G4VL14_SCHMA Loading...

Putative prefoldin subunit

AlphaFold DB , UniProt , Accession G4VL14, Species SCHMA (Schistosoma mansoni, Blood fluke), Gene n/a, Length 118 aa.

						>G4VL14_SCHMA|G4VL14
MSDPDVKKAIEAHRQKTVTANQQFSILNSQIESLNIKFRRSQLIESELVTLPGDVATYKACGRMFIKKPRETLVEDIKKDRDKITDSIETTQKARDTVNNELSESKEALRELLSSKQS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47	Very low	80.1	Confident	203 Å²	203	103.1 Å²	103.1	100%	1	54%	0.543	S	S	*	.				0	-10.7	0	-100.3	159.6	172.4	0	0	116.2
2	S	57.3	Low	81	Confident	114 Å²	114	98.4 Å²	98.4	80%	0.797	53%	0.53	S	S	*	.			cis	-149.7	-4.7	1.1	-59.4	0	0	0	0	113.3
3	D	74.1	Confident	81.8	Confident	99 Å²	99	93.6 Å²	93.6	53%	0.529	50%	0.502	S	S	.	.	S	Bend	trans	-147.9	-39.4	-175.6	172.2	31.5	0	0	0	110.2	D5 V6 K7	D3-D5 VanDerWaalsContact C-N 3.3Å; D3-D5 PolarHBondContact O-N 2.81Å; D3-D5 VanDerWaalsContact O-N 3.14Å; D3-V6 PolarHBondContact O-N 3.23Å; D3-K7 WeakPolarHBondContact O-CB 3.47Å; D3-K7 PolarHBondContact O-N 3.04Å
4	P	83.2	Confident	82.6	Confident	83 Å²	83	100.3 Å²	100.3	54%	0.539	52%	0.517	S	S	.	.	H	α-helix	trans	-54.8	-37.8	-179.1	-30	37.8	0	0	0	115.3	K8	P4-K8 WeakPolarHBondContact O-CB 3.43Å; P4-K8 PolarHBondContact O-N 2.97Å
5	D	83.9	Confident	83.4	Confident	89 Å²	89	102.8 Å²	102.8	48%	0.476	53%	0.526	S	S	.	.	H	α-helix	trans	-67.5	-42	178.8	-57.6	-44.2	0	0	0	112.1	D3 K8 A9	D3-D5 VanDerWaalsContact C-N 3.3Å; D3-D5 PolarHBondContact O-N 2.81Å; D3-D5 VanDerWaalsContact O-N 3.14Å; D5-K8 PolarHBondContact O-N 3.31Å; D5-A9 WeakPolarHBondContact O-CB 3.19Å; D5-A9 PolarHBondContact O-N 3.05Å
6	V	85.8	Confident	84	Confident	29 Å²	29	103.9 Å²	103.9	18%	0.176	53%	0.525	C	S	.	.	H	α-helix	trans	-66.7	-48.3	176.9	178.4	0	0	0	0	109.6	D3 K8 A9 I10 L112 L113	D3-V6 PolarHBondContact O-N 3.23Å; V6-K8 VanDerWaalsContact C-N 3.34Å; V6-K8 PolarHBondContact O-N 2.88Å; V6-A9 PolarHBondContact O-N 3.46Å; V6-I10 HydrophobicContact CG1-CD1 3.82Å; V6-I10 HydrophobicContact CG1-CG1 4.49Å; V6-I10 VanDerWaalsContact O-CG1 3.31Å; V6-I10 WeakPolarHBondContact O-CG1 3.37Å; V6-I10 PolarHBondContact O-N 3.2Å; V6-L112 HydrophobicContact CB-CD2 4.33Å; V6-L112 HydrophobicContact CG2-CD2 3.8Å; V6-L113 HydrophobicContact CG1-CD2 3.78Å
7	K	88.4	Confident	84.5	Confident	128 Å²	128	100.1 Å²	100.1	56%	0.557	51%	0.509	S	S	*	.	H	α-helix	trans	-58	-44.3	176.3	-174.2	177.6	179.6	179.6	0	112	D3 I10 E11	D3-K7 WeakPolarHBondContact O-CB 3.47Å; D3-K7 PolarHBondContact O-N 3.04Å; K7-I10 PolarHBondContact O-N 2.85Å; K7-E11 WeakPolarHBondContact O-CB 3.47Å; K7-E11 PolarHBondContact O-N 3.2Å
8	K	90.3	Very high	85.1	Confident	152 Å²	152	98.7 Å²	98.7	66%	0.661	51%	0.505	S	S	*	.	H	α-helix	trans	-65.4	-39	176.6	-175.9	178.3	-179.7	-177.5	0	112.1	P4 D5 V6 E11 A12	P4-K8 WeakPolarHBondContact O-CB 3.43Å; P4-K8 PolarHBondContact O-N 2.97Å; D5-K8 PolarHBondContact O-N 3.31Å; V6-K8 VanDerWaalsContact C-N 3.34Å; V6-K8 PolarHBondContact O-N 2.88Å; K8-E11 PolarHBondContact O-N 3.02Å; K8-A12 VanDerWaalsContact O-CB 3.27Å; K8-A12 WeakPolarHBondContact O-CB 3.47Å; K8-A12 PolarHBondContact O-N 2.8Å
9	A	88.9	Confident	85.6	Confident	27 Å²	27	96.6 Å²	96.6	22%	0.223	50%	0.498	C	S	.	.	H	α-helix	trans	-65.9	-42.1	174.3	0	0	0	0	0	112.2	D5 V6 A12 H13 L112	D5-A9 WeakPolarHBondContact O-CB 3.19Å; D5-A9 PolarHBondContact O-N 3.05Å; V6-A9 PolarHBondContact O-N 3.46Å; A9-A12 PolarHBondContact O-N 2.7Å; A9-H13 WeakPolarHBondContact O-CB 3.33Å; A9-H13 PolarHBondContact O-N 2.72Å; A9-L112 HydrophobicContact CB-CD1 3.8Å; A9-L112 HydrophobicContact CB-CD2 4.41Å
10	I	90.2	Very high	86	Confident	83 Å²	83	92.1 Å²	92.1	43%	0.426	48%	0.476	S	S	.	.	H	α-helix	trans	-62.5	-44.3	174.3	-68.8	166	0	0	0	110.8	V6 K7 H13 R14 L109	V6-I10 HydrophobicContact CG1-CD1 3.82Å; V6-I10 HydrophobicContact CG1-CG1 4.49Å; V6-I10 VanDerWaalsContact O-CG1 3.31Å; V6-I10 WeakPolarHBondContact O-CG1 3.37Å; V6-I10 PolarHBondContact O-N 3.2Å; K7-I10 PolarHBondContact O-N 2.85Å; I10-H13 PolarHBondContact O-N 3.33Å; I10-R14 WeakPolarHBondContact O-CB 3.49Å; I10-R14 PolarHBondContact O-N 2.98Å; I10-L109 HydrophobicContact CG1-CD1 4.08Å
11	E	92.1	Very high	86.4	Confident	127 Å²	127	92 Å²	92	59%	0.593	48%	0.476	S	S	*	.	H	α-helix	trans	-65.6	-44.5	178.6	-174.5	164.2	-156.1	0	0	112	K7 K8 H13 R14 Q15	K7-E11 WeakPolarHBondContact O-CB 3.47Å; K7-E11 PolarHBondContact O-N 3.2Å; K8-E11 PolarHBondContact O-N 3.02Å; E11-H13 PolarHBondContact O-N 3.21Å; E11-R14 PolarHBondContact O-N 3.26Å; E11-Q15 PolarHBondContact O-N 3.28Å
12	A	90.6	Very high	88.8	Confident	47 Å²	47	88 Å²	88	39%	0.388	46%	0.455	S	S	.	.	H	α-helix	trans	-61.9	-42.2	174.1	0	0	0	0	0	112.3	K8 A9 Q15 K16	K8-A12 VanDerWaalsContact O-CB 3.27Å; K8-A12 WeakPolarHBondContact O-CB 3.47Å; K8-A12 PolarHBondContact O-N 2.8Å; A9-A12 PolarHBondContact O-N 2.7Å; A12-Q15 PolarHBondContact O-N 3.32Å; A12-K16 WeakPolarHBondContact O-CG 3.43Å; A12-K16 PolarHBondContact O-N 2.96Å
13	H	92.2	Very high	90.6	Very high	36 Å²	36	86.2 Å²	86.2	17%	0.167	43%	0.434	C	S	.	.	H	α-helix	trans	-66.2	-39	175.3	-180	59.4	0	0	0	112.3	A9 I10 E11 K16 T17 S105 L109	A9-H13 WeakPolarHBondContact O-CB 3.33Å; A9-H13 PolarHBondContact O-N 2.72Å; I10-H13 PolarHBondContact O-N 3.33Å; E11-H13 PolarHBondContact O-N 3.21Å; H13-K16 PolarHBondContact O-N 2.95Å; H13-T17 WeakPolarHBondContact O-CB 3.45Å; H13-T17 PolarHBondContact O-N 3.22Å; H13-T17 PolarHBondContact O-OG1 3.21Å; H13-S105 PolarHBondContact ND1-O 3.09Å; H13-S105 PolarHBondContact ND1-OG 3.3Å; H13-L109 HydrophobicContact CB-CD1 3.55Å
14	R	92.6	Very high	91.6	Very high	187 Å²	187	83.1 Å²	83.1	71%	0.706	42%	0.416	S	S	*	.	H	α-helix	trans	-61.1	-44.7	173.3	-178	-177.2	176.8	-166.3	-1	111	I10 E11 T17 V18	I10-R14 WeakPolarHBondContact O-CB 3.49Å; I10-R14 PolarHBondContact O-N 2.98Å; E11-R14 PolarHBondContact O-N 3.26Å; R14-T17 PolarHBondContact O-N 3.43Å; R14-V18 WeakPolarHBondContact O-CG2 3.29Å; R14-V18 PolarHBondContact O-N 3.49Å
15	Q	93.9	Very high	92.3	Very high	138 Å²	138	82.7 Å²	82.7	65%	0.645	42%	0.415	S	S	*	.	H	α-helix	trans	-62.5	-47.6	177.2	-171.5	177	8.7	0	0	111.3	E11 A12 T17 V18 T19	E11-Q15 PolarHBondContact O-N 3.28Å; A12-Q15 PolarHBondContact O-N 3.32Å; Q15-T17 VanDerWaalsContact C-N 3.34Å; Q15-T17 PolarHBondContact O-N 2.94Å; Q15-V18 PolarHBondContact O-N 3.39Å; Q15-T19 PolarHBondContact O-N 3.3Å; Q15-T19 PolarHBondContact O-OG1 3.42Å
16	K	93	Very high	92.9	Very high	120 Å²	120	83.2 Å²	83.2	52%	0.522	42%	0.416	S	S	.	.	H	α-helix	trans	-55.1	-47.1	173.2	-77.5	-177.5	169.7	-164.1	0	112.1	A12 H13 V18 T19 A20 S105	A12-K16 WeakPolarHBondContact O-CG 3.43Å; A12-K16 PolarHBondContact O-N 2.96Å; H13-K16 PolarHBondContact O-N 2.95Å; K16-V18 VanDerWaalsContact C-N 3.35Å; K16-V18 PolarHBondContact O-N 3.14Å; K16-T19 PolarHBondContact O-N 2.95Å; K16-A20 WeakPolarHBondContact O-CB 3.44Å; K16-A20 PolarHBondContact O-N 3.38Å; K16-S105 VanDerWaalsContact CD-OG 3.29Å; K16-S105 WeakPolarHBondContact CD-OG 3.49Å
17	T	93.7	Very high	93.4	Very high	40 Å²	40	82.9 Å²	82.9	25%	0.245	41%	0.414	C	S	.	.	H	α-helix	trans	-59.9	-41.5	178.1	-58.5	0	0	0	0	112.3	H13 R14 Q15 N21 L102	H13-T17 WeakPolarHBondContact O-CB 3.45Å; H13-T17 PolarHBondContact O-N 3.22Å; H13-T17 PolarHBondContact O-OG1 3.21Å; R14-T17 PolarHBondContact O-N 3.43Å; Q15-T17 VanDerWaalsContact C-N 3.34Å; Q15-T17 PolarHBondContact O-N 2.94Å; T17-N21 WeakPolarHBondContact O-CB 3.09Å; T17-N21 PolarHBondContact O-N 3.5Å; T17-N21 PolarHBondContact O-ND2 2.95Å; T17-N21 VanDerWaalsContact O-ND2 3.16Å; T17-L102 HydrophobicContact CG2-CD1 4.45Å
18	V	95	Very high	93.7	Very high	74 Å²	74	79.6 Å²	79.6	45%	0.448	40%	0.402	S	S	.	.	H	α-helix	trans	-64.8	-45.4	176	172.4	0	0	0	0	111.1	R14 Q15 K16 N21 Q22	R14-V18 WeakPolarHBondContact O-CG2 3.29Å; R14-V18 PolarHBondContact O-N 3.49Å; Q15-V18 PolarHBondContact O-N 3.39Å; K16-V18 VanDerWaalsContact C-N 3.35Å; K16-V18 PolarHBondContact O-N 3.14Å; V18-N21 PolarHBondContact O-N 2.99Å; V18-Q22 WeakPolarHBondContact O-CG 3.4Å; V18-Q22 PolarHBondContact O-N 3.44Å; V18-Q22 VanDerWaalsContact O-N 3.12Å
