 4.19Å; L34-W73 HydrophobicContact CD2-CE3 4.18Å; L34-W73 HydrophobicContact CD2-CH2 4.45Å; L34-W73 HydrophobicContact CD2-CZ2 4.45Å; L34-W73 HydrophobicContact CD2-CZ3 4.32Å
35	L	97.5	Very high	96.8	Very high	98 Å²	98	84.7 Å²	84.7	51%	0.513	44%	0.437	S	S	.	.	H	α-helix	trans	-62.4	-44.2	179.4	-72.9	169.4	0	0	0	112	A31 R32 M38 S39	A31-L35 WeakPolarHBondContact O-CG 3.24Å; A31-L35 PolarHBondContact O-N 3.26Å; R32-L35 PolarHBondContact O-N 3.32Å; R32-L35 VanDerWaalsContact O-N 3.14Å; L35-M38 HydrophobicContact CD2-CE 3.91Å; L35-S39 VanDerWaalsContact O-CB 3.25Å; L35-S39 WeakPolarHBondContact O-CB 3.39Å; L35-S39 PolarHBondContact O-N 3.41Å; L35-S39 PolarHBondContact O-OG 3.01Å
36	E	98.2	Very high	97	Very high	125 Å²	125	78.7 Å²	78.7	58%	0.584	41%	0.41	S	S	*	.	H	α-helix	trans	-60.8	-55.1	177.8	-73.5	171.3	-171	0	0	110.9	R32 M38 S39 D40	R32-E36 WeakPolarHBondContact O-CG 3.4Å; R32-E36 PolarHBondContact O-N 2.78Å; E36-M38 VanDerWaalsContact C-N 3.33Å; E36-M38 PolarHBondContact O-N 3.37Å; E36-S39 PolarHBondContact O-N 3.01Å; E36-S39 VanDerWaalsContact O-N 3.14Å; E36-D40 PolarHBondContact O-N 2.76Å
37	K	98.1	Very high	97.1	Very high	104 Å²	104	74.8 Å²	74.8	45%	0.452	39%	0.386	S	S	.	.	H	α-helix	trans	-61.6	-40	-179.4	-72.7	178.8	171.8	171.3	0	112.9	E33 K41 Y69	E33-K37 HydrophobicContact CG-CD 4.14Å; E33-K37 WeakPolarHBondContact O-CB 3.35Å; E33-K37 WeakPolarHBondContact O-CG 3.36Å; E33-K37 PolarHBondContact O-N 2.93Å; E33-K37 WeakPolarHBondContact OE1-CE 3.34Å; E33-K37 IonicContact OE1-NZ 3.32Å; E33-K37 PolarHBondContact OE1-NZ 3.48Å; K37-K41 VanDerWaalsContact O-CB 3.32Å; K37-K41 WeakPolarHBondContact O-CB 3.38Å; K37-K41 VanDerWaalsContact O-CG 3.23Å; K37-K41 WeakPolarHBondContact O-CG 3.18Å; K37-K41 PolarHBondContact O-N 3.06Å; K37-Y69 VanDerWaalsContact CB-OH 3.31Å; K37-Y69 WeakPolarHBondContact CB-OH 3.37Å
38	M	98.1	Very high	97.3	Very high	16 Å²	16	77.6 Å²	77.6	8%	0.079	40%	0.398	C	S	.	.	H	α-helix	trans	-63.7	-45.6	176.1	-178.4	172.2	62.9	0	0	111.1	L34 L35 E36 K41 C42 M66 Y69 V70	L34-M38 WeakPolarHBondContact O-CB 3.19Å; L34-M38 PolarHBondContact O-N 2.84Å; L35-M38 HydrophobicContact CD2-CE 3.91Å; E36-M38 VanDerWaalsContact C-N 3.33Å; E36-M38 PolarHBondContact O-N 3.37Å; M38-K41 PolarHBondContact O-N 2.98Å; M38-C42 WeakPolarHBondContact O-CB 3.33Å; M38-C42 PolarHBondContact O-N 3.28Å; M38-C42 PolarHBondContact O-SG 3.18Å; M38-C42 VanDerWaalsContact O-SG 3.36Å; M38-M66 HydrophobicContact CE-CG 4.27Å; M38-M66 HydrophobicContact CG-CG 4.16Å; M38-M66 HydrophobicContact SD-CB 3.93Å; M38-M66 HydrophobicContact SD-CG 3.96Å; M38-Y69 HydrophobicContact CB-CD1 3.53Å; M38-Y69 HydrophobicContact CB-CE1 3.55Å; M38-Y69 HydrophobicContact CB-CG 4.06Å; M38-Y69 HydrophobicContact CG-CD1 3.53Å; M38-Y69 HydrophobicContact CG-CD2 4.45Å; M38-Y69 HydrophobicContact CG-CE1 4.1Å; M38-Y69 HydrophobicContact CG-CG 3.73Å; M38-Y69 HydrophobicContact SD-CD1 3.83Å; M38-Y69 HydrophobicContact SD-CG 4.29Å; M38-V70 HydrophobicContact SD-CG2 3.86Å
39	S	97.8	Very high	97.2	Very high	54 Å²	54	81.1 Å²	81.1	38%	0.378	41%	0.409	S	S	.	.	H	α-helix	trans	-61.6	-48.3	-179.8	-60.7	0	0	0	0	110.9	L35 E36 K41 C42 F43	L35-S39 VanDerWaalsContact O-CB 3.25Å; L35-S39 WeakPolarHBondContact O-CB 3.39Å; L35-S39 PolarHBondContact O-N 3.41Å; L35-S39 PolarHBondContact O-OG 3.01Å; E36-S39 PolarHBondContact O-N 3.01Å; E36-S39 VanDerWaalsContact O-N 3.14Å; S39-K41 PolarHBondContact O-N 3.34Å; S39-C42 PolarHBondContact O-N 2.91Å; S39-F43 VanDerWaalsContact O-CB 3.24Å; S39-F43 WeakPolarHBondContact O-CB 3.4Å; S39-F43 PolarHBondContact O-N 2.89Å
40	D	98.1	Very high	97.2	Very high	97 Å²	97	83.5 Å²	83.5	52%	0.519	42%	0.42	S	S	.	.	H	α-helix	trans	-59.1	-48	177.7	-70.1	-16	0	0	0	111.2	E36 F43 E44	E36-D40 PolarHBondContact O-N 2.76Å; D40-F43 PolarHBondContact O-N 3.48Å; D40-E44 WeakPolarHBondContact O-CB 3.38Å; D40-E44 VanDerWaalsContact O-CG 3.29Å; D40-E44 WeakPolarHBondContact O-CG 3.49Å; D40-E44 PolarHBondContact O-N 2.92Å
41	K	98.4	Very high	97.3	Very high	92 Å²	92	83.8 Å²	83.8	40%	0.4	43%	0.432	S	S	.	.	H	α-helix	trans	-65.6	-42.1	-179.1	-74.1	-77.6	154.9	-90.7	0	112.2	K37 M38 S39 E44 K45 Y69	K37-K41 VanDerWaalsContact O-CB 3.32Å; K37-K41 WeakPolarHBondContact O-CB 3.38Å; K37-K41 VanDerWaalsContact O-CG 3.23Å; K37-K41 WeakPolarHBondContact O-CG 3.18Å; K37-K41 PolarHBondContact O-N 3.06Å; M38-K41 PolarHBondContact O-N 2.98Å; S39-K41 PolarHBondContact O-N 3.34Å; K41-E44 IonicContact NZ-OE1 2.68Å; K41-E44 PolarHBondContact NZ-OE1 3.45Å; K41-E44 IonicContact NZ-OE2 3.23Å; K41-E44 PolarHBondContact NZ-OE2 2.94Å; K41-K45 WeakPolarHBondContact O-CB 3.38Å; K41-K45 WeakPolarHBondContact O-CG 3.49Å; K41-K45 PolarHBondContact O-N 2.81Å; K41-K45 VanDerWaalsContact O-N 3.15Å; K41-Y69 HydrophobicContact CB-CE2 4.24Å; K41-Y69 HydrophobicContact CG-CE2 4.29Å
42	C	98.7	Very high	97.3	Very high	1 Å²	1	89 Å²	89	1%	0.007	46%	0.46	C	S	.	.	H	α-helix	trans	-72.8	-34.2	178.9	-67.1	0	0	0	0	112.3	M38 S39 K45 C46 C65	M38-C42 WeakPolarHBondContact O-CB 3.33Å; M38-C42 PolarHBondContact O-N 3.28Å; M38-C42 PolarHBondContact O-SG 3.18Å; M38-C42 VanDerWaalsContact O-SG 3.36Å; S39-C42 PolarHBondContact O-N 2.91Å; C42-K45 PolarHBondContact O-N 3.15Å; C42-C46 WeakPolarHBondContact O-CB 3.46Å; C42-C46 PolarHBondContact O-N 2.91Å; C42-C65 WeakPolarHBondContact CA-SG 3.25Å; C42-C65 HydrophobicContact CB-CB 3.78Å; C42-C65 WeakPolarHBondContact CB-SG 3.16Å; C42-C65 WeakPolarHBondContact SG-CB 3.04Å; C42-C65 CovalentContact SG-SG 2.05Å; C42-C65 PolarHBondContact SG-SG 3.34Å
43	F	98.1	Very high	97.3	Very high	110 Å²	110	86.5 Å²	86.5	48%	0.482	46%	0.464	S	S	.	.	H	α-helix	trans	-62.4	-53.7	172.4	-175.3	-91.5	0	0	0	111.2	S39 D40 K45 C46 V47 P50	S39-F43 VanDerWaalsContact O-CB 3.24Å; S39-F43 WeakPolarHBondContact O-CB 3.4Å; S39-F43 PolarHBondContact O-N 2.89Å; D40-F43 PolarHBondContact O-N 3.48Å; F43-K45 PolarHBondContact O-N 2.73Å; F43-K45 VanDerWaalsContact O-N 3.15Å; F43-C46 PolarHBondContact O-N 2.85Å; F43-V47 HydrophobicContact CD2-CB 3.98Å; F43-V47 HydrophobicContact CD2-CG1 4.42Å; F43-V47 HydrophobicContact CD2-CG2 3.56Å; F43-V47 HydrophobicContact CE2-CB 3.86Å; F43-V47 HydrophobicContact CE2-CG1 3.8Å; F43-V47 HydrophobicContact CE2-CG2 3.76Å; F43-V47 HydrophobicContact CG-CB 4.37Å; F43-V47 HydrophobicContact CG-CG2 4.19Å; F43-V47 HydrophobicContact CZ-CB 4.14Å; F43-V47 HydrophobicContact CZ-CG1 3.95Å; F43-V47 WeakPolarHBondContact O-CB 3.26Å; F43-V47 PolarHBondContact O-N 3.4Å; F43-P50 HydrophobicContact CZ-CB 4.49Å; F43-P50 HydrophobicContact CZ-CG 4.46Å
44	E	98	Very high	97.3	Very high	122 Å²	122	85 Å²	85	57%	0.57	46%	0.459	S	S	*	.	H	α-helix	trans	-54.9	-34.1	177.7	-76.8	172.9	-170.1	0	0	113.1	D40 K41	D40-E44 WeakPolarHBondContact O-CB 3.38Å; D40-E44 VanDerWaalsContact O-CG 3.29Å; D40-E44 WeakPolarHBondContact O-CG 3.49Å; D40-E44 PolarHBondContact O-N 2.92Å; K41-E44 IonicContact NZ-OE1 2.68Å; K41-E44 PolarHBondContact NZ-OE1 3.45Å; K41-E44 IonicContact NZ-OE2 3.23Å; K41-E44 PolarHBondContact NZ-OE2 2.94Å
45	K	98.3	Very high	97.3	Very high	156 Å²	156	87.1 Å²	87.1	68%	0.678	47%	0.471	S	S	*	.	H	α-helix	trans	-88.4	-33.1	-176.2	-68.9	-60.6	178.3	-167.1	0	114.3	K41 C42 F43	K41-K45 WeakPolarHBondContact O-CB 3.38Å; K41-K45 WeakPolarHBondContact O-CG 3.49Å; K41-K45 PolarHBondContact O-N 2.81Å; K41-K45 VanDerWaalsContact O-N 3.15Å; C42-K45 PolarHBondContact O-N 3.15Å; F43-K45 PolarHBondContact O-N 2.73Å; F43-K45 VanDerWaalsContact O-N 3.15Å
46	C	98.6	Very high	97.3	Very high	8 Å²	8	88.8 Å²	88.8	5%	0.054	48%	0.48	C	S	.	.	H	α-helix	trans	-107	-28.6	-169.6	-67.7	0	0	0	0	113.8	C42 F43 T48 C61 V62	C42-C46 WeakPolarHBondContact O-CB 3.46Å; C42-C46 PolarHBondContact O-N 2.91Å; F43-C46 PolarHBondContact O-N 2.85Å; C46-T48 PolarHBondContact O-N 3.03Å; C46-C61 WeakPolarHBondContact CA-SG 3.34Å; C46-C61 HydrophobicContact CB-CB 3.54Å; C46-C61 WeakPolarHBondContact CB-SG 3.44Å; C46-C61 WeakPolarHBondContact SG-CB 3.26Å; C46-C61 PolarHBondContact SG-O 3.01Å; C46-C61 CovalentContact SG-SG 2.05Å; C46-C61 PolarHBondContact SG-SG 3.45Å; C46-V62 HydrophobicContact CB-CG2 3.63Å; C46-V62 PolarHBondContact SG-N 3.12Å; C46-V62 VanDerWaalsContact SG-N 3.43Å