19	T	94.3	Very high	94	Very high	60 Å²	60	75.7 Å²	75.7	37%	0.368	39%	0.394	S	S	.	.	H	α-helix	trans	-64.2	-45	178.2	-56.7	0	0	0	0	112	Q15 K16 N21 Q22 Q23	Q15-T19 PolarHBondContact O-N 3.3Å; Q15-T19 PolarHBondContact O-OG1 3.42Å; K16-T19 PolarHBondContact O-N 2.95Å; T19-N21 PolarHBondContact O-N 2.92Å; T19-Q22 WeakPolarHBondContact O-CB 3.46Å; T19-Q22 PolarHBondContact O-N 2.92Å; T19-Q23 WeakPolarHBondContact O-CG 3.41Å; T19-Q23 PolarHBondContact O-N 3.38Å
20	A	94.2	Very high	94.4	Very high	6 Å²	6	78.8 Å²	78.8	5%	0.05	40%	0.404	C	S	.	.	H	α-helix	trans	-59.8	-43.9	176	0	0	0	0	0	111.5	K16 Q22 Q23 F24 V98 L102	K16-A20 WeakPolarHBondContact O-CB 3.44Å; K16-A20 PolarHBondContact O-N 3.38Å; A20-Q22 VanDerWaalsContact C-N 3.32Å; A20-Q22 PolarHBondContact O-N 2.96Å; A20-Q23 PolarHBondContact O-N 2.94Å; A20-F24 HydrophobicContact CB-CD2 4.47Å; A20-F24 HydrophobicContact CB-CE2 4.24Å; A20-F24 WeakPolarHBondContact O-CB 3.28Å; A20-F24 WeakPolarHBondContact O-CD2 3.47Å; A20-F24 WeakPolarHBondContact O-CG 3.29Å; A20-F24 PolarHBondContact O-N 2.97Å; A20-V98 HydrophobicContact CB-CG1 3.77Å; A20-L102 HydrophobicContact CB-CD1 4.39Å; A20-L102 HydrophobicContact CB-CD2 4.23Å
21	N	94.4	Very high	94.7	Very high	91 Å²	91	75.8 Å²	75.8	49%	0.487	39%	0.388	S	S	.	.	H	α-helix	trans	-61.4	-37.5	175.8	-74.6	-25.6	0	0	0	113.1	T17 V18 T19 S25	T17-N21 WeakPolarHBondContact O-CB 3.09Å; T17-N21 PolarHBondContact O-N 3.5Å; T17-N21 PolarHBondContact O-ND2 2.95Å; T17-N21 VanDerWaalsContact O-ND2 3.16Å; V18-N21 PolarHBondContact O-N 2.99Å; T19-N21 PolarHBondContact O-N 2.92Å; N21-S25 PolarHBondContact O-N 2.97Å; N21-S25 VanDerWaalsContact O-N 3.1Å
22	Q	96.2	Very high	94.9	Very high	117 Å²	117	75.5 Å²	75.5	55%	0.547	39%	0.387	S	S	.	.	H	α-helix	trans	-66.3	-45.9	173.5	-70	171.4	-12	0	0	111.5	V18 T19 A20 S25 I26	V18-Q22 WeakPolarHBondContact O-CG 3.4Å; V18-Q22 PolarHBondContact O-N 3.44Å; V18-Q22 VanDerWaalsContact O-N 3.12Å; T19-Q22 WeakPolarHBondContact O-CB 3.46Å; T19-Q22 PolarHBondContact O-N 2.92Å; A20-Q22 VanDerWaalsContact C-N 3.32Å; A20-Q22 PolarHBondContact O-N 2.96Å; Q22-S25 WeakPolarHBondContact O-CB 3.43Å; Q22-S25 PolarHBondContact O-N 3.13Å; Q22-I26 WeakPolarHBondContact O-CG1 3.34Å; Q22-I26 PolarHBondContact O-N 3.47Å; Q22-I26 VanDerWaalsContact O-N 3.11Å
23	Q	95.5	Very high	95.3	Very high	77 Å²	77	75.9 Å²	75.9	36%	0.36	39%	0.387	S	S	.	.	H	α-helix	trans	-60.9	-45.6	176.1	-71.9	169.8	-27.6	0	0	111.8	T19 A20 S25 I26 L27 V98	T19-Q23 WeakPolarHBondContact O-CG 3.41Å; T19-Q23 PolarHBondContact O-N 3.38Å; A20-Q23 PolarHBondContact O-N 2.94Å; Q23-S25 VanDerWaalsContact C-N 3.32Å; Q23-S25 PolarHBondContact O-N 3.35Å; Q23-I26 PolarHBondContact O-N 2.9Å; Q23-L27 WeakPolarHBondContact O-CB 3.2Å; Q23-L27 VanDerWaalsContact O-CG 3.26Å; Q23-L27 WeakPolarHBondContact O-CG 3.38Å; Q23-L27 PolarHBondContact O-N 3.42Å; Q23-V98 HydrophobicContact CB-CG1 4.24Å; Q23-V98 HydrophobicContact CB-CG2 4.32Å
24	F	96.2	Very high	95.5	Very high	35 Å²	35	75.3 Å²	75.3	15%	0.154	39%	0.385	C	S	.	.	H	α-helix	trans	-56.9	-43.9	174.4	-75.6	-51.1	0	0	0	112.2	A20 I26 L27 N28 R95 V98 N99 L102	A20-F24 HydrophobicContact CB-CD2 4.47Å; A20-F24 HydrophobicContact CB-CE2 4.24Å; A20-F24 WeakPolarHBondContact O-CB 3.28Å; A20-F24 WeakPolarHBondContact O-CD2 3.47Å; A20-F24 WeakPolarHBondContact O-CG 3.29Å; A20-F24 PolarHBondContact O-N 2.97Å; F24-I26 PolarHBondContact O-N 3.1Å; F24-L27 PolarHBondContact O-N 3.29Å; F24-N28 WeakPolarHBondContact O-CB 3.31Å; F24-N28 PolarHBondContact O-N 2.97Å; F24-N28 PolarHBondContact O-ND2 3.4Å; F24-N28 VanDerWaalsContact O-ND2 3.15Å; F24-N28 PolarHBondContact O-OD1 3.06Å; F24-R95 HydrophobicContact CD1-CG 3.83Å; F24-R95 HydrophobicContact CE1-CG 4.02Å; F24-R95 WeakPolarHBondContact CE1-O 3.36Å; F24-V98 HydrophobicContact CD1-CG1 4.28Å; F24-V98 HydrophobicContact CD2-CG1 4.4Å; F24-V98 HydrophobicContact CE1-CB 4.19Å; F24-V98 HydrophobicContact CE1-CG1 3.97Å; F24-V98 HydrophobicContact CE2-CG1 4.09Å; F24-V98 HydrophobicContact CG-CG1 4.49Å; F24-V98 HydrophobicContact CZ-CB 4.41Å; F24-V98 HydrophobicContact CZ-CG1 3.88Å; F24-N99 HydrophobicContact CE1-CB 4.04Å; F24-N99 HydrophobicContact CZ-CB 3.78Å; F24-L102 HydrophobicContact CE2-CD2 4.03Å
25	S	96	Very high	95.7	Very high	73 Å²	73	70 Å²	70	51%	0.51	37%	0.371	S	S	.	.	H	α-helix	trans	-58.8	-48	177	-168.9	0	0	0	0	111.4	N21 Q22 Q23 N28 S29	N21-S25 PolarHBondContact O-N 2.97Å; N21-S25 VanDerWaalsContact O-N 3.1Å; Q22-S25 WeakPolarHBondContact O-CB 3.43Å; Q22-S25 PolarHBondContact O-N 3.13Å; Q23-S25 VanDerWaalsContact C-N 3.32Å; Q23-S25 PolarHBondContact O-N 3.35Å; S25-N28 PolarHBondContact O-N 3.43Å; S25-S29 PolarHBondContact O-N 3.26Å; S25-S29 PolarHBondContact O-OG 2.93Å
26	I	96.7	Very high	95.8	Very high	100 Å²	100	68.5 Å²	68.5	51%	0.513	37%	0.366	S	S	.	.	H	α-helix	trans	-62	-49.7	178.4	-65.2	165.7	0	0	0	111.2	Q22 Q23 F24 N28 S29 Q30	Q22-I26 WeakPolarHBondContact O-CG1 3.34Å; Q22-I26 PolarHBondContact O-N 3.47Å; Q22-I26 VanDerWaalsContact O-N 3.11Å; Q23-I26 PolarHBondContact O-N 2.9Å; F24-I26 PolarHBondContact O-N 3.1Å; I26-N28 VanDerWaalsContact C-N 3.34Å; I26-N28 PolarHBondContact O-N 3.18Å; I26-S29 PolarHBondContact O-N 3.1Å; I26-Q30 WeakPolarHBondContact O-CG 3.49Å; I26-Q30 PolarHBondContact O-N 3.01Å
27	L	96.4	Very high	96	Very high	22 Å²	22	68.1 Å²	68.1	12%	0.115	36%	0.364	C	S	.	.	H	α-helix	trans	-63.8	-38.7	-179.1	-68.4	167.1	0	0	0	111.6	Q23 F24 Q30 I31 T91 A94 R95 V98	Q23-L27 WeakPolarHBondContact O-CB 3.2Å; Q23-L27 VanDerWaalsContact O-CG 3.26Å; Q23-L27 WeakPolarHBondContact O-CG 3.38Å; Q23-L27 PolarHBondContact O-N 3.42Å; F24-L27 PolarHBondContact O-N 3.29Å; L27-Q30 PolarHBondContact O-N 3.33Å; L27-I31 WeakPolarHBondContact O-CB 3.48Å; L27-I31 VanDerWaalsContact O-CG1 3.28Å; L27-I31 WeakPolarHBondContact O-CG1 3.36Å; L27-I31 PolarHBondContact O-N 2.97Å; L27-T91 HydrophobicContact CB-CG2 4.37Å; L27-T91 HydrophobicContact CD2-CG2 3.7Å; L27-A94 HydrophobicContact CD2-CB 4.2Å; L27-R95 HydrophobicContact CB-CB 4.47Å; L27-R95 HydrophobicContact CD1-CB 4.13Å; L27-V98 HydrophobicContact CD1-CG2 4.3Å
28	N	95.8	Very high	96.1	Very high	60 Å²	60	68.7 Å²	68.7	32%	0.321	36%	0.363	S	S	.	.	H	α-helix	trans	-62.8	-47.8	175.1	-70.6	-19.5	0	0	0	111.5	F24 S25 I26 Q30 I31 E32 R95	F24-N28 WeakPolarHBondContact O-CB 3.31Å; F24-N28 PolarHBondContact O-N 2.97Å; F24-N28 PolarHBondContact O-ND2 3.4Å; F24-N28 VanDerWaalsContact O-ND2 3.15Å; F24-N28 PolarHBondContact O-OD1 3.06Å; S25-N28 PolarHBondContact O-N 3.43Å; I26-N28 VanDerWaalsContact C-N 3.34Å; I26-N28 PolarHBondContact O-N 3.18Å; N28-Q30 VanDerWaalsContact C-N 3.29Å; N28-Q30 PolarHBondContact O-N 2.76Å; N28-I31 PolarHBondContact O-N 2.88Å; N28-E32 PolarHBondContact O-N 2.96Å; N28-R95 VanDerWaalsContact OD1-CZ 3.25Å; N28-R95 PolarHBondContact OD1-NE 3.43Å; N28-R95 PolarHBondContact OD1-NH2 2.85Å
29	S	97	Very high	96.1	Very high	69 Å²	69	73.6 Å²	73.6	48%	0.483	37%	0.374	S	S	.	.	H	α-helix	trans	-64.3	-32.8	176.5	-62.5	0	0	0	0	112.8	S25 I26 S33	S25-S29 PolarHBondContact O-N 3.26Å; S25-S29 PolarHBondContact O-OG 2.93Å; I26-S29 PolarHBondContact O-N 3.1Å; S29-S33 WeakPolarHBondContact O-CB 3.48Å; S29-S33 PolarHBondContact O-N 3.29Å
30	Q	96.8	Very high	96.2	Very high	93 Å²	93	78.9 Å²	78.9	44%	0.435	39%	0.387	S	S	.	.	H	α-helix	trans	-66.4	-47.6	172.6	-74.2	174.1	-6.7	0	0	111.7	I26 L27 N28 E32 S33 L34 T91	I26-Q30 WeakPolarHBondContact O-CG 3.49Å; I26-Q30 PolarHBondContact O-N 3.01Å; L27-Q30 PolarHBondContact O-N 3.33Å; N28-Q30 VanDerWaalsContact C-N 3.29Å; N28-Q30 PolarHBondContact O-N 2.76Å; Q30-E32 VanDerWaalsContact C-N 3.34Å; Q30-E32 PolarHBondContact O-N 3.24Å; Q30-S33 PolarHBondContact O-N 3.47Å; Q30-L34 WeakPolarHBondContact O-CB 3.35Å; Q30-L34 VanDerWaalsContact O-CG 3.32Å; Q30-L34 WeakPolarHBondContact O-CG 3.3Å; Q30-L34 PolarHBondContact O-N 2.87Å; Q30-T91 HydrophobicContact CB-CG2 4.03Å