47	V	98.1	Very high	97.3	Very high	16 Å²	16	87.1 Å²	87.1	10%	0.097	48%	0.482	C	S	.	.			trans	-93.1	98	-176.6	-175.2	0	0	0	0	109.2	F43 P50 L54	F43-V47 HydrophobicContact CD2-CB 3.98Å; F43-V47 HydrophobicContact CD2-CG1 4.42Å; F43-V47 HydrophobicContact CD2-CG2 3.56Å; F43-V47 HydrophobicContact CE2-CB 3.86Å; F43-V47 HydrophobicContact CE2-CG1 3.8Å; F43-V47 HydrophobicContact CE2-CG2 3.76Å; F43-V47 HydrophobicContact CG-CB 4.37Å; F43-V47 HydrophobicContact CG-CG2 4.19Å; F43-V47 HydrophobicContact CZ-CB 4.14Å; F43-V47 HydrophobicContact CZ-CG1 3.95Å; F43-V47 WeakPolarHBondContact O-CB 3.26Å; F43-V47 PolarHBondContact O-N 3.4Å; V47-P50 HydrophobicContact CG1-CB 4.5Å; V47-P50 HydrophobicContact CG1-CG 4.31Å; V47-L54 HydrophobicContact CG1-CD2 4.44Å; V47-L54 HydrophobicContact CG2-CD2 3.6Å
48	T	95.8	Very high	97.3	Very high	115 Å²	115	82.6 Å²	82.6	71%	0.706	46%	0.463	S	S	*	.	S	Bend	trans	-89.4	-24.6	-177.4	62.1	0	0	0	0	112.2	C46 E58	C46-T48 PolarHBondContact O-N 3.03Å; T48-E58 PolarHBondContact N-OE1 3.39Å
49	K	94.6	Very high	97.3	Very high	163 Å²	163	87 Å²	87	71%	0.709	48%	0.483	S	S	*	.	S	Bend	trans	-130.7	88.7	177.3	-65.5	177.9	-173.6	171.6	0	109	G51 E58	K49-G51 PolarHBondContact O-N 3.45Å; K49-E58 PolarHBondContact N-OE1 3.49Å
50	P	95.4	Very high	97.4	Very high	103 Å²	103	91.6 Å²	91.6	67%	0.669	50%	0.496	S	S	*	.			trans	-54.2	130.5	177.9	-26.1	35	0	0	0	111.5	F43 V47	F43-P50 HydrophobicContact CZ-CB 4.49Å; F43-P50 HydrophobicContact CZ-CG 4.46Å; V47-P50 HydrophobicContact CG1-CB 4.5Å; V47-P50 HydrophobicContact CG1-CG 4.31Å
51	G	95	Very high	97.4	Very high	64 Å²	64	89.3 Å²	89.3	66%	0.66	49%	0.487	S	S	*	.			trans	-155.4	-172.5	-177.2	0	0	0	0	0	111.6	K49 S53	K49-G51 PolarHBondContact O-N 3.45Å; G51-S53 PolarHBondContact O-N 3.46Å
52	T	96.4	Very high	97.4	Very high	154 Å²	154	86 Å²	86	95%	0.945	47%	0.474	S	S	*	.	S	Bend	trans	-77.7	-9.5	179.4	52.2	0	0	0	0	113.5
53	S	97	Very high	97.4	Very high	89 Å²	89	87.5 Å²	87.5	62%	0.622	49%	0.491	S	S	*	.	S	Bend	trans	-150.3	148	-179.7	59.6	0	0	0	0	110.5	G51	G51-S53 PolarHBondContact O-N 3.46Å
54	L	97	Very high	97.4	Very high	64 Å²	64	87 Å²	87	34%	0.335	49%	0.492	S	S	.	.			trans	-80.2	131.1	168.8	-60.3	-179.3	0	0	0	110.1	V47 E58 Q59 V62	V47-L54 HydrophobicContact CG1-CD2 4.44Å; V47-L54 HydrophobicContact CG2-CD2 3.6Å; L54-E58 WeakPolarHBondContact CA-OE2 3.29Å; L54-E58 HydrophobicContact CB-CB 4.1Å; L54-E58 HydrophobicContact CD2-CB 4.17Å; L54-Q59 HydrophobicContact CB-CG 3.59Å; L54-Q59 HydrophobicContact CD1-CG 4.38Å; L54-Q59 PolarHBondContact O-NE2 3.43Å; L54-V62 HydrophobicContact CD1-CG2 4.32Å
55	D	96.7	Very high	97.4	Very high	79 Å²	79	82.4 Å²	82.4	42%	0.422	47%	0.474	S	S	.	.			trans	-71.5	169.8	170.1	78.5	37.4	0	0	0	111.8	S57 E58 Q59	D55-S57 PolarHBondContact O-N 3.02Å; D55-S57 VanDerWaalsContact OD1-CA 3.32Å; D55-S57 WeakPolarHBondContact OD1-CA 3.29Å; D55-S57 VanDerWaalsContact OD1-CB 3.25Å; D55-S57 WeakPolarHBondContact OD1-CB 3.4Å; D55-S57 PolarHBondContact OD1-N 2.96Å; D55-E58 PolarHBondContact N-OE2 3.24Å; D55-E58 VanDerWaalsContact N-OE2 3.12Å; D55-E58 PolarHBondContact O-N 3.45Å; D55-E58 PolarHBondContact OD1-N 2.88Å; D55-Q59 VanDerWaalsContact O-CG 3.3Å; D55-Q59 WeakPolarHBondContact O-CG 3.43Å; D55-Q59 PolarHBondContact O-N 3.07Å
56	N	97.8	Very high	97.5	Very high	132 Å²	132	78.2 Å²	78.2	71%	0.706	46%	0.457	S	S	*	.	H	α-helix	trans	-58.2	-32.4	-177.3	-68.9	-17.1	0	0	0	113.4	K60	N56-K60 WeakPolarHBondContact O-CB 3.36Å; N56-K60 PolarHBondContact O-N 3.49Å
57	S	97.9	Very high	97.4	Very high	90 Å²	90	82.4 Å²	82.4	63%	0.629	48%	0.479	S	S	*	.	H	α-helix	trans	-74.8	-43.2	178.9	-53.3	0	0	0	0	110.6	D55 K60 C61	D55-S57 PolarHBondContact O-N 3.02Å; D55-S57 VanDerWaalsContact OD1-CA 3.32Å; D55-S57 WeakPolarHBondContact OD1-CA 3.29Å; D55-S57 VanDerWaalsContact OD1-CB 3.25Å; D55-S57 WeakPolarHBondContact OD1-CB 3.4Å; D55-S57 PolarHBondContact OD1-N 2.96Å; S57-K60 PolarHBondContact O-N 2.89Å; S57-C61 WeakPolarHBondContact O-CB 3.45Å; S57-C61 PolarHBondContact O-N 3.02Å
58	E	98.3	Very high	97.5	Very high	10 Å²	10	89.6 Å²	89.6	5%	0.047	50%	0.504	C	S	.	.	H	α-helix	trans	-63.6	-45.4	176.3	-63.1	-178.6	139.8	0	0	111	T48 K49 L54 D55 K60 C61 V62	T48-E58 PolarHBondContact N-OE1 3.39Å; K49-E58 PolarHBondContact N-OE1 3.49Å; L54-E58 WeakPolarHBondContact CA-OE2 3.29Å; L54-E58 HydrophobicContact CB-CB 4.1Å; L54-E58 HydrophobicContact CD2-CB 4.17Å; D55-E58 PolarHBondContact N-OE2 3.24Å; D55-E58 VanDerWaalsContact N-OE2 3.12Å; D55-E58 PolarHBondContact O-N 3.45Å; D55-E58 PolarHBondContact OD1-N 2.88Å; E58-K60 PolarHBondContact O-N 3.35Å; E58-C61 PolarHBondContact O-N 3.44Å; E58-V62 WeakPolarHBondContact O-CG2 3.4Å; E58-V62 PolarHBondContact O-N 3.35Å
59	Q	98	Very high	97.6	Very high	107 Å²	107	87 Å²	87	50%	0.5	48%	0.482	S	S	.	.	H	α-helix	trans	-57.4	-48.2	175.7	-71.1	177.7	8.7	0	0	112	L54 D55 C61 V62 G63	L54-Q59 HydrophobicContact CB-CG 3.59Å; L54-Q59 HydrophobicContact CD1-CG 4.38Å; L54-Q59 PolarHBondContact O-NE2 3.43Å; D55-Q59 VanDerWaalsContact O-CG 3.3Å; D55-Q59 WeakPolarHBondContact O-CG 3.43Å; D55-Q59 PolarHBondContact O-N 3.07Å; Q59-C61 VanDerWaalsContact C-N 3.35Å; Q59-C61 PolarHBondContact O-N 2.98Å; Q59-V62 PolarHBondContact O-N 2.68Å; Q59-G63 PolarHBondContact O-N 3.32Å
60	K	98.5	Very high	97.8	Very high	152 Å²	152	81.8 Å²	81.8	66%	0.661	46%	0.464	S	S	*	.	H	α-helix	trans	-62.7	-42.3	177.6	-177.7	177.2	178.4	180	0	111.6	N56 S57 E58 L64	N56-K60 WeakPolarHBondContact O-CB 3.36Å; N56-K60 PolarHBondContact O-N 3.49Å; S57-K60 PolarHBondContact O-N 2.89Å; E58-K60 PolarHBondContact O-N 3.35Å; K60-L64 HydrophobicContact CG-CD1 4.14Å; K60-L64 WeakPolarHBondContact O-CG 3.41Å; K60-L64 PolarHBondContact O-N 3.43Å; K60-L64 VanDerWaalsContact O-N 3.11Å
61	C	98.8	Very high	97.9	Very high	49 Å²	49	80.6 Å²	80.6	33%	0.331	45%	0.452	S	S	.	.	H	α-helix	trans	-62.8	-47.4	177.2	-178.5	0	0	0	0	111.4	C46 S57 E58 Q59 G63 L64 C65	C46-C61 WeakPolarHBondContact CA-SG 3.34Å; C46-C61 HydrophobicContact CB-CB 3.54Å; C46-C61 WeakPolarHBondContact CB-SG 3.44Å; C46-C61 WeakPolarHBondContact SG-CB 3.26Å; C46-C61 PolarHBondContact SG-O 3.01Å; C46-C61 CovalentContact SG-SG 2.05Å; C46-C61 PolarHBondContact SG-SG 3.45Å; S57-C61 WeakPolarHBondContact O-CB 3.45Å; S57-C61 PolarHBondContact O-N 3.02Å; E58-C61 PolarHBondContact O-N 3.44Å; Q59-C61 VanDerWaalsContact C-N 3.35Å; Q59-C61 PolarHBondContact O-N 2.98Å; C61-G63 PolarHBondContact O-N 3.47Å; C61-L64 PolarHBondContact O-N 2.95Å; C61-C65 VanDerWaalsContact O-CB 3.25Å; C61-C65 WeakPolarHBondContact O-CB 3.27Å; C61-C65 PolarHBondContact O-N 2.9Å
62	V	98.5	Very high	98	Very high	21 Å²	21	80 Å²	80	13%	0.127	44%	0.441	C	S	.	.	H	α-helix	trans	-60.2	-46.2	-179.9	170.3	0	0	0	0	110.8	C46 L54 E58 Q59 L64 C65 M66	C46-V62 HydrophobicContact CB-CG2 3.63Å; C46-V62 PolarHBondContact SG-N 3.12Å; C46-V62 VanDerWaalsContact SG-N 3.43Å; L54-V62 HydrophobicContact CD1-CG2 4.32Å; E58-V62 WeakPolarHBondContact O-CG2 3.4Å; E58-V62 PolarHBondContact O-N 3.35Å; Q59-V62 PolarHBondContact O-N 2.68Å; V62-L64 PolarHBondContact O-N 2.99Å; V62-C65 PolarHBondContact O-N 3.14Å; V62-M66 HydrophobicContact CG1-CE 3.63Å; V62-M66 HydrophobicContact CG1-CG 4.4Å; V62-M66 HydrophobicContact CG1-SD 3.98Å; V62-M66 WeakPolarHBondContact O-CG 3.21Å; V62-M66 PolarHBondContact O-N 2.86Å
63	G	98.3	Very high	98.1	Very high	34 Å²	34	78.3 Å²	78.3	35%	0.351	42%	0.417	S	S	.	.	H	α-helix	trans	-57.3	-50.3	176.2	0	0	0	0	0	112.5	Q59 C61 C65 M66 D67	Q59-G63 PolarHBondContact O-N 3.32Å; C61-G63 PolarHBondContact O-N 3.47Å; G63-C65 VanDerWaalsContact C-N 3.32Å; G63-C65 PolarHBondContact O-N 2.95Å; G63-M66 PolarHBondContact O-N 3.39Å; G63-D67 PolarHBondContact O-N 3.02Å; G63-D67 VanDerWaalsContact O-N 3.12Å