31	I	96.6	Very high	96.3	Very high	20 Å²	20	79.3 Å²	79.3	10%	0.103	39%	0.389	C	S	.	.	H	α-helix	trans	-58.5	-45	175.5	-71.1	164.3	0	0	0	110.7	L27 N28 L34 N35 T91 Q92	L27-I31 WeakPolarHBondContact O-CB 3.48Å; L27-I31 VanDerWaalsContact O-CG1 3.28Å; L27-I31 WeakPolarHBondContact O-CG1 3.36Å; L27-I31 PolarHBondContact O-N 2.97Å; N28-I31 PolarHBondContact O-N 2.88Å; I31-L34 PolarHBondContact O-N 3.31Å; I31-N35 WeakPolarHBondContact CG2-ND2 3.34Å; I31-N35 WeakPolarHBondContact O-CB 3.35Å; I31-N35 VanDerWaalsContact O-CG 3.3Å; I31-N35 PolarHBondContact O-N 2.71Å; I31-N35 PolarHBondContact O-ND2 3.12Å; I31-N35 VanDerWaalsContact O-ND2 3.17Å; I31-T91 HydrophobicContact CD1-CG2 4.15Å; I31-T91 HydrophobicContact CG1-CG2 3.66Å; I31-Q92 HydrophobicContact CD1-CG 3.93Å; I31-Q92 HydrophobicContact CG1-CG 4.45Å
32	E	96.6	Very high	96.3	Very high	121 Å²	121	79.2 Å²	79.2	57%	0.565	39%	0.386	S	S	*	.	H	α-helix	trans	-61.5	-47.1	176.5	-173.8	177.4	-169.7	0	0	112	N28 Q30 L34 N35 I36	N28-E32 PolarHBondContact O-N 2.96Å; Q30-E32 VanDerWaalsContact C-N 3.34Å; Q30-E32 PolarHBondContact O-N 3.24Å; E32-L34 VanDerWaalsContact C-N 3.31Å; E32-L34 PolarHBondContact O-N 2.93Å; E32-N35 PolarHBondContact O-N 3.45Å; E32-I36 HydrophobicContact CG-CD1 4.22Å; E32-I36 WeakPolarHBondContact O-CG1 3.36Å; E32-I36 PolarHBondContact O-N 3.17Å
33	S	97.2	Very high	96.3	Very high	55 Å²	55	78.2 Å²	78.2	39%	0.385	38%	0.384	S	S	.	.	H	α-helix	trans	-59.9	-39.8	176.6	-170.5	0	0	0	0	112.5	S29 Q30 K37	S29-S33 WeakPolarHBondContact O-CB 3.48Å; S29-S33 PolarHBondContact O-N 3.29Å; Q30-S33 PolarHBondContact O-N 3.47Å; S33-K37 WeakPolarHBondContact O-CG 3.42Å; S33-K37 PolarHBondContact O-N 2.87Å; S33-K37 VanDerWaalsContact O-N 3.17Å
34	L	97.3	Very high	96.2	Very high	24 Å²	24	78.1 Å²	78.1	13%	0.126	39%	0.385	C	S	.	.	H	α-helix	trans	-69	-42.2	175.8	-70.1	169	0	0	0	111.9	Q30 I31 E32 I36 K37 F38 I84 I88	Q30-L34 WeakPolarHBondContact O-CB 3.35Å; Q30-L34 VanDerWaalsContact O-CG 3.32Å; Q30-L34 WeakPolarHBondContact O-CG 3.3Å; Q30-L34 PolarHBondContact O-N 2.87Å; I31-L34 PolarHBondContact O-N 3.31Å; E32-L34 VanDerWaalsContact C-N 3.31Å; E32-L34 PolarHBondContact O-N 2.93Å; L34-I36 VanDerWaalsContact C-N 3.31Å; L34-I36 PolarHBondContact O-N 2.68Å; L34-K37 WeakPolarHBondContact O-CB 3.34Å; L34-K37 PolarHBondContact O-N 3.23Å; L34-K37 VanDerWaalsContact O-N 3.12Å; L34-F38 WeakPolarHBondContact O-CB 3.45Å; L34-F38 PolarHBondContact O-N 2.9Å; L34-I84 HydrophobicContact CB-CG2 4.34Å; L34-I84 HydrophobicContact CD2-CG2 4.34Å; L34-I88 HydrophobicContact CB-CD1 4.03Å; L34-I88 HydrophobicContact CB-CG1 3.49Å; L34-I88 VanDerWaalsContact CB-CG1 3.49Å; L34-I88 HydrophobicContact CD1-CG1 4.01Å; L34-I88 HydrophobicContact CG-CG1 4.35Å
35	N	96.3	Very high	96.1	Very high	75 Å²	75	78.1 Å²	78.1	40%	0.401	39%	0.386	S	S	.	.	H	α-helix	trans	-59.9	-39.3	174.7	-78	-35.9	0	0	0	112.4	I31 E32 F38 R39	I31-N35 WeakPolarHBondContact CG2-ND2 3.34Å; I31-N35 WeakPolarHBondContact O-CB 3.35Å; I31-N35 VanDerWaalsContact O-CG 3.3Å; I31-N35 PolarHBondContact O-N 2.71Å; I31-N35 PolarHBondContact O-ND2 3.12Å; I31-N35 VanDerWaalsContact O-ND2 3.17Å; E32-N35 PolarHBondContact O-N 3.45Å; N35-F38 PolarHBondContact O-N 2.82Å; N35-R39 WeakPolarHBondContact O-CB 3.41Å; N35-R39 PolarHBondContact O-N 3.34Å
36	I	97	Very high	96	Very high	107 Å²	107	77.4 Å²	77.4	55%	0.549	38%	0.38	S	S	.	.	H	α-helix	trans	-63.1	-43.7	174	-68.1	165.3	0	0	0	110.8	E32 L34 R40	E32-I36 HydrophobicContact CG-CD1 4.22Å; E32-I36 WeakPolarHBondContact O-CG1 3.36Å; E32-I36 PolarHBondContact O-N 3.17Å; L34-I36 VanDerWaalsContact C-N 3.31Å; L34-I36 PolarHBondContact O-N 2.68Å; I36-R40 VanDerWaalsContact O-CB 3.3Å; I36-R40 WeakPolarHBondContact O-CB 3.29Å; I36-R40 PolarHBondContact O-N 3.37Å
37	K	95.8	Very high	95.9	Very high	111 Å²	111	78.8 Å²	78.8	48%	0.483	39%	0.385	S	S	.	.	H	α-helix	trans	-63.9	-42.7	175.6	-68	168.1	-171.7	172.3	0	111.8	S33 L34 R40 S41 I84	S33-K37 WeakPolarHBondContact O-CG 3.42Å; S33-K37 PolarHBondContact O-N 2.87Å; S33-K37 VanDerWaalsContact O-N 3.17Å; L34-K37 WeakPolarHBondContact O-CB 3.34Å; L34-K37 PolarHBondContact O-N 3.23Å; L34-K37 VanDerWaalsContact O-N 3.12Å; K37-R40 PolarHBondContact O-N 2.92Å; K37-S41 PolarHBondContact O-N 3.39Å; K37-I84 HydrophobicContact CB-CD1 3.97Å
38	F	96.3	Very high	95.7	Very high	52 Å²	52	78.6 Å²	78.6	23%	0.228	38%	0.384	C	S	.	.	H	α-helix	trans	-58.7	-54.3	175.9	-178	-90.1	0	0	0	111	L34 N35 R40 S41 Q42 R81 I84 I88	L34-F38 WeakPolarHBondContact O-CB 3.45Å; L34-F38 PolarHBondContact O-N 2.9Å; N35-F38 PolarHBondContact O-N 2.82Å; F38-R40 VanDerWaalsContact C-N 3.32Å; F38-R40 PolarHBondContact O-N 2.91Å; F38-S41 WeakPolarHBondContact O-CA 3.36Å; F38-S41 WeakPolarHBondContact O-CB 3.32Å; F38-S41 PolarHBondContact O-N 3.38Å; F38-S41 PolarHBondContact O-OG 2.98Å; F38-Q42 HydrophobicContact CD1-CG 4.43Å; F38-Q42 HydrophobicContact CE1-CG 4.14Å; F38-Q42 PolarHBondContact O-N 2.96Å; F38-Q42 VanDerWaalsContact O-N 3.1Å; F38-R81 HydrophobicContact CD2-CG 3.56Å; F38-R81 HydrophobicContact CE2-CG 3.42Å; F38-R81 VanDerWaalsContact CE2-CG 3.42Å; F38-R81 HydrophobicContact CZ-CG 4.33Å; F38-I84 HydrophobicContact CB-CG2 3.89Å; F38-I84 HydrophobicContact CD2-CG2 4.42Å; F38-I88 HydrophobicContact CB-CD1 4.41Å
39	R	96.4	Very high	95.4	Very high	178 Å²	178	79.9 Å²	79.9	67%	0.672	39%	0.394	S	S	*	.	H	α-helix	trans	-59.2	-42	177.7	-173.5	177.9	-179	-178.1	1	112	N35 S41 Q42 L43	N35-R39 WeakPolarHBondContact O-CB 3.41Å; N35-R39 PolarHBondContact O-N 3.34Å; R39-S41 VanDerWaalsContact C-N 3.3Å; R39-S41 PolarHBondContact O-N 2.63Å; R39-Q42 WeakPolarHBondContact O-CB 2.76Å; R39-Q42 PolarHBondContact O-N 3.4Å; R39-L43 WeakPolarHBondContact O-CG 3.46Å; R39-L43 PolarHBondContact O-N 3.01Å
40	R	96	Very high	95.2	Very high	171 Å²	171	81.4 Å²	81.4	65%	0.645	40%	0.4	S	S	*	.	H	α-helix	trans	-60.3	-39.3	174	-179.6	176.7	174.1	-176.2	-2	111.9	I36 K37 F38 Q42 L43 I44	I36-R40 VanDerWaalsContact O-CB 3.3Å; I36-R40 WeakPolarHBondContact O-CB 3.29Å; I36-R40 PolarHBondContact O-N 3.37Å; K37-R40 PolarHBondContact O-N 2.92Å; F38-R40 VanDerWaalsContact C-N 3.32Å; F38-R40 PolarHBondContact O-N 2.91Å; R40-Q42 VanDerWaalsContact C-N 3.31Å; R40-Q42 PolarHBondContact O-N 2.66Å; R40-L43 PolarHBondContact O-N 2.7Å; R40-I44 HydrophobicContact CG-CD1 3.8Å; R40-I44 HydrophobicContact CG-CG1 4.38Å; R40-I44 VanDerWaalsContact O-CG1 3.28Å; R40-I44 WeakPolarHBondContact O-CG1 3.48Å; R40-I44 PolarHBondContact O-N 2.95Å
41	S	95.4	Very high	95	Very high	14 Å²	14	80 Å²	80	10%	0.098	40%	0.396	C	S	.	.	H	α-helix	trans	-65.3	-33.5	176.3	82.8	0	0	0	0	112.7	K37 F38 R39 E45 I77 R81	K37-S41 PolarHBondContact O-N 3.39Å; F38-S41 WeakPolarHBondContact O-CA 3.36Å; F38-S41 WeakPolarHBondContact O-CB 3.32Å; F38-S41 PolarHBondContact O-N 3.38Å; F38-S41 PolarHBondContact O-OG 2.98Å; R39-S41 VanDerWaalsContact C-N 3.3Å; R39-S41 PolarHBondContact O-N 2.63Å; S41-E45 PolarHBondContact O-N 3.26Å; S41-E45 VanDerWaalsContact O-N 3.1Å; S41-I77 WeakPolarHBondContact O-CG2 3.45Å; S41-R81 VanDerWaalsContact C-NH2 3.34Å; S41-R81 PolarHBondContact O-NH2 3.04Å; S41-R81 PolarHBondContact OG-NE 3.34Å
42	Q	95.3	Very high	94.7	Very high	89 Å²	89	83 Å²	83	42%	0.416	42%	0.416	S	S	.	.	H	α-helix	trans	-68.7	-45.6	175	-66.2	177.4	-56.3	0	0	111.3	F38 R39 R40 E45 S46	F38-Q42 HydrophobicContact CD1-CG 4.43Å; F38-Q42 HydrophobicContact CE1-CG 4.14Å; F38-Q42 PolarHBondContact O-N 2.96Å; F38-Q42 VanDerWaalsContact O-N 3.1Å; R39-Q42 WeakPolarHBondContact O-CB 2.76Å; R39-Q42 PolarHBondContact O-N 3.4Å; R40-Q42 VanDerWaalsContact C-N 3.31Å; R40-Q42 PolarHBondContact O-N 2.66Å; Q42-E45 PolarHBondContact O-N 3.29Å; Q42-S46 PolarHBondContact O-N 2.89Å; Q42-S46 PolarHBondContact O-OG 2.88Å
43	L	95.9	Very high	94.1	Very high	96 Å²	96	80.3 Å²	80.3	50%	0.503	42%	0.421	S	S	.	.	H	α-helix	trans	-61.4	-44.8	176.5	-66.2	171.4	0	0	0	111.7	R39 R40 E45 S46 E47	R39-L43 WeakPolarHBondContact O-CG 3.46Å; R39-L43 PolarHBondContact O-N 3.01Å; R40-L43 PolarHBondContact O-N 2.7Å; L43-E45 VanDerWaalsContact C-N 3.32Å; L43-E45 PolarHBondContact O-N 3.03Å; L43-S46 WeakPolarHBondContact CA-OG 3.35Å; L43-S46 PolarHBondContact O-N 3.14Å; L43-S46 PolarHBondContact O-OG 3.48Å; L43-E47 WeakPolarHBondContact O-CB 3.49Å; L43-E47 VanDerWaalsContact O-CG 3.29Å; L43-E47 WeakPolarHBondContact O-CG 3.36Å; L43-E47 PolarHBondContact O-N 3.03Å
44	I	93.8	Very high	93.7	Very high	76 Å²	76	84.6 Å²	84.6	39%	0.39	44%	0.44	S	S	.	.	H	α-helix	trans	-65	-36.9	177.8	-62.9	166.9	0	0	0	111	R40 L48 I77	R40-I44 HydrophobicContact CG-CD1 3.8Å; R40-I44 HydrophobicContact CG-CG1 4.38Å; R40-I44 VanDerWaalsContact O-CG1 3.28Å; R40-I44 WeakPolarHBondContact O-CG1 3.48Å; R40-I44 PolarHBondContact O-N 2.95Å; I44-L48 WeakPolarHBondContact O-CB 3.45Å; I44-L48 PolarHBondContact O-N 2.96Å; I44-I77 HydrophobicContact CB-CD1 4.48Å; I44-I77 HydrophobicContact CG2-CD1 3.67Å
45	E	94.2	Very high	93.5	Very high	35 Å²	35	86.3 Å²	86.3	16%	0.164	45%	0.451	C	S	.	.	H	α-helix	trans	-62.9	-47.7	173.3	-179	-179.6	-161.9	0	0	111.7	S41 Q42 L43 E47 L48 V49 V74 I77 K78 R81	S41-E45 PolarHBondContact O-N 3.26Å; S41-E45 VanDerWaalsContact O-N 3.1Å; Q42-E45 PolarHBondContact O-N 3.29Å; L43-E45 VanDerWaalsContact C-N 3.32Å; L43-E45 PolarHBondContact O-N 3.03Å; E45-E47 PolarHBondContact O-N 2.91Å; E45-L48 PolarHBondContact O-N 2.87Å; E45-V49 HydrophobicContact CG-CG2 4.37Å; E45-V49 VanDerWaalsContact O-CG2 3.31Å; E45-V49 WeakPolarHBondContact O-CG2 3.41Å; E45-V49 PolarHBondContact O-N 3.32Å; E45-V74 HydrophobicContact CG-CG1 4.24Å; E45-I77 HydrophobicContact CB-CG2 4.23Å; E45-K78 WeakPolarHBondContact OE1-CE 3.42Å; E45-K78 IonicContact OE1-NZ 2.85Å; E45-K78 PolarHBondContact OE1-NZ 3.25Å; E45-R81 IonicContact OE2-CZ 3.99Å; E45-R81 IonicContact OE2-NH1 2.76Å; E45-R81 PolarHBondContact OE2-NH1 3.14Å; E45-R81 IonicContact OE2-NH2 2.99Å; E45-R81 PolarHBondContact OE2-NH2 3.45Å
46	S	94.2	Very high	93.4	Very high	57 Å²	57	85 Å²	85	40%	0.399	45%	0.451	S	S	.	.	H	α-helix	trans	-63.1	-44.4	-179.4	55.4	0	0	0	0	112.1	Q42 L43 L48 V49 T50	Q42-S46 PolarHBondContact O-N 2.89Å; Q42-S46 PolarHBondContact O-OG 2.88Å; L43-S46 WeakPolarHBondContact CA-OG 3.35Å; L43-S46 PolarHBondContact O-N 3.14Å; L43-S46 PolarHBondContact O-OG 3.48Å; S46-L48 VanDerWaalsContact C-N 3.3Å; S46-L48 PolarHBondContact O-N 3.45Å; S46-V49 PolarHBondContact O-N 3.45Å; S46-T50 WeakPolarHBondContact O-CG2 3.47Å; S46-T50 PolarHBondContact O-N 2.95Å; S46-T50 VanDerWaalsContact O-N 3.14Å; S46-T50 PolarHBondContact O-OG1 2.91Å
47	E	92.9	Very high	93.2	Very high	130 Å²	130	80.7 Å²	80.7	61%	0.607	43%	0.43	S	S	*	.	H	α-helix	trans	-65	-32.5	175.7	-66.3	-58.9	149.3	0	0	112.4	L43 E45 T50 L51	L43-E47 WeakPolarHBondContact O-CB 3.49Å; L43-E47 VanDerWaalsContact O-CG 3.29Å; L43-E47 WeakPolarHBondContact O-CG 3.36Å; L43-E47 PolarHBondContact O-N 3.03Å; E45-E47 PolarHBondContact O-N 2.91Å; E47-T50 PolarHBondContact O-OG1 3.25Å; E47-L51 WeakPolarHBondContact O-CG 3.33Å
48	L	92.1	Very high	93.2	Very high	17 Å²	17	81.7 Å²	81.7	9%	0.089	43%	0.431	C	S	.	.	H	α-helix	trans	-74.8	-32.5	178	-177.1	62.5	0	0	0	112	I44 E45 S46 L51 T57 R70 L73 V74 I77	I44-L48 WeakPolarHBondContact O-CB 3.45Å; I44-L48 PolarHBondContact O-N 2.96Å; E45-L48 PolarHBondContact O-N 2.87Å; S46-L48 VanDerWaalsContact C-N 3.3Å; S46-L48 PolarHBondContact O-N 3.45Å; L48-L51 HydrophobicContact CD1-CD1 4.23Å; L48-T57 HydrophobicContact CD1-CG2 3.92Å; L48-R70 HydrophobicContact CD1-CG 3.82Å; L48-R70 HydrophobicContact CG-CG 3.89Å; L48-R70 VanDerWaalsContact O-CD 3.29Å; L48-R70 WeakPolarHBondContact O-CD 3.5Å; L48-L73 HydrophobicContact CD1-CD1 4.5Å; L48-L73 HydrophobicContact CD2-CB 3.54Å; L48-V74 HydrophobicContact CD2-CG2 3.58Å; L48-V74 HydrophobicContact CG-CG2 3.99Å; L48-I77 HydrophobicContact CD2-CD1 3.82Å
49	V	91.3	Very high	93	Very high	87 Å²	87	82.7 Å²	82.7	53%	0.527	44%	0.435	S	S	.	.	H	α-helix	trans	-75.3	-29.7	177.7	170	0	0	0	0	112.2	E45 S46 L51 V74	E45-V49 HydrophobicContact CG-CG2 4.37Å; E45-V49 VanDerWaalsContact O-CG2 3.31Å; E45-V49 WeakPolarHBondContact O-CG2 3.41Å; E45-V49 PolarHBondContact O-N 3.32Å; S46-V49 PolarHBondContact O-N 3.45Å; V49-L51 VanDerWaalsContact C-N 3.3Å; V49-L51 PolarHBondContact O-N 3.27Å; V49-V74 HydrophobicContact CG2-CG2 4.11Å
50	T	92.5	Very high	92.8	Very high	102 Å²	102	77.5 Å²	77.5	63%	0.626	43%	0.431	S	S	*	.	H	α-helix	trans	-73.6	-17.3	174.7	53.3	0	0	0	0	113.7	S46 E47	S46-T50 WeakPolarHBondContact O-CG2 3.47Å; S46-T50 PolarHBondContact O-N 2.95Å; S46-T50 VanDerWaalsContact O-N 3.14Å; S46-T50 PolarHBondContact O-OG1 2.91Å; E47-T50 PolarHBondContact O-OG1 3.25Å
51	L	91.2	Very high	92.6	Very high	64 Å²	64	72.8 Å²	72.8	34%	0.335	42%	0.423	S	S	.	.	S	Bend	trans	-67	135.5	175.6	-66.4	-177.3	0	0	0	112	E47 L48 V49 V55 T57 R70	E47-L51 WeakPolarHBondContact O-CG 3.33Å; L48-L51 HydrophobicContact CD1-CD1 4.23Å; V49-L51 VanDerWaalsContact C-N 3.3Å; V49-L51 PolarHBondContact O-N 3.27Å; L51-V55 HydrophobicContact CD1-CG1 4.25Å; L51-T57 HydrophobicContact CD1-CG2 3.97Å; L51-R70 PolarHBondContact O-NH1 3.45Å
52	P	90.3	Very high	92.6	Very high	81 Å²	81	76.3 Å²	76.3	53%	0.526	46%	0.461	S	S	.	.			trans	-53.3	149.1	169.1	-27.6	36.2	0	0	0	113.3	D54 V55	P52-D54 VanDerWaalsContact C-N 3.26Å; P52-D54 WeakPolarHBondContact CB-OD1 3.29Å; P52-D54 PolarHBondContact O-N 3.28Å; P52-V55 HydrophobicContact CB-CG2 4.09Å; P52-V55 HydrophobicContact CG-CG2 4.4Å; P52-V55 WeakPolarHBondContact O-CB 3.31Å; P52-V55 WeakPolarHBondContact O-CG2 3.46Å; P52-V55 PolarHBondContact O-N 3.34Å
53	G	85.4	Confident	92.6	Very high	66 Å²	66	84 Å²	84	68%	0.68	49%	0.487	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.4	-15.7	-171	0	0	0	0	0	115.5
54	D	88.7	Confident	92.6	Very high	144 Å²	144	86 Å²	86	77%	0.77	50%	0.495	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.1	-12.7	175.8	63	-32.1	0	0	0	113.4	P52 A56	P52-D54 VanDerWaalsContact C-N 3.26Å; P52-D54 WeakPolarHBondContact CB-OD1 3.29Å; P52-D54 PolarHBondContact O-N 3.28Å; D54-A56 PolarHBondContact O-N 3.4Å
55	V	93.1	Very high	92.8	Very high	60 Å²	60	89.7 Å²	89.7	36%	0.364	51%	0.509	S	S	.	.			trans	-67.1	118.2	-178.9	179.7	0	0	0	0	111	L51 P52 T57	L51-V55 HydrophobicContact CD1-CG1 4.25Å; P52-V55 HydrophobicContact CB-CG2 4.09Å; P52-V55 HydrophobicContact CG-CG2 4.4Å; P52-V55 WeakPolarHBondContact O-CB 3.31Å; P52-V55 WeakPolarHBondContact O-CG2 3.46Å; P52-V55 PolarHBondContact O-N 3.34Å; V55-T57 HydrophobicContact CG1-CG2 4.35Å; V55-T57 PolarHBondContact O-N 3.06Å
56	A	93.1	Very high	92.8	Very high	49 Å²	49	92 Å²	92	41%	0.405	52%	0.521	S	S	.	.			trans	-66.9	114.5	173.4	0	0	0	0	0	110.7	D54 Y58	D54-A56 PolarHBondContact O-N 3.4Å; A56-Y58 HydrophobicContact CB-CE2 3.94Å; A56-Y58 WeakPolarHBondContact O-CE2 3.41Å
57	T	94.2	Very high	92.9	Very high	16 Å²	16	96.1 Å²	96.1	10%	0.098	53%	0.532	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.9	152	-178.6	46.4	0	0	0	0	111.9	L48 L51 V55 K67 K68 R70 L73	L48-T57 HydrophobicContact CD1-CG2 3.92Å; L51-T57 HydrophobicContact CD1-CG2 3.97Å; V55-T57 HydrophobicContact CG1-CG2 4.35Å; V55-T57 PolarHBondContact O-N 3.06Å; T57-K67 WeakPolarHBondContact O-CA 3.49Å; T57-K68 PolarHBondContact O-N 3.49Å; T57-K68 VanDerWaalsContact O-O 3.06Å; T57-K68 PolarHBondContact OG1-O 3.03Å; T57-K68 VanDerWaalsContact OG1-O 3.05Å; T57-R70 PolarHBondContact OG1-N 3.43Å; T57-L73 WeakPolarHBondContact OG1-CD1 3.41Å
58	Y	94.5	Very high	92.9	Very high	132 Å²	132	92.6 Å²	92.6	52%	0.518	52%	0.515	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.3	135.9	-169.7	-62.2	-97.5	0	0	0	111.5	A56 F65 I66 K67	A56-Y58 HydrophobicContact CB-CE2 3.94Å; A56-Y58 WeakPolarHBondContact O-CE2 3.41Å; Y58-F65 HydrophobicContact CD1-CB 4.36Å; Y58-I66 CarbonylContact C-O 3.55Å; Y58-I66 WeakPolarHBondContact CA-O 3.32Å; Y58-K67 HydrophobicContact CD1-CB 3.84Å; Y58-K67 HydrophobicContact CD1-CG 4.41Å; Y58-K67 HydrophobicContact CE1-CB 3.63Å; Y58-K67 HydrophobicContact CE1-CD 4.49Å; Y58-K67 HydrophobicContact CE1-CG 4.02Å
59	K	92.4	Very high	92.9	Very high	72 Å²	72	95.6 Å²	95.6	31%	0.313	54%	0.535	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.5	129.4	170.2	-157.9	170.2	-173.5	173.1	0	109.8	F65 I66 K68 L73 D76 D80	K59-F65 WeakPolarHBondContact O-CA 3.33Å; K59-I66 PolarHBondContact N-O 3.17Å; K59-I66 PolarHBondContact O-N 2.91Å; K59-K68 HydrophobicContact CB-CD 4.41Å; K59-K68 HydrophobicContact CD-CD 4.47Å; K59-L73 HydrophobicContact CB-CD2 3.82Å; K59-L73 HydrophobicContact CD-CD2 4.21Å; K59-L73 HydrophobicContact CG-CD2 4.14Å; K59-D76 WeakPolarHBondContact CD-OD2 3.47Å; K59-D76 IonicContact NZ-OD2 2.71Å; K59-D76 PolarHBondContact NZ-OD2 2.94Å; K59-D80 IonicContact NZ-OD2 2.72Å