64	L	98.7	Very high	98.1	Very high	98 Å²	98	77.8 Å²	77.8	51%	0.513	41%	0.407	S	S	.	.	H	α-helix	trans	-62	-39.4	176.4	-71.6	170.4	0	0	0	112.6	K60 C61 V62 R68	K60-L64 HydrophobicContact CG-CD1 4.14Å; K60-L64 WeakPolarHBondContact O-CG 3.41Å; K60-L64 PolarHBondContact O-N 3.43Å; K60-L64 VanDerWaalsContact O-N 3.11Å; C61-L64 PolarHBondContact O-N 2.95Å; V62-L64 PolarHBondContact O-N 2.99Å; L64-R68 WeakPolarHBondContact O-CB 3.34Å; L64-R68 VanDerWaalsContact O-CG 3.26Å; L64-R68 WeakPolarHBondContact O-CG 3.31Å; L64-R68 PolarHBondContact O-N 3.4Å
65	C	98.8	Very high	98.2	Very high	27 Å²	27	80.2 Å²	80.2	18%	0.182	42%	0.42	C	S	.	.	H	α-helix	trans	-63.2	-46	178.5	175.2	0	0	0	0	111.2	C42 C61 V62 G63 R68 Y69	C42-C65 WeakPolarHBondContact CA-SG 3.25Å; C42-C65 HydrophobicContact CB-CB 3.78Å; C42-C65 WeakPolarHBondContact CB-SG 3.16Å; C42-C65 WeakPolarHBondContact SG-CB 3.04Å; C42-C65 CovalentContact SG-SG 2.05Å; C42-C65 PolarHBondContact SG-SG 3.34Å; C61-C65 VanDerWaalsContact O-CB 3.25Å; C61-C65 WeakPolarHBondContact O-CB 3.27Å; C61-C65 PolarHBondContact O-N 2.9Å; V62-C65 PolarHBondContact O-N 3.14Å; G63-C65 VanDerWaalsContact C-N 3.32Å; G63-C65 PolarHBondContact O-N 2.95Å; C65-R68 PolarHBondContact O-N 3.22Å; C65-Y69 WeakPolarHBondContact O-CB 3.04Å; C65-Y69 PolarHBondContact O-N 3.48Å
66	M	98.4	Very high	98.2	Very high	67 Å²	67	81 Å²	81	33%	0.33	43%	0.427	S	S	.	.	H	α-helix	trans	-61	-46.9	178.1	-71.5	176.2	170.8	0	0	111.3	M38 V62 G63 R68 Y69 V70	M38-M66 HydrophobicContact CE-CG 4.27Å; M38-M66 HydrophobicContact CG-CG 4.16Å; M38-M66 HydrophobicContact SD-CB 3.93Å; M38-M66 HydrophobicContact SD-CG 3.96Å; V62-M66 HydrophobicContact CG1-CE 3.63Å; V62-M66 HydrophobicContact CG1-CG 4.4Å; V62-M66 HydrophobicContact CG1-SD 3.98Å; V62-M66 WeakPolarHBondContact O-CG 3.21Å; V62-M66 PolarHBondContact O-N 2.86Å; G63-M66 PolarHBondContact O-N 3.39Å; M66-R68 PolarHBondContact O-N 3.31Å; M66-Y69 PolarHBondContact O-N 2.81Å; M66-V70 WeakPolarHBondContact O-CG2 3Å; M66-V70 PolarHBondContact O-N 3.21Å
67	D	98.5	Very high	98.1	Very high	97 Å²	97	76.8 Å²	76.8	52%	0.519	41%	0.408	S	S	.	.	H	α-helix	trans	-57.2	-49.7	176.6	-69.9	-22.2	0	0	0	111.4	G63 Y69 V70 D71	G63-D67 PolarHBondContact O-N 3.02Å; G63-D67 VanDerWaalsContact O-N 3.12Å; D67-Y69 VanDerWaalsContact C-N 3.32Å; D67-Y69 PolarHBondContact O-N 2.61Å; D67-V70 PolarHBondContact O-N 3.11Å; D67-D71 WeakPolarHBondContact O-CB 3.35Å; D67-D71 VanDerWaalsContact O-CG 3.29Å; D67-D71 PolarHBondContact O-N 2.78Å
68	R	98.4	Very high	98.1	Very high	167 Å²	167	79.7 Å²	79.7	63%	0.63	41%	0.409	S	S	*	.	H	α-helix	trans	-65.1	-35.2	178.5	-68.7	-61.3	87.8	144.7	2.3	112.9	L64 C65 M66 D71 A72	L64-R68 WeakPolarHBondContact O-CB 3.34Å; L64-R68 VanDerWaalsContact O-CG 3.26Å; L64-R68 WeakPolarHBondContact O-CG 3.31Å; L64-R68 PolarHBondContact O-N 3.4Å; C65-R68 PolarHBondContact O-N 3.22Å; M66-R68 PolarHBondContact O-N 3.31Å; R68-D71 IonicContact CZ-OD2 3.32Å; R68-D71 VanDerWaalsContact CZ-OD2 3.23Å; R68-D71 IonicContact NE-OD2 2.72Å; R68-D71 PolarHBondContact NE-OD2 3.39Å; R68-D71 IonicContact NH2-OD2 2.61Å; R68-D71 PolarHBondContact NH2-OD2 3.04Å; R68-A72 VanDerWaalsContact O-CB 3.29Å; R68-A72 WeakPolarHBondContact O-CB 3.08Å; R68-A72 PolarHBondContact O-N 3.33Å
69	Y	98.6	Very high	98.1	Very high	61 Å²	61	82.1 Å²	82.1	24%	0.239	43%	0.425	C	S	.	.	H	α-helix	trans	-66.5	-46.1	178.9	-171	-85.2	0	0	0	110.9	L34 K37 M38 K41 C65 M66 D67 A72 W73	L34-Y69 HydrophobicContact CD1-CD1 4.36Å; L34-Y69 HydrophobicContact CD1-CE1 3.68Å; K37-Y69 VanDerWaalsContact CB-OH 3.31Å; K37-Y69 WeakPolarHBondContact CB-OH 3.37Å; M38-Y69 HydrophobicContact CB-CD1 3.53Å; M38-Y69 HydrophobicContact CB-CE1 3.55Å; M38-Y69 HydrophobicContact CB-CG 4.06Å; M38-Y69 HydrophobicContact CG-CD1 3.53Å; M38-Y69 HydrophobicContact CG-CD2 4.45Å; M38-Y69 HydrophobicContact CG-CE1 4.1Å; M38-Y69 HydrophobicContact CG-CG 3.73Å; M38-Y69 HydrophobicContact SD-CD1 3.83Å; M38-Y69 HydrophobicContact SD-CG 4.29Å; K41-Y69 HydrophobicContact CB-CE2 4.24Å; K41-Y69 HydrophobicContact CG-CE2 4.29Å; C65-Y69 WeakPolarHBondContact O-CB 3.04Å; C65-Y69 PolarHBondContact O-N 3.48Å; M66-Y69 PolarHBondContact O-N 2.81Å; D67-Y69 VanDerWaalsContact C-N 3.32Å; D67-Y69 PolarHBondContact O-N 2.61Å; Y69-A72 PolarHBondContact O-N 3.46Å; Y69-W73 VanDerWaalsContact O-CB 3.29Å; Y69-W73 WeakPolarHBondContact O-CB 3.25Å; Y69-W73 PolarHBondContact O-N 2.05Å