60	A	93.3	Very high	92.9	Very high	69 Å²	69	95 Å²	95	57%	0.57	52%	0.523	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-67.1	132.5	167.4	0	0	0	0	0	110.1	F65	A60-F65 HydrophobicContact CB-CD1 4.13Å; A60-F65 HydrophobicContact CB-CE1 3.86Å
61	C	91.6	Very high	92.9	Very high	73 Å²	73	96.3 Å²	96.3	49%	0.493	52%	0.522	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138	100.4	177.6	-170.3	0	0	0	0	108.9	R63 M64 I66	C61-R63 PolarHBondContact O-N 2.86Å; C61-M64 PolarHBondContact N-O 3.11Å; C61-M64 PolarHBondContact O-N 3.49Å; C61-I66 HydrophobicContact CB-CD1 3.78Å; C61-I66 HydrophobicContact CB-CG1 4.19Å
62	G	94.3	Very high	92.9	Very high	87 Å²	87	95.6 Å²	95.6	90%	0.897	52%	0.521	S	S	*	.	T	Hydrogen-bonded Turn	trans	58.8	-110.1	-173.5	0	0	0	0	0	111.8
63	R	95.8	Very high	93.1	Very high	252 Å²	252	92.5 Å²	92.5	95%	0.951	50%	0.5	S	S	*	.	T	Hydrogen-bonded Turn	trans	-103.2	12.4	178.3	-59.6	-173.9	-64.2	176.9	0.7	113.7	C61	C61-R63 PolarHBondContact O-N 2.86Å
64	M	96.9	Very high	93.5	Very high	138 Å²	138	90.2 Å²	90.2	68%	0.68	47%	0.473	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-128.8	166.7	-175.3	-65.3	-178.6	71.7	0	0	111.8	C61	C61-M64 PolarHBondContact N-O 3.11Å; C61-M64 PolarHBondContact O-N 3.49Å
65	F	96.3	Very high	93.7	Very high	153 Å²	153	88.1 Å²	88.1	67%	0.671	46%	0.458	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-120.8	128.1	173.4	-66.9	-83.7	0	0	0	109.7	Y58 K59 A60	Y58-F65 HydrophobicContact CD1-CB 4.36Å; K59-F65 WeakPolarHBondContact O-CA 3.33Å; A60-F65 HydrophobicContact CB-CD1 4.13Å; A60-F65 HydrophobicContact CB-CE1 3.86Å
66	I	95.2	Very high	93.8	Very high	84 Å²	84	86.5 Å²	86.5	43%	0.431	45%	0.448	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.3	119.5	179.6	-58.5	176.3	0	0	0	107.9	Y58 K59 C61 K68	Y58-I66 CarbonylContact C-O 3.55Å; Y58-I66 WeakPolarHBondContact CA-O 3.32Å; K59-I66 PolarHBondContact N-O 3.17Å; K59-I66 PolarHBondContact O-N 2.91Å; C61-I66 HydrophobicContact CB-CD1 3.78Å; C61-I66 HydrophobicContact CB-CG1 4.19Å; I66-K68 PolarHBondContact O-N 3.21Å
67	K	95.3	Very high	93.9	Very high	142 Å²	142	85.5 Å²	85.5	62%	0.617	44%	0.435	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-60.5	126.4	173.1	-170.5	177.9	178	179.7	0	108.8	T57 Y58	T57-K67 WeakPolarHBondContact O-CA 3.49Å; Y58-K67 HydrophobicContact CD1-CB 3.84Å; Y58-K67 HydrophobicContact CD1-CG 4.41Å; Y58-K67 HydrophobicContact CE1-CB 3.63Å; Y58-K67 HydrophobicContact CE1-CD 4.49Å; Y58-K67 HydrophobicContact CE1-CG 4.02Å
68	K	92.8	Very high	93.9	Very high	56 Å²	56	89.3 Å²	89.3	24%	0.243	45%	0.45	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.2	151.6	174.8	-81.8	-162	168.5	-159	0	109.3	T57 K59 I66 T72 L73 D76	T57-K68 PolarHBondContact O-N 3.49Å; T57-K68 VanDerWaalsContact O-O 3.06Å; T57-K68 PolarHBondContact OG1-O 3.03Å; T57-K68 VanDerWaalsContact OG1-O 3.05Å; K59-K68 HydrophobicContact CB-CD 4.41Å; K59-K68 HydrophobicContact CD-CD 4.47Å; I66-K68 PolarHBondContact O-N 3.21Å; K68-T72 HydrophobicContact CD-CG2 4.25Å; K68-L73 HydrophobicContact CB-CD1 4.21Å; K68-L73 HydrophobicContact CB-CD2 3.94Å; K68-L73 HydrophobicContact CB-CG 3.79Å; K68-L73 HydrophobicContact CD-CD2 3.86Å; K68-L73 HydrophobicContact CD-CG 4.4Å; K68-L73 HydrophobicContact CG-CD2 4.41Å; K68-D76 IonicContact NZ-OD1 2.7Å; K68-D76 PolarHBondContact NZ-OD1 3.45Å; K68-D76 IonicContact NZ-OD2 2.68Å; K68-D76 PolarHBondContact NZ-OD2 3.27Å
69	P	92.4	Very high	94	Very high	80 Å²	80	88 Å²	88	52%	0.519	45%	0.447	S	S	.	.			trans	-60.6	146.1	166	-20.5	32.9	0	0	0	111.1	E71 T72 L73	P69-E71 PolarHBondContact O-N 2.74Å; P69-T72 PolarHBondContact O-N 3.41Å; P69-L73 PolarHBondContact O-N 2.86Å; P69-L73 VanDerWaalsContact O-N 3.09Å
70	R	91.9	Very high	94	Very high	75 Å²	75	87.8 Å²	87.8	28%	0.283	45%	0.449	S	S	.	.	H	α-helix	trans	-52.4	-43.8	176.4	-176.7	-172	66	171.1	1.2	111.8	L48 L51 T57 L73 V74	L48-R70 HydrophobicContact CD1-CG 3.82Å; L48-R70 HydrophobicContact CG-CG 3.89Å; L48-R70 VanDerWaalsContact O-CD 3.29Å; L48-R70 WeakPolarHBondContact O-CD 3.5Å; L51-R70 PolarHBondContact O-NH1 3.45Å; T57-R70 PolarHBondContact OG1-N 3.43Å; R70-L73 WeakPolarHBondContact O-CB 3.46Å; R70-L73 PolarHBondContact O-N 3.32Å; R70-V74 WeakPolarHBondContact O-CG2 3.28Å; R70-V74 PolarHBondContact O-N 2.95Å
71	E	91.7	Very high	94.1	Very high	129 Å²	129	86 Å²	86	60%	0.603	43%	0.428	S	S	*	.	H	α-helix	trans	-64.1	-45.7	-179.3	-69.4	162.3	-167.1	0	0	112	P69 L73 V74 E75	P69-E71 PolarHBondContact O-N 2.74Å; E71-L73 PolarHBondContact O-N 2.92Å; E71-V74 PolarHBondContact O-N 3.39Å; E71-V74 VanDerWaalsContact O-N 3.13Å; E71-E75 PolarHBondContact O-N 2.85Å
72	T	92.7	Very high	94.3	Very high	50 Å²	50	86.9 Å²	86.9	31%	0.307	43%	0.428	S	S	.	.	H	α-helix	trans	-61.6	-32.6	174.6	-45.5	0	0	0	0	112.3	K68 P69 D76	K68-T72 HydrophobicContact CD-CG2 4.25Å; P69-T72 PolarHBondContact O-N 3.41Å; T72-D76 WeakPolarHBondContact O-CB 3.49Å; T72-D76 PolarHBondContact O-N 3.41Å
73	L	93.2	Very high	94.4	Very high	16 Å²	16	88.3 Å²	88.3	8%	0.084	41%	0.409	C	S	.	.	H	α-helix	trans	-71	-40.8	174	-71.7	171.4	0	0	0	112.1	L48 T57 K59 K68 P69 R70 E71 E75 D76 I77	L48-L73 HydrophobicContact CD1-CD1 4.5Å; L48-L73 HydrophobicContact CD2-CB 3.54Å; T57-L73 WeakPolarHBondContact OG1-CD1 3.41Å; K59-L73 HydrophobicContact CB-CD2 3.82Å; K59-L73 HydrophobicContact CD-CD2 4.21Å; K59-L73 HydrophobicContact CG-CD2 4.14Å; K68-L73 HydrophobicContact CB-CD1 4.21Å; K68-L73 HydrophobicContact CB-CD2 3.94Å; K68-L73 HydrophobicContact CB-CG 3.79Å; K68-L73 HydrophobicContact CD-CD2 3.86Å; K68-L73 HydrophobicContact CD-CG 4.4Å; K68-L73 HydrophobicContact CG-CD2 4.41Å; P69-L73 PolarHBondContact O-N 2.86Å; P69-L73 VanDerWaalsContact O-N 3.09Å; R70-L73 WeakPolarHBondContact O-CB 3.46Å; R70-L73 PolarHBondContact O-N 3.32Å; E71-L73 PolarHBondContact O-N 2.92Å; L73-E75 VanDerWaalsContact C-N 3.35Å; L73-D76 PolarHBondContact O-N 3.12Å; L73-I77 WeakPolarHBondContact O-CB 3.2Å; L73-I77 WeakPolarHBondContact O-CD1 3.41Å; L73-I77 WeakPolarHBondContact O-CG1 3.46Å; L73-I77 PolarHBondContact O-N 3.38Å
74	V	93.6	Very high	94.5	Very high	18 Å²	18	77.7 Å²	77.7	11%	0.109	37%	0.371	C	S	.	.	H	α-helix	trans	-60.9	-44	172.8	171.1	0	0	0	0	110.7	E45 L48 V49 R70 E71 I77 K78	E45-V74 HydrophobicContact CG-CG1 4.24Å; L48-V74 HydrophobicContact CD2-CG2 3.58Å; L48-V74 HydrophobicContact CG-CG2 3.99Å; V49-V74 HydrophobicContact CG2-CG2 4.11Å; R70-V74 WeakPolarHBondContact O-CG2 3.28Å; R70-V74 PolarHBondContact O-N 2.95Å; E71-V74 PolarHBondContact O-N 3.39Å; E71-V74 VanDerWaalsContact O-N 3.13Å; V74-I77 PolarHBondContact O-N 3.18Å; V74-K78 HydrophobicContact CG1-CD 4.35Å; V74-K78 WeakPolarHBondContact O-CG 3.34Å; V74-K78 PolarHBondContact O-N 3.21Å
75	E	94.4	Very high	94.4	Very high	99 Å²	99	73.4 Å²	73.4	46%	0.463	35%	0.353	S	S	.	.	H	α-helix	trans	-62.8	-44.7	174.9	-75.7	-172.6	-156.3	0	0	113.5	E71 L73 I77 K78 K79	E71-E75 PolarHBondContact O-N 2.85Å; L73-E75 VanDerWaalsContact C-N 3.35Å; E75-I77 VanDerWaalsContact C-N 3.28Å; E75-I77 PolarHBondContact O-N 3.1Å; E75-K78 PolarHBondContact O-N 3.45Å; E75-K79 WeakPolarHBondContact O-CG 3.49Å; E75-K79 PolarHBondContact O-N 2.77Å; E75-K79 IonicContact OE2-NZ 3.45Å; E75-K79 PolarHBondContact OE2-NZ 3.07Å
76	D	93.9	Very high	94.5	Very high	27 Å²	27	70.6 Å²	70.6	14%	0.144	35%	0.345	C	S	.	.	H	α-helix	trans	-55.7	-46	173.9	-87.4	9.8	0	0	0	110.1	K59 K68 T72 L73 K79 D80	K59-D76 WeakPolarHBondContact CD-OD2 3.47Å; K59-D76 IonicContact NZ-OD2 2.71Å; K59-D76 PolarHBondContact NZ-OD2 2.94Å; K68-D76 IonicContact NZ-OD1 2.7Å; K68-D76 PolarHBondContact NZ-OD1 3.45Å; K68-D76 IonicContact NZ-OD2 2.68Å; K68-D76 PolarHBondContact NZ-OD2 3.27Å; T72-D76 WeakPolarHBondContact O-CB 3.49Å; T72-D76 PolarHBondContact O-N 3.41Å; L73-D76 PolarHBondContact O-N 3.12Å; D76-K79 PolarHBondContact O-N 2.79Å; D76-D80 WeakPolarHBondContact O-CB 3.27Å; D76-D80 PolarHBondContact O-N 3.21Å
77	I	94.8	Very high	94.5	Very high	28 Å²	28	69 Å²	69	14%	0.144	34%	0.341	C	S	.	.	H	α-helix	trans	-63.9	-40.4	179.6	-70	160.4	0	0	0	111.5	S41 I44 E45 L48 L73 V74 E75 D80 R81	S41-I77 WeakPolarHBondContact O-CG2 3.45Å; I44-I77 HydrophobicContact CB-CD1 4.48Å; I44-I77 HydrophobicContact CG2-CD1 3.67Å; E45-I77 HydrophobicContact CB-CG2 4.23Å; L48-I77 HydrophobicContact CD2-CD1 3.82Å; L73-I77 WeakPolarHBondContact O-CB 3.2Å; L73-I77 WeakPolarHBondContact O-CD1 3.41Å; L73-I77 WeakPolarHBondContact O-CG1 3.46Å; L73-I77 PolarHBondContact O-N 3.38Å; V74-I77 PolarHBondContact O-N 3.18Å; E75-I77 VanDerWaalsContact C-N 3.28Å; E75-I77 PolarHBondContact O-N 3.1Å; I77-D80 PolarHBondContact O-N 2.87Å; I77-R81 VanDerWaalsContact O-CB 3.32Å; I77-R81 WeakPolarHBondContact O-CB 3.32Å; I77-R81 PolarHBondContact O-N 3.16Å
78	K	95	Very high	94.6	Very high	95 Å²	95	63 Å²	63	41%	0.413	32%	0.316	S	S	.	.	H	α-helix	trans	-63	-51.7	174.9	-72.7	176.6	-177.2	-179.6	0	111.3	E45 V74 E75 D80 R81 D82	E45-K78 WeakPolarHBondContact OE1-CE 3.42Å; E45-K78 IonicContact OE1-NZ 2.85Å; E45-K78 PolarHBondContact OE1-NZ 3.25Å; V74-K78 HydrophobicContact CG1-CD 4.35Å; V74-K78 WeakPolarHBondContact O-CG 3.34Å; V74-K78 PolarHBondContact O-N 3.21Å; E75-K78 PolarHBondContact O-N 3.45Å; K78-D80 PolarHBondContact O-N 3.31Å; K78-R81 CarbonylContact O-C 3.59Å; K78-R81 WeakPolarHBondContact O-CA 3.42Å; K78-R81 WeakPolarHBondContact O-CB 3.26Å; K78-R81 PolarHBondContact O-N 3.15Å; K78-D82 PolarHBondContact O-N 3.45Å
79	K	95.6	Very high	94.8	Very high	105 Å²	105	64.4 Å²	64.4	46%	0.457	32%	0.323	S	S	.	.	H	α-helix	trans	-58.5	-35.2	177.4	-69.7	162.8	-175.5	156.3	0	112.7	E75 D76 K83	E75-K79 WeakPolarHBondContact O-CG 3.49Å; E75-K79 PolarHBondContact O-N 2.77Å; E75-K79 IonicContact OE2-NZ 3.45Å; E75-K79 PolarHBondContact OE2-NZ 3.07Å; D76-K79 PolarHBondContact O-N 2.79Å; K79-K83 WeakPolarHBondContact O-CE 3.42Å; K79-K83 WeakPolarHBondContact O-CG 3.48Å
80	D	94	Very high	95	Very high	67 Å²	67	65 Å²	65	36%	0.358	33%	0.325	S	S	.	.	H	α-helix	trans	-78	-28.7	175.4	-71.4	-22.4	0	0	0	112.3	K59 D76 I77 K78 K83 I84	K59-D80 IonicContact NZ-OD2 2.72Å; D76-D80 WeakPolarHBondContact O-CB 3.27Å; D76-D80 PolarHBondContact O-N 3.21Å; I77-D80 PolarHBondContact O-N 2.87Å; K78-D80 PolarHBondContact O-N 3.31Å; D80-K83 IonicContact OD1-NZ 3.33Å; D80-K83 PolarHBondContact OD1-NZ 2.9Å; D80-I84 WeakPolarHBondContact O-CD1 3.44Å; D80-I84 VanDerWaalsContact O-CG1 3.29Å; D80-I84 WeakPolarHBondContact O-CG1 3.46Å; D80-I84 PolarHBondContact O-N 2.85Å
81	R	95.4	Very high	95.1	Very high	33 Å²	33	62.2 Å²	62.2	13%	0.125	32%	0.317	C	S	.	.	H	α-helix	trans	-68.8	-43.6	171.6	-174.8	-175.1	-58.5	149.1	8.9	112.1	F38 S41 E45 I77 K78 K83 I84 T85	F38-R81 HydrophobicContact CD2-CG 3.56Å; F38-R81 HydrophobicContact CE2-CG 3.42Å; F38-R81 VanDerWaalsContact CE2-CG 3.42Å; F38-R81 HydrophobicContact CZ-CG 4.33Å; S41-R81 VanDerWaalsContact C-NH2 3.34Å; S41-R81 PolarHBondContact O-NH2 3.04Å; S41-R81 PolarHBondContact OG-NE 3.34Å; E45-R81 IonicContact OE2-CZ 3.99Å; E45-R81 IonicContact OE2-NH1 2.76Å; E45-R81 PolarHBondContact OE2-NH1 3.14Å; E45-R81 IonicContact OE2-NH2 2.99Å; E45-R81 PolarHBondContact OE2-NH2 3.45Å; I77-R81 VanDerWaalsContact O-CB 3.32Å; I77-R81 WeakPolarHBondContact O-CB 3.32Å; I77-R81 PolarHBondContact O-N 3.16Å; K78-R81 CarbonylContact O-C 3.59Å; K78-R81 WeakPolarHBondContact O-CA 3.42Å; K78-R81 WeakPolarHBondContact O-CB 3.26Å; K78-R81 PolarHBondContact O-N 3.15Å; R81-K83 VanDerWaalsContact C-N 3.32Å; R81-K83 PolarHBondContact O-N 3.26Å; R81-I84 CarbonylContact O-C 3.59Å; R81-I84 WeakPolarHBondContact O-CA 3.47Å; R81-I84 WeakPolarHBondContact O-CB 3.09Å; R81-I84 PolarHBondContact O-N 3.46Å; R81-T85 PolarHBondContact O-N 2.94Å; R81-T85 PolarHBondContact O-OG1 2.9Å
82	D	96.2	Very high	95.3	Very high	90 Å²	90	60 Å²	60	48%	0.481	31%	0.306	S	S	.	.	H	α-helix	trans	-57.6	-47	179.8	-59.3	-28.3	0	0	0	110.3	K78 I84 T85 D86	K78-D82 PolarHBondContact O-N 3.45Å; D82-I84 VanDerWaalsContact C-N 3.27Å; D82-I84 PolarHBondContact O-N 3.03Å; D82-T85 WeakPolarHBondContact O-CA 3.4Å; D82-T85 VanDerWaalsContact O-CB 3.31Å; D82-T85 WeakPolarHBondContact O-CB 3.25Å; D82-T85 PolarHBondContact O-N 3.36Å; D82-D86 PolarHBondContact O-N 2.82Å
83	K	96.2	Very high	95.5	Very high	117 Å²	117	63.2 Å²	63.2	51%	0.509	32%	0.316	S	S	.	.	H	α-helix	trans	-58.2	-34.8	172.5	-62.3	167	-160.4	160.6	0	113.7	K79 D80 R81 S87	K79-K83 WeakPolarHBondContact O-CE 3.42Å; K79-K83 WeakPolarHBondContact O-CG 3.48Å; D80-K83 IonicContact OD1-NZ 3.33Å; D80-K83 PolarHBondContact OD1-NZ 2.9Å; R81-K83 VanDerWaalsContact C-N 3.32Å; R81-K83 PolarHBondContact O-N 3.26Å; K83-S87 WeakPolarHBondContact O-CB 3.38Å; K83-S87 PolarHBondContact O-N 3.24Å; K83-S87 PolarHBondContact O-OG 3.16Å
84	I	96.2	Very high	95.6	Very high	29 Å²	29	64.5 Å²	64.5	15%	0.149	33%	0.329	C	S	.	.	H	α-helix	trans	-69.2	-41.8	175.7	-68.6	161.7	0	0	0	109.7	L34 K37 F38 D80 R81 D82 S87 I88	L34-I84 HydrophobicContact CB-CG2 4.34Å; L34-I84 HydrophobicContact CD2-CG2 4.34Å; K37-I84 HydrophobicContact CB-CD1 3.97Å; F38-I84 HydrophobicContact CB-CG2 3.89Å; F38-I84 HydrophobicContact CD2-CG2 4.42Å; D80-I84 WeakPolarHBondContact O-CD1 3.44Å; D80-I84 VanDerWaalsContact O-CG1 3.29Å; D80-I84 WeakPolarHBondContact O-CG1 3.46Å; D80-I84 PolarHBondContact O-N 2.85Å; R81-I84 CarbonylContact O-C 3.59Å; R81-I84 WeakPolarHBondContact O-CA 3.47Å; R81-I84 WeakPolarHBondContact O-CB 3.09Å; R81-I84 PolarHBondContact O-N 3.46Å; D82-I84 VanDerWaalsContact C-N 3.27Å; D82-I84 PolarHBondContact O-N 3.03Å; I84-S87 WeakPolarHBondContact O-CB 3.32Å; I84-S87 PolarHBondContact O-N 3.01Å; I84-I88 HydrophobicContact CG2-CD1 3.91Å; I84-I88 HydrophobicContact CG2-CG1 4.46Å; I84-I88 VanDerWaalsContact O-CG1 3.29Å; I84-I88 WeakPolarHBondContact O-CG1 3.36Å; I84-I88 PolarHBondContact O-N 3.01Å
85	T	96	Very high	95.7	Very high	48 Å²	48	68.3 Å²	68.3	29%	0.294	34%	0.341	S	S	.	.	H	α-helix	trans	-59.6	-51	174.1	-49.1	0	0	0	0	111.1	R81 D82 S87 I88 E89	R81-T85 PolarHBondContact O-N 2.94Å; R81-T85 PolarHBondContact O-OG1 2.9Å; D82-T85 WeakPolarHBondContact O-CA 3.4Å; D82-T85 VanDerWaalsContact O-CB 3.31Å; D82-T85 WeakPolarHBondContact O-CB 3.25Å; D82-T85 PolarHBondContact O-N 3.36Å; T85-S87 PolarHBondContact O-N 3.41Å; T85-I88 WeakPolarHBondContact O-CB 3.46Å; T85-I88 PolarHBondContact O-N 3.41Å; T85-E89 PolarHBondContact O-N 2.88Å
86	D	97.2	Very high	95.7	Very high	94 Å²	94	67.6 Å²	67.6	50%	0.503	34%	0.34	S	S	.	.	H	α-helix	trans	-56.5	-39.5	176.5	-62	-23.4	0	0	0	111.8	D82 T90	D82-D86 PolarHBondContact O-N 2.82Å; D86-T90 WeakPolarHBondContact O-CB 3.31Å; D86-T90 PolarHBondContact O-N 2.93Å; D86-T90 PolarHBondContact O-OG1 3.11Å
87	S	96.4	Very high	95.8	Very high	51 Å²	51	69.7 Å²	69.7	36%	0.357	35%	0.354	S	S	.	.	H	α-helix	trans	-67.9	-39.3	176.2	-59.5	0	0	0	0	112	K83 I84 T85 T90 T91	K83-S87 WeakPolarHBondContact O-CB 3.38Å; K83-S87 PolarHBondContact O-N 3.24Å; K83-S87 PolarHBondContact O-OG 3.16Å; I84-S87 WeakPolarHBondContact O-CB 3.32Å; I84-S87 PolarHBondContact O-N 3.01Å; T85-S87 PolarHBondContact O-N 3.41Å; S87-T90 PolarHBondContact O-N 3.21Å; S87-T91 WeakPolarHBondContact O-CB 3.42Å; S87-T91 PolarHBondContact O-N 3.02Å; S87-T91 PolarHBondContact O-OG1 3.39Å
88	I	96.6	Very high	95.8	Very high	16 Å²	16	69 Å²	69	8%	0.082	35%	0.352	C	S	.	.	H	α-helix	trans	-63.1	-49.7	175.5	-70.6	162.8	0	0	0	109.6	L34 F38 I84 T85 T90 T91 Q92	L34-I88 HydrophobicContact CB-CD1 4.03Å; L34-I88 HydrophobicContact CB-CG1 3.49Å; L34-I88 VanDerWaalsContact CB-CG1 3.49Å; L34-I88 HydrophobicContact CD1-CG1 4.01Å; L34-I88 HydrophobicContact CG-CG1 4.35Å; F38-I88 HydrophobicContact CB-CD1 4.41Å; I84-I88 HydrophobicContact CG2-CD1 3.91Å; I84-I88 HydrophobicContact CG2-CG1 4.46Å; I84-I88 VanDerWaalsContact O-CG1 3.29Å; I84-I88 WeakPolarHBondContact O-CG1 3.36Å; I84-I88 PolarHBondContact O-N 3.01Å; T85-I88 WeakPolarHBondContact O-CB 3.46Å; T85-I88 PolarHBondContact O-N 3.41Å; I88-T90 VanDerWaalsContact C-N 3.33Å; I88-T90 PolarHBondContact O-N 3.07Å; I88-T91 PolarHBondContact O-N 2.9Å; I88-Q92 HydrophobicContact CG2-CG 4.35Å; I88-Q92 WeakPolarHBondContact O-CB 3.36Å; I88-Q92 VanDerWaalsContact O-CG 3.32Å; I88-Q92 WeakPolarHBondContact O-CG 3.27Å; I88-Q92 PolarHBondContact O-N 3.48Å