70	V	97.9	Very high	98.1	Very high	53 Å²	53	83.2 Å²	83.2	32%	0.321	43%	0.428	S	S	.	.	H	α-helix	trans	-64.1	-43.7	176.4	173.3	0	0	0	0	111.1	M38 M66 D67 A72 W73 N74	M38-V70 HydrophobicContact SD-CG2 3.86Å; M66-V70 WeakPolarHBondContact O-CG2 3Å; M66-V70 PolarHBondContact O-N 3.21Å; D67-V70 PolarHBondContact O-N 3.11Å; V70-A72 PolarHBondContact O-N 2.91Å; V70-W73 PolarHBondContact O-N 3.36Å; V70-N74 WeakPolarHBondContact CG1-ND2 3.46Å; V70-N74 WeakPolarHBondContact O-CB 3.33Å; V70-N74 VanDerWaalsContact O-CG 3.3Å; V70-N74 PolarHBondContact O-N 2.67Å; V70-N74 PolarHBondContact O-ND2 2.91Å
71	D	98.3	Very high	98	Very high	78 Å²	78	78.8 Å²	78.8	42%	0.417	42%	0.42	S	S	.	.	H	α-helix	trans	-57.9	-48.1	175.5	-75.8	-20.6	0	0	0	111.9	D67 R68 N74 L75	D67-D71 WeakPolarHBondContact O-CB 3.35Å; D67-D71 VanDerWaalsContact O-CG 3.29Å; D67-D71 PolarHBondContact O-N 2.78Å; R68-D71 IonicContact CZ-OD2 3.32Å; R68-D71 VanDerWaalsContact CZ-OD2 3.23Å; R68-D71 IonicContact NE-OD2 2.72Å; R68-D71 PolarHBondContact NE-OD2 3.39Å; R68-D71 IonicContact NH2-OD2 2.61Å; R68-D71 PolarHBondContact NH2-OD2 3.04Å; D71-N74 PolarHBondContact O-N 3.49Å; D71-L75 WeakPolarHBondContact O-CB 3.32Å; D71-L75 PolarHBondContact O-N 3.38Å
72	A	98.3	Very high	98	Very high	52 Å²	52	79.8 Å²	79.8	43%	0.43	43%	0.428	S	S	.	.	H	α-helix	trans	-64.4	-44.4	178.9	0	0	0	0	0	111.4	R68 Y69 V70 N74 L75 V76	R68-A72 VanDerWaalsContact O-CB 3.29Å; R68-A72 WeakPolarHBondContact O-CB 3.08Å; R68-A72 PolarHBondContact O-N 3.33Å; Y69-A72 PolarHBondContact O-N 3.46Å; V70-A72 PolarHBondContact O-N 2.91Å; A72-N74 PolarHBondContact O-N 3.14Å; A72-L75 PolarHBondContact O-N 3.33Å; A72-V76 WeakPolarHBondContact O-CB 3.18Å; A72-V76 VanDerWaalsContact O-CG2 3.26Å; A72-V76 WeakPolarHBondContact O-CG2 3.38Å; A72-V76 PolarHBondContact O-N 2.94Å
73	W	97.2	Very high	98	Very high	117 Å²	117	86.4 Å²	86.4	44%	0.443	45%	0.45	S	S	.	.	H	α-helix	trans	-60.6	-44.3	177.2	178.6	81.9	0	0	0	111.8	L34 Y69 V70 V76 S77	L34-W73 HydrophobicContact CD1-CB 4.26Å; L34-W73 HydrophobicContact CD1-CD2 3.8Å; L34-W73 HydrophobicContact CD1-CG 3.62Å; L34-W73 HydrophobicContact CD2-CD2 4.19Å; L34-W73 HydrophobicContact CD2-CE3 4.18Å; L34-W73 HydrophobicContact CD2-CH2 4.45Å; L34-W73 HydrophobicContact CD2-CZ2 4.45Å; L34-W73 HydrophobicContact CD2-CZ3 4.32Å; Y69-W73 VanDerWaalsContact O-CB 3.29Å; Y69-W73 WeakPolarHBondContact O-CB 3.25Å; Y69-W73 PolarHBondContact O-N 2.05Å; V70-W73 PolarHBondContact O-N 3.36Å; W73-V76 PolarHBondContact O-N 2.05Å; W73-S77 WeakPolarHBondContact O-CB 3.35Å; W73-S77 PolarHBondContact O-N 2.91Å; W73-S77 PolarHBondContact O-OG 3.22Å
74	N	97.1	Very high	97.9	Very high	79 Å²	79	89.1 Å²	89.1	42%	0.422	46%	0.456	S	S	.	.	H	α-helix	trans	-62	-46	176.7	-78.1	-34.8	0	0	0	111.9	V70 D71 A72 K78	V70-N74 WeakPolarHBondContact CG1-ND2 3.46Å; V70-N74 WeakPolarHBondContact O-CB 3.33Å; V70-N74 VanDerWaalsContact O-CG 3.3Å; V70-N74 PolarHBondContact O-N 2.67Å; V70-N74 PolarHBondContact O-ND2 2.91Å; D71-N74 PolarHBondContact O-N 3.49Å; A72-N74 PolarHBondContact O-N 3.14Å; N74-K78 WeakPolarHBondContact O-CB 3.23Å; N74-K78 PolarHBondContact O-N 3.44Å
75	L	98.4	Very high	97.8	Very high	115 Å²	115	91.1 Å²	91.1	60%	0.602	46%	0.46	S	S	*	.	H	α-helix	trans	-61.9	-50.4	178.4	176.7	60.9	0	0	0	111.4	D71 A72 K78 V79	D71-L75 WeakPolarHBondContact O-CB 3.32Å; D71-L75 PolarHBondContact O-N 3.38Å; A72-L75 PolarHBondContact O-N 3.33Å; L75-K78 PolarHBondContact O-N 3.19Å; L75-V79 HydrophobicContact CD1-CG2 4.21Å; L75-V79 WeakPolarHBondContact O-CG2 3.3Å; L75-V79 PolarHBondContact O-N 3.04Å