89	E	96.5	Very high	95.8	Very high	86 Å²	86	68.4 Å²	68.4	40%	0.402	35%	0.353	S	S	.	.	H	α-helix	trans	-59.1	-43.7	177.5	-73.7	-165.6	-162.9	0	0	112.3	T85 T91 Q92 K93	T85-E89 PolarHBondContact O-N 2.88Å; E89-T91 VanDerWaalsContact C-N 3.33Å; E89-T91 PolarHBondContact O-N 3.29Å; E89-Q92 PolarHBondContact O-N 3.34Å; E89-K93 WeakPolarHBondContact O-CB 3.29Å; E89-K93 WeakPolarHBondContact O-CD 3.46Å; E89-K93 VanDerWaalsContact O-CG 3.27Å; E89-K93 WeakPolarHBondContact O-CG 3.46Å; E89-K93 PolarHBondContact O-N 3.41Å; E89-K93 IonicContact OE2-NZ 3.16Å; E89-K93 PolarHBondContact OE2-NZ 2.9Å
90	T	96.6	Very high	95.7	Very high	91 Å²	91	67.5 Å²	67.5	56%	0.558	35%	0.353	S	S	*	.	H	α-helix	trans	-63.2	-41.5	178	-57.2	0	0	0	0	111.2	D86 S87 I88 K93 A94	D86-T90 WeakPolarHBondContact O-CB 3.31Å; D86-T90 PolarHBondContact O-N 2.93Å; D86-T90 PolarHBondContact O-OG1 3.11Å; S87-T90 PolarHBondContact O-N 3.21Å; I88-T90 VanDerWaalsContact C-N 3.33Å; I88-T90 PolarHBondContact O-N 3.07Å; T90-K93 PolarHBondContact O-N 3.02Å; T90-A94 PolarHBondContact O-N 2.92Å
91	T	95.4	Very high	95.7	Very high	18 Å²	18	69.2 Å²	69.2	11%	0.11	36%	0.359	C	S	.	.	H	α-helix	trans	-68.7	-35.6	177.2	-46.3	0	0	0	0	111.8	L27 Q30 I31 S87 I88 E89 R95	L27-T91 HydrophobicContact CB-CG2 4.37Å; L27-T91 HydrophobicContact CD2-CG2 3.7Å; Q30-T91 HydrophobicContact CB-CG2 4.03Å; I31-T91 HydrophobicContact CD1-CG2 4.15Å; I31-T91 HydrophobicContact CG1-CG2 3.66Å; S87-T91 WeakPolarHBondContact O-CB 3.42Å; S87-T91 PolarHBondContact O-N 3.02Å; S87-T91 PolarHBondContact O-OG1 3.39Å; I88-T91 PolarHBondContact O-N 2.9Å; E89-T91 VanDerWaalsContact C-N 3.33Å; E89-T91 PolarHBondContact O-N 3.29Å; T91-R95 WeakPolarHBondContact O-CB 3.46Å; T91-R95 PolarHBondContact O-N 3.23Å
92	Q	95.6	Very high	95.5	Very high	82 Å²	82	69.4 Å²	69.4	38%	0.383	36%	0.362	S	S	.	.	H	α-helix	trans	-65.8	-48.1	172.9	-74	171.3	-12.8	0	0	111.5	I31 I88 E89 A94 R95 D96	I31-Q92 HydrophobicContact CD1-CG 3.93Å; I31-Q92 HydrophobicContact CG1-CG 4.45Å; I88-Q92 HydrophobicContact CG2-CG 4.35Å; I88-Q92 WeakPolarHBondContact O-CB 3.36Å; I88-Q92 VanDerWaalsContact O-CG 3.32Å; I88-Q92 WeakPolarHBondContact O-CG 3.27Å; I88-Q92 PolarHBondContact O-N 3.48Å; E89-Q92 PolarHBondContact O-N 3.34Å; Q92-A94 VanDerWaalsContact C-N 3.29Å; Q92-A94 PolarHBondContact O-N 3.42Å; Q92-R95 WeakPolarHBondContact O-CA 3.42Å; Q92-R95 VanDerWaalsContact O-CB 3.25Å; Q92-R95 WeakPolarHBondContact O-CB 3.39Å; Q92-R95 PolarHBondContact O-N 2.9Å; Q92-D96 VanDerWaalsContact O-CG 3.31Å; Q92-D96 PolarHBondContact O-N 3.13Å
93	K	96.8	Very high	95.4	Very high	118 Å²	118	67.6 Å²	67.6	51%	0.513	36%	0.357	S	S	.	.	H	α-helix	trans	-56.3	-43.1	175.4	-71.3	161.4	-169.1	159.9	0	111.4	E89 T90 R95 D96 T97	E89-K93 WeakPolarHBondContact O-CB 3.29Å; E89-K93 WeakPolarHBondContact O-CD 3.46Å; E89-K93 VanDerWaalsContact O-CG 3.27Å; E89-K93 WeakPolarHBondContact O-CG 3.46Å; E89-K93 PolarHBondContact O-N 3.41Å; E89-K93 IonicContact OE2-NZ 3.16Å; E89-K93 PolarHBondContact OE2-NZ 2.9Å; T90-K93 PolarHBondContact O-N 3.02Å; K93-R95 PolarHBondContact O-N 3.28Å; K93-D96 PolarHBondContact O-N 3.4Å; K93-T97 PolarHBondContact O-N 3.49Å; K93-T97 PolarHBondContact O-OG1 3.02Å; K93-T97 VanDerWaalsContact O-OG1 3.07Å
94	A	95.7	Very high	95.2	Very high	42 Å²	42	68 Å²	68	35%	0.347	36%	0.36	S	S	.	.	H	α-helix	trans	-62.9	-38.5	175.2	0	0	0	0	0	113.2	L27 T90 Q92 T97 V98	L27-A94 HydrophobicContact CD2-CB 4.2Å; T90-A94 PolarHBondContact O-N 2.92Å; Q92-A94 VanDerWaalsContact C-N 3.29Å; Q92-A94 PolarHBondContact O-N 3.42Å; A94-T97 PolarHBondContact O-N 3.5Å; A94-V98 WeakPolarHBondContact O-CG2 3.46Å; A94-V98 PolarHBondContact O-N 3.24Å; A94-V98 VanDerWaalsContact O-N 3.14Å
95	R	94.6	Very high	95	Very high	99 Å²	99	67.2 Å²	67.2	37%	0.374	36%	0.357	S	S	.	.	H	α-helix	trans	-63.6	-42.3	174.1	-170	-151.1	-151.9	-154.4	10.4	111.5	F24 L27 N28 T91 Q92 K93 V98 N99	F24-R95 HydrophobicContact CD1-CG 3.83Å; F24-R95 HydrophobicContact CE1-CG 4.02Å; F24-R95 WeakPolarHBondContact CE1-O 3.36Å; L27-R95 HydrophobicContact CB-CB 4.47Å; L27-R95 HydrophobicContact CD1-CB 4.13Å; N28-R95 VanDerWaalsContact OD1-CZ 3.25Å; N28-R95 PolarHBondContact OD1-NE 3.43Å; N28-R95 PolarHBondContact OD1-NH2 2.85Å; T91-R95 WeakPolarHBondContact O-CB 3.46Å; T91-R95 PolarHBondContact O-N 3.23Å; Q92-R95 WeakPolarHBondContact O-CA 3.42Å; Q92-R95 VanDerWaalsContact O-CB 3.25Å; Q92-R95 WeakPolarHBondContact O-CB 3.39Å; Q92-R95 PolarHBondContact O-N 2.9Å; K93-R95 PolarHBondContact O-N 3.28Å; R95-V98 PolarHBondContact O-N 2.83Å; R95-N99 PolarHBondContact O-N 2.98Å
96	D	95.6	Very high	94.8	Very high	83 Å²	83	71.6 Å²	71.6	44%	0.444	37%	0.372	S	S	.	.	H	α-helix	trans	-69.3	-35.8	179.1	-61.4	-22.8	0	0	0	111.2	Q92 K93 N99 N100	Q92-D96 VanDerWaalsContact O-CG 3.31Å; Q92-D96 PolarHBondContact O-N 3.13Å; K93-D96 PolarHBondContact O-N 3.4Å; D96-N99 WeakPolarHBondContact O-CB 3.38Å; D96-N99 PolarHBondContact O-N 2.98Å; D96-N100 PolarHBondContact O-N 3.2Å; D96-N100 PolarHBondContact O-ND2 2.88Å; D96-N100 PolarHBondContact O-OD1 2.87Å
97	T	95.7	Very high	94.5	Very high	72 Å²	72	72.7 Å²	72.7	44%	0.442	37%	0.374	S	S	.	.	H	α-helix	trans	-57.8	-50.1	169.6	-56.7	0	0	0	0	111.8	K93 A94 N99 N100 E101	K93-T97 PolarHBondContact O-N 3.49Å; K93-T97 PolarHBondContact O-OG1 3.02Å; K93-T97 VanDerWaalsContact O-OG1 3.07Å; A94-T97 PolarHBondContact O-N 3.5Å; T97-N99 PolarHBondContact O-N 2.82Å; T97-N100 PolarHBondContact O-N 3.47Å; T97-N100 VanDerWaalsContact O-N 3.11Å; T97-E101 WeakPolarHBondContact O-CG 3.36Å; T97-E101 PolarHBondContact O-N 3.3Å
98	V	94.5	Very high	94.2	Very high	14 Å²	14	73 Å²	73	9%	0.085	38%	0.38	C	S	.	.	H	α-helix	trans	-60.3	-34.8	177	173.5	0	0	0	0	111.7	A20 Q23 F24 L27 A94 R95 L102	A20-V98 HydrophobicContact CB-CG1 3.77Å; Q23-V98 HydrophobicContact CB-CG1 4.24Å; Q23-V98 HydrophobicContact CB-CG2 4.32Å; F24-V98 HydrophobicContact CD1-CG1 4.28Å; F24-V98 HydrophobicContact CD2-CG1 4.4Å; F24-V98 HydrophobicContact CE1-CB 4.19Å; F24-V98 HydrophobicContact CE1-CG1 3.97Å; F24-V98 HydrophobicContact CE2-CG1 4.09Å; F24-V98 HydrophobicContact CG-CG1 4.49Å; F24-V98 HydrophobicContact CZ-CB 4.41Å; F24-V98 HydrophobicContact CZ-CG1 3.88Å; L27-V98 HydrophobicContact CD1-CG2 4.3Å; A94-V98 WeakPolarHBondContact O-CG2 3.46Å; A94-V98 PolarHBondContact O-N 3.24Å; A94-V98 VanDerWaalsContact O-N 3.14Å; R95-V98 PolarHBondContact O-N 2.83Å; V98-L102 WeakPolarHBondContact O-CB 3.46Å; V98-L102 PolarHBondContact O-N 3.12Å; V98-L102 VanDerWaalsContact O-N 3.13Å
99	N	94.5	Very high	93.9	Very high	82 Å²	82	73.7 Å²	73.7	44%	0.439	38%	0.384	S	S	.	.	H	α-helix	trans	-68.4	-40.5	174.6	-174.3	77.2	0	0	0	113	F24 R95 D96 T97 L102 S103	F24-N99 HydrophobicContact CE1-CB 4.04Å; F24-N99 HydrophobicContact CZ-CB 3.78Å; R95-N99 PolarHBondContact O-N 2.98Å; D96-N99 WeakPolarHBondContact O-CB 3.38Å; D96-N99 PolarHBondContact O-N 2.98Å; T97-N99 PolarHBondContact O-N 2.82Å; N99-L102 PolarHBondContact O-N 3.34Å; N99-S103 PolarHBondContact O-N 2.92Å
100	N	95	Very high	93.6	Very high	86 Å²	86	78.8 Å²	78.8	46%	0.46	40%	0.399	S	S	.	.	H	α-helix	trans	-66.7	-46.8	176.8	-65.4	-12.9	0	0	0	110.8	D96 T97 L102 S103 E104	D96-N100 PolarHBondContact O-N 3.2Å; D96-N100 PolarHBondContact O-ND2 2.88Å; D96-N100 PolarHBondContact O-OD1 2.87Å; T97-N100 PolarHBondContact O-N 3.47Å; T97-N100 VanDerWaalsContact O-N 3.11Å; N100-L102 PolarHBondContact O-N 3.5Å; N100-S103 WeakPolarHBondContact O-CA 3.49Å; N100-S103 WeakPolarHBondContact O-CB 3.09Å; N100-S103 PolarHBondContact O-N 3.42Å; N100-E104 WeakPolarHBondContact O-CG 3.44Å; N100-E104 PolarHBondContact O-N 3.42Å
101	E	92.1	Very high	93.2	Very high	103 Å²	103	80.9 Å²	80.9	48%	0.481	40%	0.403	S	S	.	.	H	α-helix	trans	-56.2	-37.4	174.6	-71.9	178.8	-166.2	0	0	112.7	T97 S105	T97-E101 WeakPolarHBondContact O-CG 3.36Å; T97-E101 PolarHBondContact O-N 3.3Å; E101-S105 VanDerWaalsContact O-CB 3.31Å; E101-S105 WeakPolarHBondContact O-CB 3.36Å; E101-S105 PolarHBondContact O-N 2.97Å
102	L	92.8	Very high	92.9	Very high	36 Å²	36	82.5 Å²	82.5	19%	0.188	41%	0.41	C	S	.	.	H	α-helix	trans	-70.8	-38.7	175.8	-176.4	60.4	0	0	0	112.1	T17 A20 F24 V98 N99 N100 K106	T17-L102 HydrophobicContact CG2-CD1 4.45Å; A20-L102 HydrophobicContact CB-CD1 4.39Å; A20-L102 HydrophobicContact CB-CD2 4.23Å; F24-L102 HydrophobicContact CE2-CD2 4.03Å; V98-L102 WeakPolarHBondContact O-CB 3.46Å; V98-L102 PolarHBondContact O-N 3.12Å; V98-L102 VanDerWaalsContact O-N 3.13Å; N99-L102 PolarHBondContact O-N 3.34Å; N100-L102 PolarHBondContact O-N 3.5Å; L102-K106 WeakPolarHBondContact O-CB 3.39Å; L102-K106 PolarHBondContact O-N 2.89Å; L102-K106 VanDerWaalsContact O-N 3.12Å
103	S	93.3	Very high	92.5	Very high	53 Å²	53	82 Å²	82	37%	0.371	41%	0.41	S	S	.	.	H	α-helix	trans	-66.6	-49.4	175.7	-162.9	0	0	0	0	111.5	N99 N100 S105 K106 E107	N99-S103 PolarHBondContact O-N 2.92Å; N100-S103 WeakPolarHBondContact O-CA 3.49Å; N100-S103 WeakPolarHBondContact O-CB 3.09Å; N100-S103 PolarHBondContact O-N 3.42Å; S103-S105 VanDerWaalsContact C-N 3.28Å; S103-S105 PolarHBondContact O-N 3.36Å; S103-K106 WeakPolarHBondContact O-CA 3.31Å; S103-K106 WeakPolarHBondContact O-CB 3.35Å; S103-K106 PolarHBondContact O-N 3.14Å; S103-E107 PolarHBondContact O-N 3.3Å
104	E	92.1	Very high	92	Very high	126 Å²	126	79.1 Å²	79.1	59%	0.589	41%	0.405	S	S	*	.	H	α-helix	trans	-55.5	-43.9	173.8	-71.2	171	-163.5	0	0	111.2	N100 K106 E107 A108	N100-E104 WeakPolarHBondContact O-CG 3.44Å; N100-E104 PolarHBondContact O-N 3.42Å; E104-K106 PolarHBondContact O-N 3.07Å; E104-E107 PolarHBondContact O-N 2.91Å; E104-A108 WeakPolarHBondContact O-CB 3.5Å; E104-A108 PolarHBondContact O-N 2.91Å
105	S	91.2	Very high	91.5	Very high	12 Å²	12	80.2 Å²	80.2	8%	0.084	41%	0.41	C	S	.	.	H	α-helix	trans	-64.6	-27.8	176.6	-173.8	0	0	0	0	113.6	H13 K16 E101 S103 L109	H13-S105 PolarHBondContact ND1-O 3.09Å; H13-S105 PolarHBondContact ND1-OG 3.3Å; K16-S105 VanDerWaalsContact CD-OG 3.29Å; K16-S105 WeakPolarHBondContact CD-OG 3.49Å; E101-S105 VanDerWaalsContact O-CB 3.31Å; E101-S105 WeakPolarHBondContact O-CB 3.36Å; E101-S105 PolarHBondContact O-N 2.97Å; S103-S105 VanDerWaalsContact C-N 3.28Å; S103-S105 PolarHBondContact O-N 3.36Å; S105-L109 PolarHBondContact O-N 2.88Å
106	K	91.9	Very high	90.5	Very high	140 Å²	140	82.2 Å²	82.2	61%	0.609	42%	0.421	S	S	*	.	H	α-helix	trans	-79.8	-38.1	177	179.5	-172.9	175.8	-172	0	111.1	L102 S103 E104 L109 R110	L102-K106 WeakPolarHBondContact O-CB 3.39Å; L102-K106 PolarHBondContact O-N 2.89Å; L102-K106 VanDerWaalsContact O-N 3.12Å; S103-K106 WeakPolarHBondContact O-CA 3.31Å; S103-K106 WeakPolarHBondContact O-CB 3.35Å; S103-K106 PolarHBondContact O-N 3.14Å; E104-K106 PolarHBondContact O-N 3.07Å; K106-L109 PolarHBondContact O-N 2.88Å; K106-R110 PolarHBondContact O-N 3.01Å
107	E	92.7	Very high	89.3	Confident	116 Å²	116	86.7 Å²	86.7	54%	0.542	44%	0.439	S	S	.	.	H	α-helix	trans	-67.5	-47.4	175.6	-70.7	-175.6	165.3	0	0	111.5	S103 E104 L109 R110 E111	S103-E107 PolarHBondContact O-N 3.3Å; E104-E107 PolarHBondContact O-N 2.91Å; E107-L109 PolarHBondContact O-N 2.93Å; E107-R110 CarbonylContact O-C 3.59Å; E107-R110 WeakPolarHBondContact O-CA 3.37Å; E107-R110 WeakPolarHBondContact O-CB 3.34Å; E107-R110 PolarHBondContact O-N 3.22Å; E107-E111 PolarHBondContact O-N 3.47Å
108	A	89.6	Confident	87.3	Confident	57 Å²	57	90.8 Å²	90.8	47%	0.471	47%	0.471	S	S	.	.	H	α-helix	trans	-57.2	-36.7	174.3	0	0	0	0	0	112.8	E104 L112	E104-A108 WeakPolarHBondContact O-CB 3.5Å; E104-A108 PolarHBondContact O-N 2.91Å; A108-L112 WeakPolarHBondContact O-CB 3.27Å; A108-L112 PolarHBondContact O-N 3.08Å; A108-L112 VanDerWaalsContact O-N 3.08Å
109	L	89.4	Confident	87	Confident	32 Å²	32	94.6 Å²	94.6	17%	0.168	49%	0.49	C	S	.	.	H	α-helix	trans	-69.6	-38.5	173.3	-177.8	147.5	0	0	0	111.9	I10 H13 S105 K106 E107 L112 L113	I10-L109 HydrophobicContact CG1-CD1 4.08Å; H13-L109 HydrophobicContact CB-CD1 3.55Å; S105-L109 PolarHBondContact O-N 2.88Å; K106-L109 PolarHBondContact O-N 2.88Å; E107-L109 PolarHBondContact O-N 2.93Å; L109-L112 PolarHBondContact O-N 3.45Å; L109-L113 HydrophobicContact CD2-CD1 3.64Å; L109-L113 HydrophobicContact CD2-CG 4.31Å; L109-L113 WeakPolarHBondContact O-CG 3.48Å; L109-L113 PolarHBondContact O-N 2.99Å
110	R	90.5	Very high	86.6	Confident	193 Å²	193	95.3 Å²	95.3	73%	0.728	49%	0.493	S	S	*	.	H	α-helix	trans	-63.8	-44.1	176.3	-174.1	-174.2	179.2	101.3	0.5	111.6	K106 E107 L113 S114	K106-R110 PolarHBondContact O-N 3.01Å; E107-R110 CarbonylContact O-C 3.59Å; E107-R110 WeakPolarHBondContact O-CA 3.37Å; E107-R110 WeakPolarHBondContact O-CB 3.34Å; E107-R110 PolarHBondContact O-N 3.22Å; R110-L113 PolarHBondContact O-N 2.98Å; R110-S114 PolarHBondContact O-N 3.2Å; R110-S114 PolarHBondContact O-OG 3.06Å
111	E	89.4	Confident	86.1	Confident	134 Å²	134	95.8 Å²	95.8	63%	0.626	50%	0.495	S	S	*	.	H	α-helix	trans	-64.4	-40.4	176.2	-69.1	-177.2	163.7	0	0	112.2	E107 L113 S114 S115	E107-E111 PolarHBondContact O-N 3.47Å; E111-L113 VanDerWaalsContact C-N 3.3Å; E111-L113 PolarHBondContact O-N 3.26Å; E111-S114 WeakPolarHBondContact CA-OG 3.42Å; E111-S114 PolarHBondContact O-N 2.72Å; E111-S114 PolarHBondContact O-OG 3.43Å; E111-S115 VanDerWaalsContact O-CB 3.27Å; E111-S115 WeakPolarHBondContact O-CB 3.36Å; E111-S115 PolarHBondContact O-N 3.17Å; E111-S115 PolarHBondContact O-OG 3.26Å
112	L	88	Confident	85.8	Confident	52 Å²	52	95.4 Å²	95.4	27%	0.272	50%	0.496	S	S	.	.	H	α-helix	trans	-63.6	-36.7	174.4	-167.5	153.7	0	0	0	111.3	V6 A9 A108 L109 S115 K116	V6-L112 HydrophobicContact CB-CD2 4.33Å; V6-L112 HydrophobicContact CG2-CD2 3.8Å; A9-L112 HydrophobicContact CB-CD1 3.8Å; A9-L112 HydrophobicContact CB-CD2 4.41Å; A108-L112 WeakPolarHBondContact O-CB 3.27Å; A108-L112 PolarHBondContact O-N 3.08Å; A108-L112 VanDerWaalsContact O-N 3.08Å; L109-L112 PolarHBondContact O-N 3.45Å; L112-S115 PolarHBondContact O-OG 3.26Å; L112-K116 WeakPolarHBondContact O-CG 3.18Å
113	L	86.7	Confident	85.3	Confident	71 Å²	71	99.1 Å²	99.1	37%	0.372	52%	0.515	S	S	.	.	H	α-helix	trans	-73.1	-43.3	175.3	-70	176.3	0	0	0	112.9	V6 L109 R110 E111 K116 Q117	V6-L113 HydrophobicContact CG1-CD2 3.78Å; L109-L113 HydrophobicContact CD2-CD1 3.64Å; L109-L113 HydrophobicContact CD2-CG 4.31Å; L109-L113 WeakPolarHBondContact O-CG 3.48Å; L109-L113 PolarHBondContact O-N 2.99Å; R110-L113 PolarHBondContact O-N 2.98Å; E111-L113 VanDerWaalsContact C-N 3.3Å; E111-L113 PolarHBondContact O-N 3.26Å; L113-K116 PolarHBondContact O-N 3.3Å; L113-Q117 PolarHBondContact O-N 3.44Å
114	S	87.5	Confident	84.8	Confident	59 Å²	59	102.1 Å²	102.1	41%	0.413	53%	0.525	S	S	.	.	H	α-helix	trans	-66.9	-40.5	-179.4	60.4	0	0	0	0	112.3	R110 E111 K116 Q117 S118	R110-S114 PolarHBondContact O-N 3.2Å; R110-S114 PolarHBondContact O-OG 3.06Å; E111-S114 WeakPolarHBondContact CA-OG 3.42Å; E111-S114 PolarHBondContact O-N 2.72Å; E111-S114 PolarHBondContact O-OG 3.43Å; S114-K116 PolarHBondContact O-N 2.9Å; S114-Q117 PolarHBondContact O-N 3.23Å; S114-S118 PolarHBondContact O-N 3.04Å
115	S	84.2	Confident	84.3	Confident	65 Å²	65	100.4 Å²	100.4	46%	0.455	52%	0.52	S	S	.	.	H	α-helix	trans	-69.2	3.4	174.3	63.6	0	0	0	0	115	E111 L112	E111-S115 VanDerWaalsContact O-CB 3.27Å; E111-S115 WeakPolarHBondContact O-CB 3.36Å; E111-S115 PolarHBondContact O-N 3.17Å; E111-S115 PolarHBondContact O-OG 3.26Å; L112-S115 PolarHBondContact O-OG 3.26Å
116	K	74.7	Confident	83.7	Confident	141 Å²	141	107.2 Å²	107.2	61%	0.613	55%	0.553	S	S	*	*	H	α-helix	trans	-116.9	-9.5	169.8	-58	-64.6	173	-138.8	0	113.3	L112 L113 S114	L112-K116 WeakPolarHBondContact O-CG 3.18Å; L113-K116 PolarHBondContact O-N 3.3Å; S114-K116 PolarHBondContact O-N 2.9Å
117	Q	68.9	Low	83	Confident	176 Å²	176	104.5 Å²	104.5	82%	0.822	55%	0.549	S	S	*	.	H	α-helix	trans	-91.5	-19.9	171.7	-73.5	-174.1	-26	0	0	112.7	L113 S114	L113-Q117 PolarHBondContact O-N 3.44Å; S114-Q117 PolarHBondContact O-N 3.23Å
118	S	55.1	Low	82.2	Confident	158 Å²	158	103.5 Å²	103.5	100%	1.105	55%	0.55	S	S	*	.			trans	-92.6	0	168.6	-51.9	0	0	0	0	110.9	S114	S114-S118 PolarHBondContact O-N 3.04Å

Retrieved 118 of 118 residues in 27.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).