76	V	97.8	Very high	97.8	Very high	95 Å²	95	96.6 Å²	96.6	58%	0.576	48%	0.477	S	S	*	.	H	α-helix	trans	-61.9	-46.1	179.5	172.3	0	0	0	0	110.3	A72 W73 K78 V79 F80	A72-V76 WeakPolarHBondContact O-CB 3.18Å; A72-V76 VanDerWaalsContact O-CG2 3.26Å; A72-V76 WeakPolarHBondContact O-CG2 3.38Å; A72-V76 PolarHBondContact O-N 2.94Å; W73-V76 PolarHBondContact O-N 2.05Å; V76-K78 VanDerWaalsContact C-N 3.34Å; V76-K78 PolarHBondContact O-N 3.44Å; V76-V79 PolarHBondContact O-N 2.87Å; V76-F80 WeakPolarHBondContact O-CB 3.2Å; V76-F80 PolarHBondContact O-N 3.18Å
77	S	96.2	Very high	97.7	Very high	43 Å²	43	97.2 Å²	97.2	30%	0.301	48%	0.479	S	S	.	.	H	α-helix	trans	-59.1	-44.8	178.9	-62.4	0	0	0	0	111.7	W73 F80 A81	W73-S77 WeakPolarHBondContact O-CB 3.35Å; W73-S77 PolarHBondContact O-N 2.91Å; W73-S77 PolarHBondContact O-OG 3.22Å; S77-F80 PolarHBondContact O-N 2.76Å; S77-A81 VanDerWaalsContact O-CB 3.32Å; S77-A81 WeakPolarHBondContact O-CB 3.44Å; S77-A81 PolarHBondContact O-N 3.18Å
78	K	97.6	Very high	97.6	Very high	151 Å²	151	95.2 Å²	95.2	66%	0.657	48%	0.477	S	S	*	.	H	α-helix	trans	-62.2	-47.3	176.9	-178.7	179.4	179.1	179.2	0	112.3	N74 L75 V76 S82	N74-K78 WeakPolarHBondContact O-CB 3.23Å; N74-K78 PolarHBondContact O-N 3.44Å; L75-K78 PolarHBondContact O-N 3.19Å; V76-K78 VanDerWaalsContact C-N 3.34Å; V76-K78 PolarHBondContact O-N 3.44Å; K78-S82 WeakPolarHBondContact O-CB 3.24Å; K78-S82 PolarHBondContact O-N 3.3Å; K78-S82 PolarHBondContact O-OG 2.86Å
79	V	98.4	Very high	97.4	Very high	61 Å²	61	93.5 Å²	93.5	37%	0.37	48%	0.476	S	S	.	.	H	α-helix	trans	-65.6	-43	179.8	171.9	0	0	0	0	110.6	L75 V76 S82 R83	L75-V79 HydrophobicContact CD1-CG2 4.21Å; L75-V79 WeakPolarHBondContact O-CG2 3.3Å; L75-V79 PolarHBondContact O-N 3.04Å; V76-V79 PolarHBondContact O-N 2.87Å; V79-S82 PolarHBondContact O-N 2.92Å; V79-R83 WeakPolarHBondContact O-CG 3.32Å; V79-R83 PolarHBondContact O-N 2.9Å
80	F	97.8	Very high	97.3	Very high	131 Å²	131	97 Å²	97	58%	0.575	49%	0.492	S	S	*	.	H	α-helix	trans	-62.9	-48	178.8	-175.8	-112.7	0	0	0	111.7	V76 S77 S82 R83 I84	V76-F80 WeakPolarHBondContact O-CB 3.2Å; V76-F80 PolarHBondContact O-N 3.18Å; S77-F80 PolarHBondContact O-N 2.76Å; F80-S82 VanDerWaalsContact C-N 3.32Å; F80-S82 PolarHBondContact O-N 3.43Å; F80-R83 PolarHBondContact O-N 3.15Å; F80-R83 VanDerWaalsContact O-N 3.15Å; F80-I84 HydrophobicContact CD1-CD1 3.68Å; F80-I84 HydrophobicContact CE1-CD1 3.24Å; F80-I84 HydrophobicContact CE1-CG1 4.28Å; F80-I84 HydrophobicContact CE2-CD1 4.21Å; F80-I84 HydrophobicContact CE2-CG1 4.46Å; F80-I84 HydrophobicContact CG-CD1 4.35Å; F80-I84 HydrophobicContact CZ-CD1 3.54Å; F80-I84 HydrophobicContact CZ-CG1 4.22Å; F80-I84 PolarHBondContact O-N 2.72Å
81	A	96.6	Very high	96.8	Very high	58 Å²	58	104.5 Å²	104.5	48%	0.479	53%	0.529	S	S	.	.	H	α-helix	trans	-59.7	-41.9	175.6	0	0	0	0	0	112.2	S77 R83 I84 K85	S77-A81 VanDerWaalsContact O-CB 3.32Å; S77-A81 WeakPolarHBondContact O-CB 3.44Å; S77-A81 PolarHBondContact O-N 3.18Å; A81-R83 VanDerWaalsContact C-N 3.32Å; A81-R83 PolarHBondContact O-N 2.85Å; A81-I84 PolarHBondContact O-N 3.43Å; A81-K85 PolarHBondContact O-N 2.97Å
82	S	97.8	Very high	96.7	Very high	71 Å²	71	105.9 Å²	105.9	50%	0.497	54%	0.535	S	S	.	.	H	α-helix	trans	-62.6	-39.7	176.4	-56.7	0	0	0	0	112	K78 V79 F80 R86	K78-S82 WeakPolarHBondContact O-CB 3.24Å; K78-S82 PolarHBondContact O-N 3.3Å; K78-S82 PolarHBondContact O-OG 2.86Å; V79-S82 PolarHBondContact O-N 2.92Å; F80-S82 VanDerWaalsContact C-N 3.32Å; F80-S82 PolarHBondContact O-N 3.43Å; S82-R86 PolarHBondContact O-N 3.38Å; S82-R86 VanDerWaalsContact O-N 3.17Å
83	R	97.9	Very high	96.6	Very high	159 Å²	159	108.7 Å²	108.7	60%	0.6	54%	0.54	S	S	*	.	H	α-helix	trans	-66.6	-47.5	175.9	-73.6	176.5	-176.7	-165.6	2.2	111.5	V79 F80 A81 K85 R86 E87	V79-R83 WeakPolarHBondContact O-CG 3.32Å; V79-R83 PolarHBondContact O-N 2.9Å; F80-R83 PolarHBondContact O-N 3.15Å; F80-R83 VanDerWaalsContact O-N 3.15Å; A81-R83 VanDerWaalsContact C-N 3.32Å; A81-R83 PolarHBondContact O-N 2.85Å; R83-K85 VanDerWaalsContact C-N 3.29Å; R83-K85 PolarHBondContact O-N 2.84Å; R83-R86 PolarHBondContact O-N 3.45Å; R83-R86 VanDerWaalsContact O-N 3.16Å; R83-E87 WeakPolarHBondContact O-CG 3.29Å; R83-E87 PolarHBondContact O-N 2.95Å
84	I	97.7	Very high	96.6	Very high	92 Å²	92	108.2 Å²	108.2	47%	0.472	55%	0.546	S	S	.	.	H	α-helix	trans	-54.8	-48	177.2	-73.4	171.1	0	0	0	110.5	F80 A81 R86 E87 A88	F80-I84 HydrophobicContact CD1-CD1 3.68Å; F80-I84 HydrophobicContact CE1-CD1 3.24Å; F80-I84 HydrophobicContact CE1-CG1 4.28Å; F80-I84 HydrophobicContact CE2-CD1 4.21Å; F80-I84 HydrophobicContact CE2-CG1 4.46Å; F80-I84 HydrophobicContact CG-CD1 4.35Å; F80-I84 HydrophobicContact CZ-CD1 3.54Å; F80-I84 HydrophobicContact CZ-CG1 4.22Å; F80-I84 PolarHBondContact O-N 2.72Å; A81-I84 PolarHBondContact O-N 3.43Å; I84-R86 PolarHBondContact O-N 2.95Å; I84-E87 PolarHBondContact O-N 3.32Å; I84-A88 WeakPolarHBondContact O-CB 3.25Å; I84-A88 PolarHBondContact O-N 3.38Å
85	K	96.9	Very high	96.6	Very high	139 Å²	139	109.9 Å²	109.9	60%	0.604	55%	0.553	S	S	*	*	H	α-helix	trans	-56.8	-48.9	178.3	-178	179.3	174	-177.2	0	111.6	A81 R83 E87 A88 E89	A81-K85 PolarHBondContact O-N 2.97Å; R83-K85 VanDerWaalsContact C-N 3.29Å; R83-K85 PolarHBondContact O-N 2.84Å; K85-E87 PolarHBondContact O-N 3.42Å; K85-A88 PolarHBondContact O-N 3.34Å; K85-E89 WeakPolarHBondContact CE-OE1 3.44Å; K85-E89 WeakPolarHBondContact O-CG 3.41Å; K85-E89 PolarHBondContact O-N 3.15Å; K85-E89 VanDerWaalsContact O-N 3.14Å
86	R	97.1	Very high	96.5	Very high	142 Å²	142	109.6 Å²	109.6	54%	0.536	55%	0.55	S	S	.	*	H	α-helix	trans	-63.8	-38.9	-180	-170.5	-171.5	72.6	174.4	3.3	112.9	S82 R83 I84	S82-R86 PolarHBondContact O-N 3.38Å; S82-R86 VanDerWaalsContact O-N 3.17Å; R83-R86 PolarHBondContact O-N 3.45Å; R83-R86 VanDerWaalsContact O-N 3.16Å; I84-R86 PolarHBondContact O-N 2.95Å
87	E	97.4	Very high	96.4	Very high	80 Å²	80	110.6 Å²	110.6	37%	0.374	55%	0.548	S	S	.	.	H	α-helix	trans	-73.1	-31.3	178.3	-61	-49.5	132.9	0	0	111.8	R83 I84 K85 E89 K90	R83-E87 WeakPolarHBondContact O-CG 3.29Å; R83-E87 PolarHBondContact O-N 2.95Å; I84-E87 PolarHBondContact O-N 3.32Å; K85-E87 PolarHBondContact O-N 3.42Å; E87-E89 VanDerWaalsContact C-N 3.35Å; E87-K90 VanDerWaalsContact CD-NZ 3.29Å; E87-K90 PolarHBondContact O-N 3.12Å; E87-K90 IonicContact OE1-NZ 3.06Å; E87-K90 PolarHBondContact OE1-NZ 3.45Å; E87-K90 IonicContact OE2-NZ 2.76Å; E87-K90 PolarHBondContact OE2-NZ 3.42Å
88	A	96	Very high	96.4	Very high	56 Å²	56	115.4 Å²	115.4	46%	0.463	57%	0.566	S	S	.	*	H	α-helix	trans	-67.9	-32.1	174	0	0	0	0	0	113	I84 K85 K90 L91	I84-A88 WeakPolarHBondContact O-CB 3.25Å; I84-A88 PolarHBondContact O-N 3.38Å; K85-A88 PolarHBondContact O-N 3.34Å; A88-K90 PolarHBondContact O-N 3.21Å; A88-L91 PolarHBondContact O-N 3.28Å
89	E	95.4	Very high	96.3	Very high	131 Å²	131	112.7 Å²	112.7	61%	0.612	56%	0.559	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.6	-10.7	176.2	-72	167.5	-178.2	0	0	113.8	K85 E87	K85-E89 WeakPolarHBondContact CE-OE1 3.44Å; K85-E89 WeakPolarHBondContact O-CG 3.41Å; K85-E89 PolarHBondContact O-N 3.15Å; K85-E89 VanDerWaalsContact O-N 3.14Å; E87-E89 VanDerWaalsContact C-N 3.35Å
90	K	94.6	Very high	96.1	Very high	134 Å²	134	117 Å²	117	58%	0.583	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.1	-7.3	176.9	-64.8	178	-172.9	167.4	0	113.7	E87 A88	E87-K90 VanDerWaalsContact CD-NZ 3.29Å; E87-K90 PolarHBondContact O-N 3.12Å; E87-K90 IonicContact OE1-NZ 3.06Å; E87-K90 PolarHBondContact OE1-NZ 3.45Å; E87-K90 IonicContact OE2-NZ 2.76Å; E87-K90 PolarHBondContact OE2-NZ 3.42Å; A88-K90 PolarHBondContact O-N 3.21Å
91	L	88.3	Confident	96	Very high	211 Å²	211	115.7 Å²	115.7	100%	1.105	58%	0.575	S	S	*	*			trans	-95.6	0	178	-61.8	176.7	0	0	0	110	A88	A88-L91 PolarHBondContact O-N 3.28Å

Retrieved 91 of 91 residues in 64 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).